diff bwa-0.6.2/stdaln.c @ 2:a294fbfcb1db draft default tip

Uploaded BWA
author ashvark
date Fri, 18 Jul 2014 07:55:59 -0400
parents dd1186b11b3b
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/bwa-0.6.2/stdaln.c	Fri Jul 18 07:55:59 2014 -0400
@@ -0,0 +1,1072 @@
+/* The MIT License
+
+   Copyright (c) 2003-2006, 2008, 2009, by Heng Li <lh3lh3@gmail.com>
+
+   Permission is hereby granted, free of charge, to any person obtaining
+   a copy of this software and associated documentation files (the
+   "Software"), to deal in the Software without restriction, including
+   without limitation the rights to use, copy, modify, merge, publish,
+   distribute, sublicense, and/or sell copies of the Software, and to
+   permit persons to whom the Software is furnished to do so, subject to
+   the following conditions:
+
+   The above copyright notice and this permission notice shall be
+   included in all copies or substantial portions of the Software.
+
+   THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+   EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+   MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
+   NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS
+   BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN
+   ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN
+   CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
+   SOFTWARE.
+*/
+
+#include <stdlib.h>
+#include <stdio.h>
+#include <string.h>
+#include <stdint.h>
+#include "stdaln.h"
+
+/* char -> 17 (=16+1) nucleotides */
+unsigned char aln_nt16_table[256] = {
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,16 /*'-'*/,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
+	15,15, 3, 6,  8,15, 7, 9,  0,12,15,15, 15,15,15,15,
+	15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
+	15,15, 3, 6,  8,15, 7, 9,  0,12,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
+	15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15
+};
+char *aln_nt16_rev_table = "XAGRCMSVTWKDYHBN-";
+
+/* char -> 5 (=4+1) nucleotides */
+unsigned char aln_nt4_table[256] = {
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 5 /*'-'*/, 4, 4,
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 0, 4, 2,  4, 4, 4, 1,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  3, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 0, 4, 2,  4, 4, 4, 1,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  3, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4, 
+	4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4,  4, 4, 4, 4
+};
+char *aln_nt4_rev_table = "AGCTN-";
+
+/* char -> 22 (=20+1+1) amino acids */
+unsigned char aln_aa_table[256] = {
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,20,21, 21,22 /*'-'*/,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21, 0,21, 4,  3, 6,13, 7,  8, 9,21,11, 10,12, 2,21,
+	14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
+	21, 0,21, 4,  3, 6,13, 7,  8, 9,21,11, 10,12, 2,21,
+	14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
+	21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21
+};
+char *aln_aa_rev_table = "ARNDCQEGHILKMFPSTWYV*X-";
+                       /* 01234567890123456789012 */
+
+/* translation table. They are useless in stdaln.c, but when you realize you need it, you need not write the table again. */
+unsigned char aln_trans_table_eu[66] = {
+	11,11, 2, 2,  1, 1,15,15, 16,16,16,16,  9,12, 9, 9,
+	 6, 6, 3, 3,  7, 7, 7, 7,  0, 0, 0, 0, 19,19,19,19,
+	 5, 5, 8, 8,  1, 1, 1, 1, 14,14,14,14, 10,10,10,10,
+	20,20,18,18, 20,17, 4, 4, 15,15,15,15, 10,10,13,13, 21, 22
+};
+char *aln_trans_table_eu_char = "KKNNRRSSTTTTIMIIEEDDGGGGAAAAVVVVQQHHRRRRPPPPLLLL**YY*WCCSSSSLLFFX";
+                              /* 01234567890123456789012345678901234567890123456789012345678901234 */
+int aln_sm_blosum62[] = {
+/*	 A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  *  X */
+	 4,-1,-2,-2, 0,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-3,-2, 0,-4, 0,
+	-1, 5, 0,-2,-3, 1, 0,-2, 0,-3,-2, 2,-1,-3,-2,-1,-1,-3,-2,-3,-4,-1,
+	-2, 0, 6, 1,-3, 0, 0, 0, 1,-3,-3, 0,-2,-3,-2, 1, 0,-4,-2,-3,-4,-1,
+	-2,-2, 1, 6,-3, 0, 2,-1,-1,-3,-4,-1,-3,-3,-1, 0,-1,-4,-3,-3,-4,-1,
+	 0,-3,-3,-3, 9,-3,-4,-3,-3,-1,-1,-3,-1,-2,-3,-1,-1,-2,-2,-1,-4,-2,
+	-1, 1, 0, 0,-3, 5, 2,-2, 0,-3,-2, 1, 0,-3,-1, 0,-1,-2,-1,-2,-4,-1,
+	-1, 0, 0, 2,-4, 2, 5,-2, 0,-3,-3, 1,-2,-3,-1, 0,-1,-3,-2,-2,-4,-1,
+	 0,-2, 0,-1,-3,-2,-2, 6,-2,-4,-4,-2,-3,-3,-2, 0,-2,-2,-3,-3,-4,-1,
+	-2, 0, 1,-1,-3, 0, 0,-2, 8,-3,-3,-1,-2,-1,-2,-1,-2,-2, 2,-3,-4,-1,
+	-1,-3,-3,-3,-1,-3,-3,-4,-3, 4, 2,-3, 1, 0,-3,-2,-1,-3,-1, 3,-4,-1,
+	-1,-2,-3,-4,-1,-2,-3,-4,-3, 2, 4,-2, 2, 0,-3,-2,-1,-2,-1, 1,-4,-1,
+	-1, 2, 0,-1,-3, 1, 1,-2,-1,-3,-2, 5,-1,-3,-1, 0,-1,-3,-2,-2,-4,-1,
+	-1,-1,-2,-3,-1, 0,-2,-3,-2, 1, 2,-1, 5, 0,-2,-1,-1,-1,-1, 1,-4,-1,
+	-2,-3,-3,-3,-2,-3,-3,-3,-1, 0, 0,-3, 0, 6,-4,-2,-2, 1, 3,-1,-4,-1,
+	-1,-2,-2,-1,-3,-1,-1,-2,-2,-3,-3,-1,-2,-4, 7,-1,-1,-4,-3,-2,-4,-2,
+	 1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-2, 0,-1,-2,-1, 4, 1,-3,-2,-2,-4, 0,
+	 0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-2,-1, 1, 5,-2,-2, 0,-4, 0,
+	-3,-3,-4,-4,-2,-2,-3,-2,-2,-3,-2,-3,-1, 1,-4,-3,-2,11, 2,-3,-4,-2,
+	-2,-2,-2,-3,-2,-1,-2,-3, 2,-1,-1,-2,-1, 3,-3,-2,-2, 2, 7,-1,-4,-1,
+	 0,-3,-3,-3,-1,-2,-2,-3,-3, 3, 1,-2, 1,-1,-2,-2, 0,-3,-1, 4,-4,-1,
+	-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4, 1,-4,
+	 0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-2, 0, 0,-2,-1,-1,-4,-1
+};
+
+int aln_sm_blosum45[] = {
+/*	 A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  *  X */
+	 5,-2,-1,-2,-1,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-2,-2, 0,-5, 0,
+	-2, 7, 0,-1,-3, 1, 0,-2, 0,-3,-2, 3,-1,-2,-2,-1,-1,-2,-1,-2,-5,-1,
+	-1, 0, 6, 2,-2, 0, 0, 0, 1,-2,-3, 0,-2,-2,-2, 1, 0,-4,-2,-3,-5,-1,
+	-2,-1, 2, 7,-3, 0, 2,-1, 0,-4,-3, 0,-3,-4,-1, 0,-1,-4,-2,-3,-5,-1,
+	-1,-3,-2,-3,12,-3,-3,-3,-3,-3,-2,-3,-2,-2,-4,-1,-1,-5,-3,-1,-5,-2,
+	-1, 1, 0, 0,-3, 6, 2,-2, 1,-2,-2, 1, 0,-4,-1, 0,-1,-2,-1,-3,-5,-1,
+	-1, 0, 0, 2,-3, 2, 6,-2, 0,-3,-2, 1,-2,-3, 0, 0,-1,-3,-2,-3,-5,-1,
+	 0,-2, 0,-1,-3,-2,-2, 7,-2,-4,-3,-2,-2,-3,-2, 0,-2,-2,-3,-3,-5,-1,
+	-2, 0, 1, 0,-3, 1, 0,-2,10,-3,-2,-1, 0,-2,-2,-1,-2,-3, 2,-3,-5,-1,
+	-1,-3,-2,-4,-3,-2,-3,-4,-3, 5, 2,-3, 2, 0,-2,-2,-1,-2, 0, 3,-5,-1,
+	-1,-2,-3,-3,-2,-2,-2,-3,-2, 2, 5,-3, 2, 1,-3,-3,-1,-2, 0, 1,-5,-1,
+	-1, 3, 0, 0,-3, 1, 1,-2,-1,-3,-3, 5,-1,-3,-1,-1,-1,-2,-1,-2,-5,-1,
+	-1,-1,-2,-3,-2, 0,-2,-2, 0, 2, 2,-1, 6, 0,-2,-2,-1,-2, 0, 1,-5,-1,
+	-2,-2,-2,-4,-2,-4,-3,-3,-2, 0, 1,-3, 0, 8,-3,-2,-1, 1, 3, 0,-5,-1,
+	-1,-2,-2,-1,-4,-1, 0,-2,-2,-2,-3,-1,-2,-3, 9,-1,-1,-3,-3,-3,-5,-1,
+	 1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-3,-1,-2,-2,-1, 4, 2,-4,-2,-1,-5, 0,
+	 0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-1,-1, 2, 5,-3,-1, 0,-5, 0,
+	-2,-2,-4,-4,-5,-2,-3,-2,-3,-2,-2,-2,-2, 1,-3,-4,-3,15, 3,-3,-5,-2,
+	-2,-1,-2,-2,-3,-1,-2,-3, 2, 0, 0,-1, 0, 3,-3,-2,-1, 3, 8,-1,-5,-1,
+	 0,-2,-3,-3,-1,-3,-3,-3,-3, 3, 1,-2, 1, 0,-3,-1, 0,-3,-1, 5,-5,-1,
+	-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5, 1,-5,
+	 0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-1, 0, 0,-2,-1,-1,-5,-1
+};
+
+int aln_sm_nt[] = {
+/*	 X  A  G  R  C  M  S  V  T  W  K  D  Y  H  B  N */
+	-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,
+	-2, 2,-1, 1,-2, 1,-2, 0,-2, 1,-2, 0,-2, 0,-2, 0,
+	-2,-1, 2, 1,-2,-2, 1, 0,-2,-2, 1, 0,-2,-2, 0, 0,
+	-2, 1, 1, 1,-2,-1,-1, 0,-2,-1,-1, 0,-2, 0, 0, 0,
+	-2,-2,-2,-2, 2, 1, 1, 0,-1,-2,-2,-2, 1, 0, 0, 0,
+	-2, 1,-2,-1, 1, 1,-1, 0,-2,-1,-2, 0,-1, 0, 0, 0,
+	-2,-2, 1,-1, 1,-1, 1, 0,-2,-2,-1, 0,-1, 0, 0, 0,
+	-2, 0, 0, 0, 0, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0,
+	-2,-2,-2,-2,-1,-2,-2,-2, 2, 1, 1, 0, 1, 0, 0, 0,
+	-2, 1,-2,-1,-2,-1,-2, 0, 1, 1,-1, 0,-1, 0, 0, 0,
+	-2,-2, 1,-1,-2,-2,-1, 0, 1,-1, 1, 0,-1, 0, 0, 0,
+	-2, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+	-2,-2,-2,-2, 1,-1,-1, 0, 1,-1,-1, 0, 1, 0, 0, 0,
+	-2, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+	-2,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
+	-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0
+};
+
+int aln_sm_read[] = {
+/*	  X   A   G   R   C   M   S   V   T   W   K   D   Y   H   B   N  */
+	-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,
+	-17,  2,-17,  1,-17,  1,-17,  0,-17,  1,-17,  0,-17,  0,-17,  0,
+	-17,-17,  2,  1,-17,-17,  1,  0,-17,-17,  1,  0,-17,-17,  0,  0,
+	-17,  1,  1,  1,-17,-17,-17,  0,-17,-17,-17,  0,-17,  0,  0,  0,
+	-17,-17,-17,-17,  2,  1,  1,  0,-17,-17,-17,-17,  1,  0,  0,  0,
+	-17,  1,-17,-17,  1,  1,-17,  0,-17,-17,-17,  0,-17,  0,  0,  0,
+	-17,-17,  1,-17,  1,-17,  1,  0,-17,-17,-17,  0,-17,  0,  0,  0,
+	-17,  0,  0,  0,  0,  0,  0,  0,-17,  0,  0,  0,  0,  0,  0,  0,
+	-17,-17,-17,-17,-17,-17,-17,-17,  2,  1,  1,  0,  1,  0,  0,  0,
+	-17,  1,-17,-17,-17,-17,-17,  0,  1,  1,-17,  0,-17,  0,  0,  0,
+	-17,-17,  1,-17,-17,-17,-17,  0,  1,-17,  1,  0,-17,  0,  0,  0,
+	-17,  0,  0,  0,-17,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
+	-17,-17,-17,-17,  1,-17,-17,  0,  1,-17,-17,  0,  1,  0,  0,  0,
+	-17,  0,-17,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
+	-17,-17,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
+	-17,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0
+};
+
+int aln_sm_hs[] = {
+/*     A    G    C    T    N */
+	  91, -31,-114,-123, -44,
+	 -31, 100,-125,-114, -42,
+	-123,-125, 100, -31, -42,
+	-114,-114, -31,  91, -42,
+	 -44, -42, -42, -42, -43
+};
+
+int aln_sm_maq[] = {
+	11, -19, -19, -19, -13,
+	-19, 11, -19, -19, -13,
+	-19, -19, 11, -19, -13,
+	-19, -19, -19, 11, -13,
+	-13, -13, -13, -13, -13
+};
+
+int aln_sm_blast[] = {
+	1, -3, -3, -3, -2,
+	-3, 1, -3, -3, -2,
+	-3, -3, 1, -3, -2,
+	-3, -3, -3, 1, -2,
+	-2, -2, -2, -2, -2
+};
+
+/********************/
+/* START OF align.c */
+/********************/
+
+AlnParam aln_param_blast   = {  5,  2,  2, aln_sm_blast, 5, 50 };
+AlnParam aln_param_bwa     = { 26,  9,  5, aln_sm_maq, 5, 50 };
+AlnParam aln_param_nt2nt   = {  8,  2,  2, aln_sm_nt, 16, 75 };
+AlnParam aln_param_rd2rd   = {  1, 19, 19, aln_sm_read, 16, 75 };
+AlnParam aln_param_aa2aa   = { 10,  2,  2, aln_sm_blosum62, 22, 50 };
+
+AlnAln *aln_init_AlnAln()
+{
+	AlnAln *aa;
+	aa = (AlnAln*)malloc(sizeof(AlnAln));
+	aa->path = 0;
+	aa->out1 = aa->out2 = aa->outm = 0;
+	aa->path_len = 0;
+	return aa;
+}
+void aln_free_AlnAln(AlnAln *aa)
+{
+	free(aa->path); free(aa->cigar32);
+	free(aa->out1); free(aa->out2); free(aa->outm);
+	free(aa);
+}
+
+/***************************/
+/* START OF common_align.c */
+/***************************/
+
+#define LOCAL_OVERFLOW_THRESHOLD 32000
+#define LOCAL_OVERFLOW_REDUCE 16000
+#define NT_LOCAL_SCORE int
+#define NT_LOCAL_SHIFT 16
+#define NT_LOCAL_MASK 0xffff
+
+#define SET_INF(s) (s).M = (s).I = (s).D = MINOR_INF;
+
+#define set_M(MM, cur, p, sc)							\
+{														\
+	if ((p)->M >= (p)->I) {								\
+		if ((p)->M >= (p)->D) {							\
+			(MM) = (p)->M + (sc); (cur)->Mt = FROM_M;	\
+		} else {										\
+			(MM) = (p)->D + (sc); (cur)->Mt = FROM_D;	\
+		}												\
+	} else {											\
+		if ((p)->I > (p)->D) {							\
+			(MM) = (p)->I + (sc); (cur)->Mt = FROM_I;	\
+		} else {										\
+			(MM) = (p)->D + (sc); (cur)->Mt = FROM_D;	\
+		}												\
+	}													\
+}
+#define set_I(II, cur, p)								\
+{														\
+	if ((p)->M - gap_open > (p)->I) {					\
+		(cur)->It = FROM_M;								\
+		(II) = (p)->M - gap_open - gap_ext;				\
+	} else {											\
+		(cur)->It = FROM_I;								\
+		(II) = (p)->I - gap_ext;						\
+	}													\
+}
+#define set_end_I(II, cur, p)							\
+{														\
+	if (gap_end >= 0) {									\
+		if ((p)->M - gap_open > (p)->I) {				\
+			(cur)->It = FROM_M;							\
+			(II) = (p)->M - gap_open - gap_end;			\
+		} else {										\
+			(cur)->It = FROM_I;							\
+			(II) = (p)->I - gap_end;					\
+		}												\
+	} else set_I(II, cur, p);							\
+}
+#define set_D(DD, cur, p)								\
+{														\
+	if ((p)->M - gap_open > (p)->D) {					\
+		(cur)->Dt = FROM_M;								\
+		(DD) = (p)->M - gap_open - gap_ext;				\
+	} else {											\
+		(cur)->Dt = FROM_D;								\
+		(DD) = (p)->D - gap_ext;						\
+	}													\
+}
+#define set_end_D(DD, cur, p)							\
+{														\
+	if (gap_end >= 0) {									\
+		if ((p)->M - gap_open > (p)->D) {				\
+			(cur)->Dt = FROM_M;							\
+			(DD) = (p)->M - gap_open - gap_end;			\
+		} else {										\
+			(cur)->Dt = FROM_D;							\
+			(DD) = (p)->D - gap_end;					\
+		}												\
+	} else set_D(DD, cur, p);							\
+}
+
+typedef struct
+{
+	unsigned char Mt:3, It:2, Dt:2;
+} dpcell_t;
+
+typedef struct
+{
+	int M, I, D;
+} dpscore_t;
+
+/* build score profile for accelerating alignment, in theory */
+void aln_init_score_array(unsigned char *seq, int len, int row, int *score_matrix, int **s_array)
+{
+	int *tmp, *tmp2, i, k;
+	for (i = 0; i != row; ++i) {
+		tmp = score_matrix + i * row;
+		tmp2 = s_array[i];
+		for (k = 0; k != len; ++k)
+			tmp2[k] = tmp[seq[k]];
+	}
+}
+/***************************
+ * banded global alignment *
+ ***************************/
+int aln_global_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
+					path_t *path, int *path_len)
+{
+	register int i, j;
+	dpcell_t **dpcell, *q;
+	dpscore_t *curr, *last, *s;
+	path_t *p;
+	int b1, b2, tmp_end;
+	int *mat, end, max;
+	unsigned char type, ctype;
+
+	int gap_open, gap_ext, gap_end, b;
+	int *score_matrix, N_MATRIX_ROW;
+
+	/* initialize some align-related parameters. just for compatibility */
+	gap_open = ap->gap_open;
+	gap_ext = ap->gap_ext;
+	gap_end = ap->gap_end;
+	b = ap->band_width;
+	score_matrix = ap->matrix;
+	N_MATRIX_ROW = ap->row;
+	
+	if (len1 == 0 || len2 == 0) {
+		*path_len = 0;
+		return 0;
+	}
+	/* calculate b1 and b2 */
+	if (len1 > len2) {
+		b1 = len1 - len2 + b;
+		b2 = b;
+	} else {
+		b1 = b;
+		b2 = len2 - len1 + b;
+	}
+	if (b1 > len1) b1 = len1;
+	if (b2 > len2) b2 = len2;
+	--seq1; --seq2;
+
+	/* allocate memory */
+	end = (b1 + b2 <= len1)? (b1 + b2 + 1) : (len1 + 1);
+	dpcell = (dpcell_t**)malloc(sizeof(dpcell_t*) * (len2 + 1));
+	for (j = 0; j <= len2; ++j)
+		dpcell[j] = (dpcell_t*)malloc(sizeof(dpcell_t) * end);
+	for (j = b2 + 1; j <= len2; ++j)
+		dpcell[j] -= j - b2;
+	curr = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
+	last = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
+	
+	/* set first row */
+	SET_INF(*curr); curr->M = 0;
+	for (i = 1, s = curr + 1; i < b1; ++i, ++s) {
+		SET_INF(*s);
+		set_end_D(s->D, dpcell[0] + i, s - 1);
+	}
+	s = curr; curr = last; last = s;
+
+	/* core dynamic programming, part 1 */
+	tmp_end = (b2 < len2)? b2 : len2 - 1;
+	for (j = 1; j <= tmp_end; ++j) {
+		q = dpcell[j]; s = curr; SET_INF(*s);
+		set_end_I(s->I, q, last);
+		end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
+		mat = score_matrix + seq2[j] * N_MATRIX_ROW;
+		++s; ++q;
+		for (i = 1; i != end; ++i, ++s, ++q) {
+			set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
+			set_I(s->I, q, last + i);
+			set_D(s->D, q, s - 1);
+		}
+		set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+		set_D(s->D, q, s - 1);
+		if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
+			set_end_I(s->I, q, last + i);
+		} else s->I = MINOR_INF;
+		s = curr; curr = last; last = s;
+	}
+	/* last row for part 1, use set_end_D() instead of set_D() */
+	if (j == len2 && b2 != len2 - 1) {
+		q = dpcell[j]; s = curr; SET_INF(*s);
+		set_end_I(s->I, q, last);
+		end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
+		mat = score_matrix + seq2[j] * N_MATRIX_ROW;
+		++s; ++q;
+		for (i = 1; i != end; ++i, ++s, ++q) {
+			set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
+			set_I(s->I, q, last + i);
+			set_end_D(s->D, q, s - 1);
+		}
+		set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+		set_end_D(s->D, q, s - 1);
+		if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
+			set_end_I(s->I, q, last + i);
+		} else s->I = MINOR_INF;
+		s = curr; curr = last; last = s;
+		++j;
+	}
+
+	/* core dynamic programming, part 2 */
+	for (; j <= len2 - b2 + 1; ++j) {
+		SET_INF(curr[j - b2]);
+		mat = score_matrix + seq2[j] * N_MATRIX_ROW;
+		end = j + b1 - 1;
+		for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i != end; ++i, ++s, ++q) {
+			set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+			set_I(s->I, q, last + i);
+			set_D(s->D, q, s - 1);
+		}
+		set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+		set_D(s->D, q, s - 1);
+		s->I = MINOR_INF;
+		s = curr; curr = last; last = s;
+	}
+
+	/* core dynamic programming, part 3 */
+	for (; j < len2; ++j) {
+		SET_INF(curr[j - b2]);
+		mat = score_matrix + seq2[j] * N_MATRIX_ROW;
+		for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
+			set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+			set_I(s->I, q, last + i);
+			set_D(s->D, q, s - 1);
+		}
+		set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
+		set_end_I(s->I, q, last + i);
+		set_D(s->D, q, s - 1);
+		s = curr; curr = last; last = s;
+	}
+	/* last row */
+	if (j == len2) {
+		SET_INF(curr[j - b2]);
+		mat = score_matrix + seq2[j] * N_MATRIX_ROW;
+		for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
+			set_M(s->M, q, last + i - 1, mat[seq1[i]]);
+			set_I(s->I, q, last + i);
+			set_end_D(s->D, q, s - 1);
+		}
+		set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
+		set_end_I(s->I, q, last + i);
+		set_end_D(s->D, q, s - 1);
+		s = curr; curr = last; last = s;
+	}
+
+	/* backtrace */
+	i = len1; j = len2;
+	q = dpcell[j] + i;
+	s = last + len1;
+	max = s->M; type = q->Mt; ctype = FROM_M;
+	if (s->I > max) { max = s->I; type = q->It; ctype = FROM_I; }
+	if (s->D > max) { max = s->D; type = q->Dt; ctype = FROM_D; }
+
+	p = path;
+	p->ctype = ctype; p->i = i; p->j = j; /* bug fixed 040408 */
+	++p;
+	do {
+		switch (ctype) {
+			case FROM_M: --i; --j; break;
+			case FROM_I: --j; break;
+			case FROM_D: --i; break;
+		}
+		q = dpcell[j] + i;
+		ctype = type;
+		switch (type) {
+			case FROM_M: type = q->Mt; break;
+			case FROM_I: type = q->It; break;
+			case FROM_D: type = q->Dt; break;
+		}
+		p->ctype = ctype; p->i = i; p->j = j;
+		++p;
+	} while (i || j);
+	*path_len = p - path - 1;
+
+	/* free memory */
+	for (j = b2 + 1; j <= len2; ++j)
+		dpcell[j] += j - b2;
+	for (j = 0; j <= len2; ++j)
+		free(dpcell[j]);
+	free(dpcell);
+	free(curr); free(last);
+	
+	return max;
+}
+/*************************************************
+ * local alignment combined with banded strategy *
+ *************************************************/
+int aln_local_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
+				   path_t *path, int *path_len, int _thres, int *_subo)
+{
+	register NT_LOCAL_SCORE *s;
+	register int i;
+	int q, r, qr, tmp_len, qr_shift;
+	int **s_array, *score_array;
+	int e, f;
+	int is_overflow, of_base;
+	NT_LOCAL_SCORE *eh, curr_h, last_h, curr_last_h;
+	int j, start_i, start_j, end_i, end_j;
+	path_t *p;
+	int score_f, score_r, score_g;
+	int start, end, max_score;
+	int thres, *suba, *ss;
+
+	int gap_open, gap_ext, b;
+	int *score_matrix, N_MATRIX_ROW;
+
+	/* initialize some align-related parameters. just for compatibility */
+	gap_open = ap->gap_open;
+	gap_ext = ap->gap_ext;
+	b = ap->band_width;
+	score_matrix = ap->matrix;
+	N_MATRIX_ROW = ap->row;
+	thres = _thres > 0? _thres : -_thres;
+
+	if (len1 == 0 || len2 == 0) return -1;
+
+	/* allocate memory */
+	suba = (int*)malloc(sizeof(int) * (len2 + 1));
+	eh = (NT_LOCAL_SCORE*)malloc(sizeof(NT_LOCAL_SCORE) * (len1 + 1));
+	s_array = (int**)malloc(sizeof(int*) * N_MATRIX_ROW);
+	for (i = 0; i != N_MATRIX_ROW; ++i)
+		s_array[i] = (int*)malloc(sizeof(int) * len1);
+	/* initialization */
+	aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
+	q = gap_open;
+	r = gap_ext;
+	qr = q + r;
+	qr_shift = (qr+1) << NT_LOCAL_SHIFT;
+	tmp_len = len1 + 1;
+	start_i = start_j = end_i = end_j = 0;
+	for (i = 0, max_score = 0; i != N_MATRIX_ROW * N_MATRIX_ROW; ++i)
+		if (max_score < score_matrix[i]) max_score = score_matrix[i];
+	/* convert the coordinate */
+	--seq1; --seq2;
+	for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
+
+	/* forward dynamic programming */
+	for (i = 0, s = eh; i != tmp_len; ++i, ++s) *s = 0;
+	score_f = 0;
+	is_overflow = of_base = 0;
+	suba[0] = 0;
+	for (j = 1, ss = suba + 1; j <= len2; ++j, ++ss) {
+		int subo = 0;
+		last_h = f = 0;
+		score_array = s_array[seq2[j]];
+		if (is_overflow) { /* adjust eh[] array if overflow occurs. */
+			/* If LOCAL_OVERFLOW_REDUCE is too small, optimal alignment might be missed.
+			 * If it is too large, this block will be excuted frequently and therefore
+			 * slow down the whole program.
+			 * Acually, smaller LOCAL_OVERFLOW_REDUCE might also help to reduce the
+			 * number of assignments because it sets some cells to zero when overflow
+			 * happens. */
+			int tmp, tmp2;
+			score_f -= LOCAL_OVERFLOW_REDUCE;
+			of_base += LOCAL_OVERFLOW_REDUCE;
+			is_overflow = 0;
+			for (i = 1, s = eh; i <= tmp_len; ++i, ++s) {
+				tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
+				if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
+				else tmp2 -= LOCAL_OVERFLOW_REDUCE;
+				if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
+				else tmp -= LOCAL_OVERFLOW_REDUCE;
+				*s = (tmp << NT_LOCAL_SHIFT) | tmp2;
+			}
+		}
+		for (i = 1, s = eh; i != tmp_len; ++i, ++s) {
+			/* prepare for calculate current h */
+			curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
+			if (curr_h < 0) curr_h = 0;
+			if (last_h > 0) { /* initialize f */
+				f = (f > last_h - q)? f - r : last_h - qr;
+				if (curr_h < f) curr_h = f;
+			}
+			if (*(s+1) >= qr_shift) { /* initialize e */
+				curr_last_h = *(s+1) >> NT_LOCAL_SHIFT;
+				e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
+				if (curr_h < e) curr_h = e;
+				*s = (last_h << NT_LOCAL_SHIFT) | e;
+			} else *s = last_h << NT_LOCAL_SHIFT; /* e = 0 */
+			last_h = curr_h;
+			if (subo < curr_h) subo = curr_h;
+			if (score_f < curr_h) {
+				score_f = curr_h; end_i = i; end_j = j;
+				if (score_f > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
+			}
+		}
+		*s = last_h << NT_LOCAL_SHIFT;
+		*ss = subo + of_base;
+	}
+	score_f += of_base;
+
+	if (score_f < thres) { /* no matching residue at all, 090218 */
+		if (path_len) *path_len = 0;
+		goto end_func;
+	}
+	if (path == 0) goto end_func; /* skip path-filling */
+
+	/* reverse dynamic programming */
+	for (i = end_i, s = eh + end_i; i >= 0; --i, --s) *s = 0;
+	if (end_i == 0 || end_j == 0) goto end_func; /* no local match */
+	score_r = score_matrix[seq1[end_i] * N_MATRIX_ROW + seq2[end_j]];
+	is_overflow = of_base = 0;
+	start_i = end_i; start_j = end_j;
+	eh[end_i] = ((NT_LOCAL_SCORE)(qr + score_r)) << NT_LOCAL_SHIFT; /* in order to initialize f and e, 040408 */
+	start = end_i - 1;
+	end = end_i - 3;
+	if (end <= 0) end = 0;
+
+	/* second pass DP can be done in a band, speed will thus be enhanced */
+	for (j = end_j - 1; j != 0; --j) {
+		last_h = f = 0;
+		score_array = s_array[seq2[j]];
+		if (is_overflow) { /* adjust eh[] array if overflow occurs. */
+			int tmp, tmp2;
+			score_r -= LOCAL_OVERFLOW_REDUCE;
+			of_base += LOCAL_OVERFLOW_REDUCE;
+			is_overflow = 0;
+			for (i = start, s = eh + start + 1; i >= end; --i, --s) {
+				tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
+				if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
+				else tmp2 -= LOCAL_OVERFLOW_REDUCE;
+				if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
+				else tmp -= LOCAL_OVERFLOW_REDUCE;
+				*s = (tmp << NT_LOCAL_SHIFT) | tmp2;
+			}
+		}
+		for (i = start, s = eh + start + 1; i != end; --i, --s) {
+			/* prepare for calculate current h */
+			curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
+			if (curr_h < 0) curr_h = 0;
+			if (last_h > 0) { /* initialize f */
+				f = (f > last_h - q)? f - r : last_h - qr;
+				if (curr_h < f) curr_h = f;
+			}
+			curr_last_h = *(s-1) >> NT_LOCAL_SHIFT;
+			e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
+			if (e < 0) e = 0;
+			if (curr_h < e) curr_h = e;
+			*s = (last_h << NT_LOCAL_SHIFT) | e;
+			last_h = curr_h;
+			if (score_r < curr_h) {
+				score_r = curr_h; start_i = i; start_j = j;
+				if (score_r + of_base - qr == score_f) {
+					j = 1; break;
+				}
+				if (score_r > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
+			}
+		}
+		*s = last_h << NT_LOCAL_SHIFT;
+		/* recalculate start and end, the boundaries of the band */
+		if ((eh[start] >> NT_LOCAL_SHIFT) <= qr) --start;
+		if (start <= 0) start = 0;
+		end = start_i - (start_j - j) - (score_r + of_base + (start_j - j) * max_score) / r - 1;
+		if (end <= 0) end = 0;
+	}
+
+	if (_subo) {
+		int tmp2 = 0, tmp = (int)(start_j - .33 * (end_j - start_j) + .499);
+		for (j = 1; j <= tmp; ++j)
+			if (tmp2 < suba[j]) tmp2 = suba[j];
+		tmp = (int)(end_j + .33 * (end_j - start_j) + .499);
+		for (j = tmp; j <= len2; ++j)
+			if (tmp2 < suba[j]) tmp2 = suba[j];
+		*_subo = tmp2;
+	}
+
+	if (path_len == 0) {
+		path[0].i = start_i; path[0].j = start_j;
+		path[1].i = end_i; path[1].j = end_j;
+		goto end_func;
+	}
+
+	score_r += of_base;
+	score_r -= qr;
+
+#ifdef DEBUG
+	/* this seems not a bug */
+	if (score_f != score_r)
+		fprintf(stderr, "[aln_local_core] unknown flaw occurs: score_f(%d) != score_r(%d)\n", score_f, score_r);
+#endif
+
+	if (_thres > 0) { /* call global alignment to fill the path */
+		score_g = 0;
+		j = (end_i - start_i > end_j - start_j)? end_i - start_i : end_j - start_j;
+		++j; /* j is the maximum band_width */
+		for (i = ap->band_width;; i <<= 1) {
+			AlnParam ap_real = *ap;
+			ap_real.gap_end = -1;
+			ap_real.band_width = i;
+			score_g = aln_global_core(seq1 + start_i, end_i - start_i + 1, seq2 + start_j,
+									  end_j - start_j + 1, &ap_real, path, path_len);
+			if (score_g == score_r || score_f == score_g) break;
+			if (i > j) break;
+		}
+		if (score_r > score_g && score_f > score_g) {
+			fprintf(stderr, "[aln_local_core] Potential bug: (%d,%d) > %d\n", score_f, score_r, score_g);
+			score_f = score_r = -1;
+		} else score_f = score_g;
+
+		/* convert coordinate */
+		for (p = path + *path_len - 1; p >= path; --p) {
+			p->i += start_i - 1;
+			p->j += start_j - 1;
+		}
+	} else { /* just store the start and end */
+		*path_len = 2;
+		path[1].i = start_i; path[1].j = start_j;
+		path->i = end_i; path->j = end_j;
+	}
+
+end_func:
+	/* free */
+	free(eh); free(suba);
+	for (i = 0; i != N_MATRIX_ROW; ++i) {
+		++s_array[i];
+		free(s_array[i]);
+	}
+	free(s_array);
+	return score_f;
+}
+AlnAln *aln_stdaln_aux(const char *seq1, const char *seq2, const AlnParam *ap,
+					   int type, int thres, int len1, int len2)
+{
+	unsigned char *seq11, *seq22;
+	int score;
+	int i, j, l;
+	path_t *p;
+	char *out1, *out2, *outm;
+	AlnAln *aa;
+
+	if (len1 < 0) len1 = strlen(seq1);
+	if (len2 < 0) len2 = strlen(seq2);
+
+	aa = aln_init_AlnAln();
+	seq11 = (unsigned char*)malloc(sizeof(unsigned char) * len1);
+	seq22 = (unsigned char*)malloc(sizeof(unsigned char) * len2);
+	aa->path = (path_t*)malloc(sizeof(path_t) * (len1 + len2 + 1));
+
+	if (ap->row < 10) { /* 4-nucleotide alignment */
+		for (i = 0; i < len1; ++i)
+			seq11[i] = aln_nt4_table[(int)seq1[i]];
+		for (j = 0; j < len2; ++j)
+			seq22[j] = aln_nt4_table[(int)seq2[j]];
+	} else if (ap->row < 20) { /* 16-nucleotide alignment */
+		for (i = 0; i < len1; ++i)
+			seq11[i] = aln_nt16_table[(int)seq1[i]];
+		for (j = 0; j < len2; ++j)
+			seq22[j] = aln_nt16_table[(int)seq2[j]];
+	} else { /* amino acids */
+		for (i = 0; i < len1; ++i)
+			seq11[i] = aln_aa_table[(int)seq1[i]];
+		for (j = 0; j < len2; ++j)
+			seq22[j] = aln_aa_table[(int)seq2[j]];
+	}
+	
+	if (type == ALN_TYPE_GLOBAL) score = aln_global_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len);
+	else if (type == ALN_TYPE_LOCAL) score = aln_local_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, thres, &aa->subo);
+	else if (type == ALN_TYPE_EXTEND)  score = aln_extend_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, 1, 0);
+	else {
+		free(seq11); free(seq22); free(aa->path);
+		aln_free_AlnAln(aa);
+		return 0;
+	}
+	aa->score = score;
+
+	if (thres > 0) {
+		out1 = aa->out1 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
+		out2 = aa->out2 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
+		outm = aa->outm = (char*)malloc(sizeof(char) * (aa->path_len + 1));
+
+		--seq1; --seq2;
+		--seq11; --seq22;
+
+		p = aa->path + aa->path_len - 1;
+
+		for (l = 0; p >= aa->path; --p, ++l) {
+			switch (p->ctype) {
+			case FROM_M: out1[l] = seq1[p->i]; out2[l] = seq2[p->j];
+				outm[l] = (seq11[p->i] == seq22[p->j] && seq11[p->i] != ap->row)? '|' : ' ';
+				break;
+			case FROM_I: out1[l] = '-'; out2[l] = seq2[p->j]; outm[l] = ' '; break;
+			case FROM_D: out1[l] = seq1[p->i]; out2[l] = '-'; outm[l] = ' '; break;
+			}
+		}
+		out1[l] = out2[l] = outm[l] = '\0';
+		++seq11; ++seq22;
+	}
+
+	free(seq11);
+	free(seq22);
+
+	p = aa->path + aa->path_len - 1;
+	aa->start1 = p->i? p->i : 1;
+	aa->end1 = aa->path->i;
+	aa->start2 = p->j? p->j : 1;
+	aa->end2 = aa->path->j;
+	aa->cigar32 = aln_path2cigar32(aa->path, aa->path_len, &aa->n_cigar);
+
+	return aa;
+}
+AlnAln *aln_stdaln(const char *seq1, const char *seq2, const AlnParam *ap, int type, int thres)
+{
+	return aln_stdaln_aux(seq1, seq2, ap, type, thres, -1, -1);
+}
+
+/* for backward compatibility */
+uint16_t *aln_path2cigar(const path_t *path, int path_len, int *n_cigar)
+{
+	uint32_t *cigar32;
+	uint16_t *cigar;
+	int i;
+	cigar32 = aln_path2cigar32(path, path_len, n_cigar);
+	cigar = (uint16_t*)cigar32;
+	for (i = 0; i < *n_cigar; ++i)
+		cigar[i] = (cigar32[i]&0xf)<<14 | (cigar32[i]>>4&0x3fff);
+	return cigar;
+}
+
+/* newly added functions (2009-07-21) */
+
+int aln_extend_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
+					path_t *path, int *path_len, int G0, uint8_t *_mem)
+{
+	int q, r, qr, tmp_len;
+	int32_t **s_array, *score_array;
+	int is_overflow, of_base;
+	uint32_t *eh;
+	int i, j, end_i, end_j;
+	int score, start, end;
+	int *score_matrix, N_MATRIX_ROW;
+	uint8_t *mem, *_p;
+
+	/* initialize some align-related parameters. just for compatibility */
+	q = ap->gap_open;
+	r = ap->gap_ext;
+	qr = q + r;
+	score_matrix = ap->matrix;
+	N_MATRIX_ROW = ap->row;
+
+	if (len1 == 0 || len2 == 0) return -1;
+
+	/* allocate memory */
+	mem = _mem? _mem : calloc((len1 + 2) * (N_MATRIX_ROW + 1), 4);
+	_p = mem;
+	eh = (uint32_t*)_p, _p += 4 * (len1 + 2);
+	s_array = calloc(N_MATRIX_ROW, sizeof(void*));
+	for (i = 0; i != N_MATRIX_ROW; ++i)
+		s_array[i] = (int32_t*)_p, _p += 4 * len1;
+	/* initialization */
+	aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
+	tmp_len = len1 + 1;
+	start = 1; end = 2;
+	end_i = end_j = 0;
+	score = 0;
+	is_overflow = of_base = 0;
+	/* convert the coordinate */
+	--seq1; --seq2;
+	for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
+
+	/* dynamic programming */
+	memset(eh, 0, 4 * (len1 + 2));
+	eh[1] = (uint32_t)G0<<16;
+	for (j = 1; j <= len2; ++j) {
+		int _start, _end;
+		int h1 = 0, f = 0;
+		score_array = s_array[seq2[j]];
+		/* set start and end */
+		_start = j - ap->band_width;
+		if (_start < 1) _start = 1;
+		if (_start > start) start = _start;
+		_end = j + ap->band_width;
+		if (_end > len1 + 1) _end = len1 + 1;
+		if (_end < end) end = _end;
+		if (start == end) break;
+		/* adjust eh[] array if overflow occurs. */
+		if (is_overflow) {
+			int tmp, tmp2;
+			score -= LOCAL_OVERFLOW_REDUCE;
+			of_base += LOCAL_OVERFLOW_REDUCE;
+			is_overflow = 0;
+			for (i = start; i <= end; ++i) {
+				uint32_t *s = &eh[i];
+				tmp = *s >> 16; tmp2 = *s & 0xffff;
+				if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
+				else tmp2 -= LOCAL_OVERFLOW_REDUCE;
+				if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
+				else tmp -= LOCAL_OVERFLOW_REDUCE;
+				*s = (tmp << 16) | tmp2;
+			}
+		}
+		_start = _end = 0;
+		/* the inner loop */
+		for (i = start; i < end; ++i) {
+			/* At the beginning of each cycle:
+			     eh[i] -> h[j-1,i-1]<<16 | e[j,i]
+				 f     -> f[j,i]
+				 h1    -> h[j,i-1]
+			*/
+			uint32_t *s = &eh[i];
+			int h = (int)(*s >> 16);
+			int e = *s & 0xffff; /* this is e[j,i] */
+			*s = (uint32_t)h1 << 16; /* eh[i] now stores h[j,i-1]<<16 */
+			h += h? score_array[i] : 0; /* this is left_core() specific */
+			/* calculate h[j,i]; don't need to test 0, as {e,f}>=0 */
+			h = h > e? h : e;
+			h = h > f? h : f; /* h now is h[j,i] */
+			h1 = h;
+			if (h > 0) {
+				if (_start == 0) _start = i;
+				_end = i;
+				if (score < h) {
+					score = h; end_i = i; end_j = j;
+					if (score > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
+				}
+			}
+			/* calculate e[j+1,i] and f[j,i+1] */
+			h -= qr;
+			h = h > 0? h : 0;
+			e -= r;
+			e = e > h? e : h;
+			f -= r;
+			f = f > h? f : h;
+			*s |= e;
+		}			
+		eh[end] = h1 << 16;
+		/* recalculate start and end, the boundaries of the band */
+		if (_end <= 0) break; /* no cell in this row has a positive score */
+		start = _start;
+		end = _end + 3;
+	}
+
+	score += of_base - 1;
+	if (score <= 0) {
+		if (path_len) *path_len = 0;
+		goto end_left_func;
+	}
+
+	if (path == 0) goto end_left_func;
+
+	if (path_len == 0) {
+		path[0].i = end_i; path[0].j = end_j;
+		goto end_left_func;
+	}
+
+	{ /* call global alignment to fill the path */
+		int score_g = 0;
+		j = (end_i - 1 > end_j - 1)? end_i - 1 : end_j - 1;
+		++j; /* j is the maximum band_width */
+		for (i = ap->band_width;; i <<= 1) {
+			AlnParam ap_real = *ap;
+			ap_real.gap_end = -1;
+			ap_real.band_width = i;
+			score_g = aln_global_core(seq1 + 1, end_i, seq2 + 1, end_j, &ap_real, path, path_len);
+			if (score == score_g) break;
+			if (i > j) break;
+		}
+		if (score > score_g)
+			fprintf(stderr, "[aln_left_core] no suitable bandwidth: %d < %d\n", score_g, score);
+		score = score_g;
+	}
+
+end_left_func:
+	/* free */
+	free(s_array);
+	if (!_mem) free(mem);
+	return score;
+}
+
+uint32_t *aln_path2cigar32(const path_t *path, int path_len, int *n_cigar)
+{
+	int i, n;
+	uint32_t *cigar;
+	unsigned char last_type;
+
+	if (path_len == 0 || path == 0) {
+		*n_cigar = 0;
+		return 0;
+	}
+
+	last_type = path->ctype;
+	for (i = n = 1; i < path_len; ++i) {
+		if (last_type != path[i].ctype) ++n;
+		last_type = path[i].ctype;
+	}
+	*n_cigar = n;
+	cigar = (uint32_t*)malloc(*n_cigar * 4);
+
+	cigar[0] = 1u << 4 | path[path_len-1].ctype;
+	last_type = path[path_len-1].ctype;
+	for (i = path_len - 2, n = 0; i >= 0; --i) {
+		if (path[i].ctype == last_type) cigar[n] += 1u << 4;
+		else {
+			cigar[++n] = 1u << 4 | path[i].ctype;
+			last_type = path[i].ctype;
+		}
+	}
+
+	return cigar;
+}
+
+#ifdef STDALN_MAIN
+int main()
+{
+	AlnAln *aln_local, *aln_global, *aln_left;
+	int i;
+
+	aln_local  = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCgCTCGGCTAGCTGT", &aln_param_blast, 0, 1);
+	aln_global = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 1, 1);
+//	aln_left   = aln_stdaln(     "GATGCACTGCATACGGCTCGCCTAGATCA",     "GATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 2, 1);
+	aln_left   = aln_stdaln("CACCTTCGACTCACGTCTCATTCTCGGAGTCGAGTGGACGGTCCCTCATACACGAACAGGTTC",
+							"CACCTTCGACTTTCACCTCTCATTCTCGGACTCGAGTGGACGGTCCCTCATCCAAGAACAGGGTCTGTGAAA", &aln_param_blast, 2, 1);
+
+	printf(">%d,%d\t%d,%d\n", aln_local->start1, aln_local->end1, aln_local->start2, aln_local->end2);
+	printf("%s\n%s\n%s\n", aln_local->out1, aln_local->outm, aln_local->out2);
+
+	printf(">%d,%d\t%d,%d\t", aln_global->start1, aln_global->end1, aln_global->start2, aln_global->end2);
+	for (i = 0; i != aln_global->n_cigar; ++i)
+		printf("%d%c", aln_global->cigar32[i]>>4, "MID"[aln_global->cigar32[i]&0xf]);
+	printf("\n%s\n%s\n%s\n", aln_global->out1, aln_global->outm, aln_global->out2);
+
+	printf(">%d\t%d,%d\t%d,%d\t", aln_left->score, aln_left->start1, aln_left->end1, aln_left->start2, aln_left->end2);
+	for (i = 0; i != aln_left->n_cigar; ++i)
+		printf("%d%c", aln_left->cigar32[i]>>4, "MID"[aln_left->cigar32[i]&0xf]);
+	printf("\n%s\n%s\n%s\n", aln_left->out1, aln_left->outm, aln_left->out2);
+
+	aln_free_AlnAln(aln_local);
+	aln_free_AlnAln(aln_global);
+	aln_free_AlnAln(aln_left);
+	return 0;
+}
+#endif