# HG changeset patch # User ayllon # Date 1410079356 14400 # Node ID c9fc8574e6f1b7060060a4c376f164df7d618545 # Parent 620741ec77ed686b10ea35fed7402aec8d2c553c Uploaded diff -r 620741ec77ed -r c9fc8574e6f1 tcoffee.xml --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/tcoffee.xml Sun Sep 07 04:42:36 2014 -0400 @@ -0,0 +1,171 @@ + + multiple aligment + + tcoffee.pl $input $method01 $method02 $method03 $dnd $msf_aln $clustalw_aln $pir_aln $fasta_aln $phylip $pir_seq $fasta_seq $score_ascii $score_html + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + format_output_dnd == "yes" + + + format_output_msf_aln == "yes" + + + format_output_clustalw_aln == "yes" + + + format_output_pir_aln == "yes" + + + format_output_fasta_aln == "yes" + + + format_output_phylip == "yes" + + + format_output_pir_seq == "yes" + + + format_output_fasta_seq == "yes" + + + format_output_score_ascii == "yes" + + + format_output_score_html == "yes" + + + + + **Requeriments** + + You must install T_coffee version "10.00.r1613" in your computer. + +----- + + **What it does** + + This tool is a wrapper for the T-Coffee multiple alignment suite. The input is a set of sequences in FASTA format that must be uploaded to Galaxy if not obtained using Galaxy tools. + + This wrapper offers selected advanced T-Coffee options like the selection of the alignment methods to use: ''Pairwise Structual Method'', ''Multiple Sequence Alignment + Methods'' or ''Pairwise Sequence Alignment Methods''. + + The T-Coffee documentation can be found at http://www.tcoffee.org/Projects/tcoffee/documentation + +----- + + **Example** + + Suppose you have five sequences in FASTA format: + + >1aboA + NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS + NYITPVN + + >1ycsB + KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY + VPRNLLGLYP + + >1pht + GYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIG + WLNGYNETTGERGDFPGTYVEYIGRKKISP + + >1vie + DRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI + N + + >1ihvA + NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD + + By selecting "yes" in output fasta_aln in the wrapper, the user will obtain the multiple alignment in FASTA format: + + >1aboA + NL-FVA---LYDFVASGDNTLSITKGEKLR-------VLGYN-------H + NGEWCEA--QTKN-GQGWVPSNYIT------PVN + >1ycsB + KGVIYA---LWDYEPQNDDELPMKEGDCMT-------IIHREDE-----D + EIEWWWA--RLND-KEGYVPRNLLG------LYP + >1pht + GYQYRA---LYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPE + EIGWLNGYNETTG-ERGDFPGTYVEYIGRKKISP + >1vie + DR-----------VRK--KSGAAWQGQIVGWYCTNLTPEGYAVE------ + ------S--EAHPGSVQIYPVAALE------RIN + >1ihvA + NF-RVYYRDSRDPVWKGPA-KLLWKGEGAV-------VIQDN-------S + DI--------------KVVPRRKAK-----IIRD + + + + + + +