Mercurial > repos > bgruening > augustus
comparison test-data/human_augustus_utr-on.gff @ 6:ca6d970d931c draft
"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/augustus commit 211061259f97dfbeb080aaf4713a21f64a1742e1"
author | iuc |
---|---|
date | Fri, 20 Dec 2019 14:08:53 -0500 |
parents | 4de31938431b |
children | 09855551d713 |
comparison
equal
deleted
inserted
replaced
5:b3f5d0879dab | 6:ca6d970d931c |
---|---|
1 ##gff-version 3 | 1 ##gff-version 3 |
2 # This output was generated with AUGUSTUS (version 3.2.3). | 2 # This output was generated with AUGUSTUS (version 3.3.3). |
3 # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), | 3 # AUGUSTUS is a gene prediction tool written by M. Stanke (mario.stanke@uni-greifswald.de), |
4 # O. Keller, S. König, L. Gerischer and L. Romoth. | 4 # O. Keller, S. König, L. Gerischer, L. Romoth and Katharina Hoff. |
5 # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), | 5 # Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), |
6 # Using native and syntenically mapped cDNA alignments to improve de novo gene finding | 6 # Using native and syntenically mapped cDNA alignments to improve de novo gene finding |
7 # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 | 7 # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 |
8 # No extrinsic information on sequences given. | 8 # No extrinsic information on sequences given. |
9 # Initialising the parameters using config directory /home/bag/projects/code/galaxy/tool_deps/augustus/3.1/iuc/package_augustus_3_1/820bf3789c44/config/ ... | 9 # Initializing the parameters using config directory /home/abretaud/miniconda3/envs/__augustus@3.3.3/config/ ... |
10 # human version. Using default transition matrix. | 10 # human version. Using default transition matrix. |
11 # Looks like /tmp/tmpboMLLQ/job_working_directory/000/4/task_0/dataset_5.dat is in fasta format. | 11 # Looks like /tmp/tmpTS0N1X/files/c/2/9/dataset_c29ecb21-0612-4152-8d35-994815171865.dat is in fasta format. |
12 # We have hints for 0 sequences and for 0 of the sequences in the input set. | 12 # We have hints for 0 sequences and for 0 of the sequences in the input set. |
13 # | 13 # |
14 # ----- prediction on sequence number 1 (length = 9453, name = HS04636) ----- | 14 # ----- prediction on sequence number 1 (length = 9453, name = HS04636) ----- |
15 # | 15 # |
16 # Predicted genes for sequence number 1 on both strands | 16 # Predicted genes for sequence number 1 on both strands |
101 # WQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQF | 101 # WQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQF |
102 # HVLDGECTAGASMAAW] | 102 # HVLDGECTAGASMAAW] |
103 # end gene HS08198.g2 | 103 # end gene HS08198.g2 |
104 ### | 104 ### |
105 # command line: | 105 # command line: |
106 # augustus --strand=both --noInFrameStop=false --gff3=on --uniqueGeneId=true --protein=on --codingseq=on --introns=off --stop=off --stop=off --cds=on --singlestrand=false /tmp/tmpboMLLQ/job_working_directory/000/4/task_0/dataset_5.dat --UTR=on --genemodel=complete --species=human | 106 # augustus --strand=both --noInFrameStop=false --gff3=on --uniqueGeneId=true --protein=on --codingseq=on --introns=off --stop=off --stop=off --cds=on --singlestrand=false /tmp/tmpTS0N1X/files/c/2/9/dataset_c29ecb21-0612-4152-8d35-994815171865.dat --UTR=on --genemodel=complete --species=human |