view test-data/test.gbk @ 1:b7b320f4c595 draft default tip

planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/glimmer commit a4b0969b33a68a0ea9ba12291f6694aec24f13ed
author iuc
date Tue, 30 Oct 2018 18:51:01 -0400
parents a4136c1534be
children
line wrap: on
line source

LOCUS       contig1                  350 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..350
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
ORIGIN      
        1 gagttttatc gcttccatga cgcagaagtt aacactttcg gatatttctg atgagtcgaa
       61 aaattatctt gataaagcag gaattactac tgcttgttta cgaattaaat cgaagtggac
      121 tgctggcgga aaatgagaaa attcgaccta tccttgcgca gctcgagaag ctcttacttt
      181 gcgacctttc gccatcaact aacgattctg tcaaaaactg acgcgttgga tgaggagaag
      241 tggcttaata tgcttggcac gttcgtcaag gactggttta gatatgagtc acattttgtt
      301 catggtagag attctcttgt tgacatttta aaagagcgtg gattactatc
//
LOCUS       contig2                  840 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
     CDS             40..498
                     /locus_tag="PROKKA_00001"
                     /inference="ab initio prediction:Prodigal:2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /translation="MSQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWI
                     ATDRSRARRCVEACVYGTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAE
                     FTENIINGVERPVKAAELFAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM"
     CDS             498..614
                     /locus_tag="PROKKA_00002"
                     /inference="ab initio prediction:Prodigal:2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /translation="MSKGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF"
ORIGIN      
        1 tgagtccgat gctgttcaac cactaatagg taagaaatca tgagtcaagt tactgaacaa
       61 tccgtacgtt tccagaccgc tttggcctct attaagctca ttcaggcttc tgccgttttg
      121 gatttaaccg aagatgattt cgattttctg acgagtaaca aagtttggat tgctactgac
      181 cgctctcgtg ctcgtcgctg cgttgaggct tgcgtttatg gtacgctgga ctttgtggga
      241 taccctcgct ttcctgctcc tgttgagttt attgctgccg tcattgctta ttatgttcat
      301 cccgtcaaca ttcaaacggc ctgtctcatc atggaaggcg ctgaatttac ggaaaacatt
      361 attaatggcg tcgagcgtcc ggttaaagcc gctgaattgt tcgcgtttac cttgcgtgta
      421 cgcgcaggaa acactgacgt tcttactgac gcagaagaaa acgtgcgtca aaaattacgt
      481 gcggaaggag tgatgtaatg tctaaaggta aaaaacgttc tggcgctcgc cctggtcgtc
      541 cgcagccgtt gcgaggtact aaaggcaagc gtaaaggcgc tcgtctttgg tatgtaggtg
      601 gtcaacaatt ttaattgcag gggcttcggc cccttacttg aggataaatt atgtctaata
      661 ttcaaactgg cgccgagcgt atgccgcatg acctttccca tcttggcttc cttgctggtc
      721 agattggtcg tcttattacc atttcaacta ctccggttat cgctggcgac tccttcgaga
      781 tggacgccgt tggcgctctc cgtctttctc cattgcgtcg tggccttgct attgactcta
//
LOCUS       contig3                  210 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..210
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
ORIGIN      
        1 ctgtagacat ttttactttt tatgtccctc atcgtcacgt ttatggtgaa cagtggatta
       61 agttcatgaa ggatggtgtt aatgccactc ctctcccgac tgttaacact actggttata
      121 ttgaccatgc cgcttttctt ggcacgatta accctgatac caataaaatc cctaagcatt
      181 tgtttcaggg ttatttgaat atctataaca
//
LOCUS       contig4                 1260 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..1260
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
     CDS             21..884
                     /locus_tag="PROKKA_00003"
                     /inference="ab initio prediction:Prodigal:2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /translation="MPDRTEANPNELNQDDARYGFRCCHLKNIWTAPLPPETELSRQM
                     TTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHDVISSFGGKTSYDADNRPLLVMRSN
                     LWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEI
                     QYLNAKGALTYTDIAGDPVLYGNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSY
                     VSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLLQWNSQVKFNVTVYRN
                     LPTTRDSIMTS"
ORIGIN      
        1 actattttaa agcgccgtgg atgcctgacc gtaccgaggc taaccctaat gagcttaatc
       61 aagatgatgc tcgttatggt ttccgttgct gccatctcaa aaacatttgg actgctccgc
      121 ttcctcctga gactgagctt tctcgccaaa tgacgacttc taccacatct attgacatta
      181 tgggtctgca agctgcttat gctaatttgc atactgacca agaacgtgat tacttcatgc
      241 agcgttacca tgatgttatt tcttcatttg gaggtaaaac ctcttatgac gctgacaacc
      301 gtcctttact tgtcatgcgc tctaatctct gggcatctgg ctatgatgtt gatggaactg
      361 accaaacgtc gttaggccag ttttctggtc gtgttcaaca gacctataaa cattctgtgc
      421 cgcgtttctt tgttcctgag catggcacta tgtttactct tgcgcttgtt cgttttccgc
      481 ctactgcgac taaagagatt cagtacctta acgctaaagg tgctttgact tataccgata
      541 ttgctggcga ccctgttttg tatggcaact tgccgccgcg tgaaatttct atgaaggatg
      601 ttttccgttc tggtgattcg tctaagaagt ttaagattgc tgagggtcag tggtatcgtt
      661 atgcgccttc gtatgtttct cctgcttatc accttcttga aggcttccca ttcattcagg
      721 aaccgccttc tggtgatttg caagaacgcg tacttattcg ccaccatgat tatgaccagt
      781 gtttccagtc cgttcagttg ttgcagtgga atagtcaggt taaatttaat gtgaccgttt
      841 atcgcaatct gccgaccact cgcgattcaa tcatgacttc gtgataaaag attgagtgtg
      901 aggttataac gccgaagcgg taaaaatttt aatttttgcc gctgaggggt tgaccaagcg
      961 aagcgcggta ggttttctgc ttaggagttt aatcatgttt cagactttta tttctcgcca
     1021 taattcaaac tttttttctg ataagctggt tctcacttct gttactccag cttcttcggc
     1081 acctgtttta cagacaccta aagctacatc gtcaacgtta tattttgata gtttgacggt
     1141 taatgctggt aatggtggtt ttcttcattg cattcagatg gatacatctg tcaacgccgc
     1201 taatcaggtt gtttctgttg gtgctgatat tgcttttgat gccgacccta aattttttgc
//
LOCUS       contig5                  490 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..490
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
     CDS             275..406
                     /locus_tag="PROKKA_00004"
                     /inference="ab initio prediction:Prodigal:2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /translation="MVLLLAVLLLLLLVAPCLNCLEAVKKPPPVAFKVMCLLPITIL"
ORIGIN      
        1 ctgtttggtt cgctttgagt cttcttcggt tccgactacc ctcccgactg cctatgatgt
       61 ttatcctttg aatggtcgcc atgatggtgg ttattatacc gtcaaggact gtgtgactat
      121 tgacgtcctt ccccgtacgc cgggcaataa cgtttatgtt ggtttcatgg tttggtctaa
      181 ctttaccgct actaaatgcc gcggattggt ttcgctgaat caggttatta aagagattat
      241 ttgtctccag ccacttaagt gaggtgattt atgtttggtg ctattgctgg cggtattgct
      301 tctgctcttg ctggtggcgc catgtctaaa ttgtttggag gcggtcaaaa agccgcctcc
      361 ggtggcattc aaggtgatgt gcttgctacc gataacaata ctgtaggcat gggtgatgct
      421 ggtattaaat ctgccattca aggctctaat gttcctaacc ctgatgaggc cgcccctagt
      481 tttgtttctg
//
LOCUS       contig6                 1960 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..1960
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
     CDS             6..767
                     /locus_tag="PROKKA_00005"
                     /inference="ab initio prediction:Prodigal:2.6"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /translation="MAKAGKGLLEGTLQAGTSAVSDKLLDLVGLGGKSAADKGKDTRD
                     YLAAAFPELNAWERAGADASSAGMVDAGFENQKELTKMQLDNQKEIAEMQNETQKEIA
                     GIQSATSRQNTKDQVYAQNEMLAYQQKESTARVASIMENTNLSKQQQVSEIMRQMLTQ
                     AQTAGQYFTNDQIKEMTRKVSAEVDLVHQQTQNQRYGSSHIGATAKDISNVVTDAASG
                     VVDIFHGIDKAVADTWNNFWKDGKADGIGSNLSRK"
ORIGIN      
        1 gtgctatggc taaagctggt aaaggacttc ttgaaggtac gttgcaggct ggcacttctg
       61 ccgtttctga taagttgctt gatttggttg gacttggtgg caagtctgcc gctgataaag
      121 gaaaggatac tcgtgattat cttgctgctg catttcctga gcttaatgct tgggagcgtg
      181 ctggtgctga tgcttcctct gctggtatgg ttgacgccgg atttgagaat caaaaagagc
      241 ttactaaaat gcaactggac aatcagaaag agattgccga gatgcaaaat gagactcaaa
      301 aagagattgc tggcattcag tcggcgactt cacgccagaa tacgaaagac caggtatatg
      361 cacaaaatga gatgcttgct tatcaacaga aggagtctac tgctcgcgtt gcgtctatta
      421 tggaaaacac caatctttcc aagcaacagc aggtttccga gattatgcgc caaatgctta
      481 ctcaagctca aacggctggt cagtatttta ccaatgacca aatcaaagaa atgactcgca
      541 aggttagtgc tgaggttgac ttagttcatc agcaaacgca gaatcagcgg tatggctctt
      601 ctcatattgg cgctactgca aaggatattt ctaatgtcgt cactgatgct gcttctggtg
      661 tggttgatat ttttcatggt attgataaag ctgttgccga tacttggaac aatttctgga
      721 aagacggtaa agctgatggt attggctcta atttgtctag gaaataaccg tcaggattga
      781 caccctccca attgtatgtt ttcatgcctc caaatcttgg aggctttttt atggttcgtt
      841 cttattaccc ttctgaatgt cacgctgatt attttgactt tgagcgtatc gaggctctta
      901 aacctgctat tgaggcttgt ggcatttcta ctctttctca atccccaatg cttggcttcc
      961 ataagcagat ggataaccgc atcaagctct tggaagagat tctgtctttt cgtatgcagg
     1021 gcgttgagtt cgataatggt gatatgtatg ttgacggcca taaggctgct tctgacgttc
     1081 gtgatgagtt tgtatctgtt actgagaagt taatggatga attggcacaa tgctacaatg
     1141 tgctccccca acttgatatt aataacacta tagaccaccg ccccgaaggg gacgaaaaat
     1201 ggtttttaga gaacgagaag acggttacgc agttttgccg caagctggct gctgaacgcc
     1261 ctcttaagga tattcgcgat gagtataatt accccaaaaa gaaaggtatt aaggatgagt
     1321 gttcaagatt gctggaggcc tccactatga aatcgcgtag aggctttgct attcagcgtt
     1381 tgatgaatgc aatgcgacag gctcatgctg atggttggtt tatcgttttt gacactctca
     1441 cgttggctga cgaccgatta gaggcgtttt atgataatcc caatgctttg cgtgactatt
     1501 ttcgtgatat tggtcgtatg gttcttgctg ccgagggtcg caaggctaat gattcacacg
     1561 ccgactgcta tcagtatttt tgtgtgcctg agtatggtac agctaatggc cgtcttcatt
     1621 tccatgcggt gcactttatg cggacacttc ctacaggtag cgttgaccct aattttggtc
     1681 gtcgggtacg caatcgccgc cagttaaata gcttgcaaaa tacgtggcct tatggttaca
     1741 gtatgcccat cgcagttcgc tacacgcagg acgctttttc acgttctggt tggttgtggc
     1801 ctgttgatgc taaaggtgag ccgcttaaag ctaccagtta tatggctgtt ggtttctatg
     1861 tggctaaata cgttaacaaa aagtcagata tggaccttgc tgctaaaggt ctaggagcta
     1921 aagaatggaa caactcacta aaaaccaagc tgtcgctact
//
LOCUS       contig7                  276 bp    DNA     linear       21-MAR-2017
DEFINITION  Genus species strain strain.
ACCESSION   
VERSION
KEYWORDS    .
SOURCE      Genus species
  ORGANISM  Genus species
            Unclassified.
COMMENT     Annotated using prokka 1.12 from
            https://github.com/tseemann/prokka.
FEATURES             Location/Qualifiers
     source          1..276
                     /organism="Genus species"
                     /mol_type="genomic DNA"
                     /strain="strain"
ORIGIN      
        1 tcccaagaag ctgttcagaa tcagaatgag ccgcaacttc gggatgaaaa tgctcacaat
       61 gacaaatctg tccacggagt gcttaatcca acttaccaag ctgggttacg acgcgacgcc
      121 gttcaaccag atattgaagc agaacgcaaa aagagagatg agattgaggc tgggaaaagt
      181 tactgtagcc gacgttttgg cggcgcaacc tgtgacgaca aatctgctca aatttatgcg
      241 cgcttcgata aaaatgattg gcgtatccaa cctgca
//