view test_files/peptides.txt @ 58:4f843e0c6c40 draft

Uploaded
author bornea
date Sat, 27 Aug 2016 21:03:57 -0400
parents 843ee18d6065
children
line wrap: on
line source

id	Protein Group IDs	Mod. Peptide IDs	Evidence IDs	MS/MS IDs	Best MS/MS	Oxidation (M) Site IDs	Sequence	A Count	R Count	N Count	D Count	C Count	Q Count	E Count	G Count	H Count	I Count	L Count	K Count	M Count	F Count	P Count	S Count	T Count	W Count	Y Count	V Count	U Count	Length	Missed Cleavages	Mass	Proteins	Leading Razor Protein	Gene Names	Protein Names	Unique (Groups)	Unique (Proteins)	Charges	PEP	Score	Slice Average	Slice Std. Dev.	Slice 1	Unique Slice Average	Unique Slice Std. Dev.	Unique Slice 1	Experiment HCC827_EGFR_TAP_1_run1	Experiment HCC827_EGFR_TAP_1_run2	Experiment HCC827_EGFR_TAP_2_run1	Experiment HCC827_EGFR_TAP_2_run2	Experiment HCC827_ERBB3_TAP_1_run1	Experiment HCC827_ERBB3_TAP_1_run2	Experiment HCC827_ERBB3_TAP_2_run1	Experiment HCC827_ERBB3_TAP_2_run2	Experiment HCC827_GFP_TAP_1_run1	Experiment HCC827_GFP_TAP_1_run2	Experiment HCC827_GFP_TAP_2_run1	Experiment HCC827_GFP_TAP_2_run2	Experiment HCC827_GRB2_TAP_1_run1	Experiment HCC827_GRB2_TAP_1_run2	Experiment HCC827_GRB2_TAP_2_run1	Experiment HCC827_GRB2_TAP_2_run2	Experiment HCC827_P85B_TAP_1_run1	Experiment HCC827_P85B_TAP_1_run2	Experiment HCC827_P85B_TAP_2_run1	Experiment HCC827_P85B_TAP_2_run2	Experiment HCC827ER_EGFR_TAP_1_run1	Experiment HCC827ER_EGFR_TAP_1_run2	Experiment HCC827ER_EGFR_TAP_2_run1	Experiment HCC827ER_EGFR_TAP_2_run2	Experiment HCC827ER_ERBB3_TAP_1_run1	Experiment HCC827ER_ERBB3_TAP_1_run2	Experiment HCC827ER_ERBB3_TAP_2_run1	Experiment HCC827ER_ERBB3_TAP_2_run2	Experiment HCC827ER_GRB2_TAP_1_run1	Experiment HCC827ER_GRB2_TAP_1_run2	Experiment HCC827ER_GRB2_TAP_2_run1	Experiment HCC827ER_P85B_TAP_1_run1	Experiment HCC827ER_P85B_TAP_1_run2	Experiment HCC827ER_P85B_TAP_2_run1	Experiment HCC827ER_P85B_TAP_2_run2	Unique Experiment HCC827_EGFR_TAP_1_run1	Unique Experiment HCC827_EGFR_TAP_1_run2	Unique Experiment HCC827_EGFR_TAP_2_run1	Unique Experiment HCC827_EGFR_TAP_2_run2	Unique Experiment HCC827_ERBB3_TAP_1_run1	Unique Experiment HCC827_ERBB3_TAP_1_run2	Unique Experiment HCC827_ERBB3_TAP_2_run1	Unique Experiment HCC827_ERBB3_TAP_2_run2	Unique Experiment HCC827_GFP_TAP_1_run1	Unique Experiment HCC827_GFP_TAP_1_run2	Unique Experiment HCC827_GFP_TAP_2_run1	Unique Experiment HCC827_GFP_TAP_2_run2	Unique Experiment HCC827_GRB2_TAP_1_run1	Unique Experiment HCC827_GRB2_TAP_1_run2	Unique Experiment HCC827_GRB2_TAP_2_run1	Unique Experiment HCC827_GRB2_TAP_2_run2	Unique Experiment HCC827_P85B_TAP_1_run1	Unique Experiment HCC827_P85B_TAP_1_run2	Unique Experiment HCC827_P85B_TAP_2_run1	Unique Experiment HCC827_P85B_TAP_2_run2	Unique Experiment HCC827ER_EGFR_TAP_1_run1	Unique Experiment HCC827ER_EGFR_TAP_1_run2	Unique Experiment HCC827ER_EGFR_TAP_2_run1	Unique Experiment HCC827ER_EGFR_TAP_2_run2	Unique Experiment HCC827ER_ERBB3_TAP_1_run1	Unique Experiment HCC827ER_ERBB3_TAP_1_run2	Unique Experiment HCC827ER_ERBB3_TAP_2_run1	Unique Experiment HCC827ER_ERBB3_TAP_2_run2	Unique Experiment HCC827ER_GRB2_TAP_1_run1	Unique Experiment HCC827ER_GRB2_TAP_1_run2	Unique Experiment HCC827ER_GRB2_TAP_2_run1	Unique Experiment HCC827ER_P85B_TAP_1_run1	Unique Experiment HCC827ER_P85B_TAP_1_run2	Unique Experiment HCC827ER_P85B_TAP_2_run1	Unique Experiment HCC827ER_P85B_TAP_2_run2	Intensity	Intensity HCC827_EGFR_TAP_1_run1	Intensity HCC827_EGFR_TAP_1_run2	Intensity HCC827_EGFR_TAP_2_run1	Intensity HCC827_EGFR_TAP_2_run2	Intensity HCC827_ERBB3_TAP_1_run1	Intensity HCC827_ERBB3_TAP_1_run2	Intensity HCC827_ERBB3_TAP_2_run1	Intensity HCC827_ERBB3_TAP_2_run2	Intensity HCC827_GFP_TAP_1_run1	Intensity HCC827_GFP_TAP_1_run2	Intensity HCC827_GFP_TAP_2_run1	Intensity HCC827_GFP_TAP_2_run2	Intensity HCC827_GRB2_TAP_1_run1	Intensity HCC827_GRB2_TAP_1_run2	Intensity HCC827_GRB2_TAP_2_run1	Intensity HCC827_GRB2_TAP_2_run2	Intensity HCC827_P85B_TAP_1_run1	Intensity HCC827_P85B_TAP_1_run2	Intensity HCC827_P85B_TAP_2_run1	Intensity HCC827_P85B_TAP_2_run2	Intensity HCC827ER_EGFR_TAP_1_run1	Intensity HCC827ER_EGFR_TAP_1_run2	Intensity HCC827ER_EGFR_TAP_2_run1	Intensity HCC827ER_EGFR_TAP_2_run2	Intensity HCC827ER_ERBB3_TAP_1_run1	Intensity HCC827ER_ERBB3_TAP_1_run2	Intensity HCC827ER_ERBB3_TAP_2_run1	Intensity HCC827ER_ERBB3_TAP_2_run2	Intensity HCC827ER_GRB2_TAP_1_run1	Intensity HCC827ER_GRB2_TAP_1_run2	Intensity HCC827ER_GRB2_TAP_2_run1	Intensity HCC827ER_P85B_TAP_1_run1	Intensity HCC827ER_P85B_TAP_1_run2	Intensity HCC827ER_P85B_TAP_2_run1	Intensity HCC827ER_P85B_TAP_2_run2	Reverse	Contaminant
0	165	0	0;1;2;3;4;5	0;1	1		AAAAAATAAAAASIR	11	1	0	0	0	0	0	0	0	1	0	0	0	0	0	1	1	0	0	0	0	15	0	1256.6837	Q8WVM8	Q8WVM8	C14orf163;FKSG23;KIAA0917;SCFD1;STXBP1L2	Sec1 family domain-containing protein 1;SLY1 homolog;Syntaxin-binding protein 1-like 2	yes	yes	2	0.0089625	98.942	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														362430	75520	59179	70853	64505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56510	35868	0	0	0	0	0	0	0	0	0	0	0	0	0		
1	123	1	6;7;8;9	2	2		AAAAASHLNLDALR	6	1	1	1	0	0	0	0	1	0	3	0	0	0	0	1	0	0	0	0	0	14	0	1392.7474	Q13049	Q13049	HT2A;TRIM32	72 kDa Tat-interacting protein;E3 ubiquitin-protein ligase TRIM32;Tripartite motif-containing protein 32;Zinc finger protein HT2A	yes	yes	2	0.037982	82.543	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																239340	63294	45347	64976	65722	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
2	76	2	10;11;12	3	3		AAELIANSLATAGDGLIELR	5	1	1	1	0	0	2	2	0	2	4	0	0	0	0	1	1	0	0	0	0	20	0	1997.0793	P35232	P35232	PHB	Prohibitin	yes	yes	3	0.018211	74.12	1	0	3	1	0	3	1	1																				1														1	1																				1														228910	99794	104880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24237	0	0	0	0	0	0	0	0	0	0	0	0	0		
3	26	3	13;14;15;16;17;18;19;20;21;22;23;24	4;5;6;7;8;9;10;11;12	12		AALQALGVAEGGER	4	1	0	0	0	1	2	3	0	0	2	0	0	0	0	0	0	0	0	1	0	14	0	1340.7048	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	3.5998E-12	190.1	1	0	12	1	0	12					1	1	1	1									1	1	1	1												1	1	1	1					1	1	1	1									1	1	1	1												1	1	1	1	14683000	0	0	0	0	65915	51116	77305	72536	0	0	0	0	0	0	0	0	1740300	1742200	3317400	3107600	0	0	0	0	0	0	0	0	0	0	0	907290	828790	1468000	1305200		
4	50	4	25;26;27;28;29;30;31;32;33;34;35;36	13;14;15;16;17;18;19;20;21	18		ACGLVASNLNLKPGECLR	2	1	2	0	2	0	1	2	0	0	4	1	0	0	1	1	0	0	0	1	0	18	1	1971.003	P09382	P09382	LGALS1	14 kDa laminin-binding protein;14 kDa lectin;Beta-galactoside-binding lectin L-14-I;Galaptin;Galectin-1;HBL;HPL;Lactose-binding lectin 1;Lectin galactoside-binding soluble 1;Putative MAPK-activating protein PM12;S-Lac lectin 1	yes	yes	3	2.625E-06	148.52	1	0	12	1	0	12	1	1	1	1			1	1							1	1				1	1	1									1					1	1	1	1			1	1							1	1				1	1	1									1					2008500	299970	276830	201920	220110	0	0	19638	22784	0	0	0	0	0	0	229380	203950	0	0	0	15600	198370	209010	0	0	0	0	0	0	0	0	110930	0	0	0	0		
5	47;48	5	37;38;39;40;41;42;43;44;45;46;47;48;49	22;23;24;25;26;27;28;29;30;31;32	23		ADLINNLGTIAK	2	0	2	1	0	0	0	1	0	2	2	1	0	0	0	0	1	0	0	0	0	12	0	1241.698	P07900;Q14568;P08238;Q58FF8	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA2;HSPCAL3;HSP90AB1;HSP90B;HSPC2;HSPCB;HSP90AB2P;HSP90BB	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock 90 kDa protein 1 alpha-like 3;Putative heat shock protein HSP 90-alpha A2;Heat shock 84 kDa;Heat shock protein HSP 90-beta;Heat shock protein 90-beta b;Putative heat shock protein HSP 90-beta 2	no	no	2	2.0694E-11	186.81	1	0	13	NaN	NaN		1	1	1	1	1	1	1	1													1	1				1	1	1																																											1518800	237070	229880	145070	168460	90068	98806	84884	98870	0	0	0	0	0	0	0	0	0	0	0	0	56382	73917	0	0	0	35761	105210	94418	0	0	0	0	0	0	0		
6	39	6	50;51;52;53;54	33;34	33		ADTLTDEINFLR	1	1	1	2	0	0	1	0	0	1	2	0	0	1	0	0	2	0	0	0	0	12	0	1406.7042	P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668	P04259	K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E	Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12	yes	no	2	0.00066997	143	1	0	5	1	0	5			1	1													1	1													1							1	1													1	1													1					509060	0	0	179190	181710	0	0	0	0	0	0	0	0	0	0	0	0	46712	55450	0	0	0	0	0	0	0	0	0	0	0	0	45996	0	0	0	0		+
7	40	7	55;56	35;36	36		AEAESLYQSK	2	0	0	0	0	1	2	0	0	0	1	1	0	0	0	2	0	0	1	0	0	10	0	1124.535	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	2.0106E-15	114.5	1	0	2	1	0	2																					1										1																									1										1					31976	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31976	0	0	0	0		+
8	171	8	57;58	37	37		AEAGDAALSVAEWLR	5	1	0	1	0	0	2	1	0	0	2	0	0	0	0	1	0	1	0	1	0	15	0	1557.7787	Q96P48	Q96P48	ARAP1;CENTD2;KIAA0782	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;Centaurin-delta-2	yes	yes	2	0.025821	85.457	1	0	2	1	0	2															1	1																																		1	1																				153670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	81730	71936	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
9	122	9	59;60;61;62;63	38;39	39		AEELSPAALSPSLEPIR	3	1	0	0	0	0	3	0	0	1	3	0	0	0	3	3	0	0	0	0	0	17	0	1778.9414	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	0.00045981	128.76	1	0	5	1	0	5													1	1	1	1															1																	1	1	1	1															1					791840	0	0	0	0	0	0	0	0	0	0	0	0	181510	171410	215260	177340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46321	0	0	0	0		
10	65	10	64;65;66;67;68;69	40;41;42;43;44	41		AEGILDVFQTVK	1	0	0	1	0	1	1	1	0	1	1	1	0	1	0	0	1	0	0	2	0	12	0	1318.7133	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	2	0.0036201	107.85	1	0	6	1	0	6													1	1	1	1													1		1																	1	1	1	1													1		1					553380	0	0	0	0	0	0	0	0	0	0	0	0	51203	86668	134290	103520	0	0	0	0	0	0	0	0	0	0	0	0	39627	0	138080	0	0	0	0		
11	119	11	70;71;72	45;46;47	45		AFVDFLSDEIK	1	0	0	2	0	0	1	0	0	1	1	1	0	2	0	1	0	0	0	1	0	11	0	1282.6445	Q07021	Q07021	C1QBP;GC1QBP;HABP1;SF2P32	Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33	yes	yes	2	2.6536E-17	204.52	1	0	3	1	0	3									1	1	1																																	1	1	1																									1874400	0	0	0	0	0	0	0	0	937860	826600	109940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
12	119	12	73;74;75;76;77;78;79;80;81	48;49;50;51;52;53;54	50		AFVDFLSDEIKEER	1	1	0	2	0	0	3	0	0	1	1	1	0	2	0	1	0	0	0	1	0	14	1	1696.8308	Q07021	Q07021	C1QBP;GC1QBP;HABP1;SF2P32	Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33	yes	yes	2,3	0.00020233	156.81	1	0	9	1	0	9									2	3		2									1	1																						2	3		2									1	1														22762000	0	0	0	0	0	0	0	0	11520000	10835000	0	172250	0	0	0	0	0	0	0	0	124740	110450	0	0	0	0	0	0	0	0	0	0	0	0	0		
13	85	13	82;83;84;85;86;87;88	55;56;57;58	56		AGLFHGTELLCK	1	0	0	0	1	0	1	2	1	0	3	1	0	1	0	0	1	0	0	0	0	12	0	1344.686	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2	8.362E-07	166.55	1	0	7	1	0	7																	1	1	1	1												1		1	1																	1	1	1	1												1		1	1	775500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104920	139910	133320	143300	0	0	0	0	0	0	0	0	0	0	0	60720	0	94018	99321		
14	170	14	89;90;91;92;93;94;95;96;97;98;99;100;101;102;103;104;105;106;107;108;109;110;111;112;113;114;115;116;117;118;119;120;121;122;123;124;125;126;127;128;129;130;131;132;133;134;135;136;137;138;139;140;141;142;143;144;145;146;147	59;60;61;62;63;64;65;66;67;68;69;70;71;72;73;74	61		AHFSSEDQAMLQAMLR	3	1	0	1	0	2	1	0	1	0	2	0	2	1	0	2	0	0	0	0	0	16	0	1833.8502	Q96NH3	Q96NH3	BROMI;C6orf170;C6orf171	Protein broad-minded	yes	yes	2,3	0.07561	39.163	1	0	59	1	0	59	2	2	2	2	1	1	2	2	1	2	1	1	2	2	2	2	2	2	2	1	2	2			1	1	2	2	2	1	2	3	2	2	3	2	2	2	2	1	1	2	2	1	2	1	1	2	2	2	2	2	2	2	1	2	2			1	1	2	2	2	1	2	3	2	2	3	42944000	1094900	1098100	3581900	3991600	131990	137340	919430	944580	1051300	1096900	124570	128930	1574700	1702000	2482700	2533500	1284100	1167600	2311900	129660	857300	779110	0	0	33105	58832	1739700	1781600	566870	556810	1346800	2775300	2562200	1125700	1273100		
15	122	15	148;149;150;151;152;153;154	75;76;77;78;79	75		AHHALEQLIR	2	1	0	0	0	1	1	0	2	1	2	0	0	0	0	0	0	0	0	0	0	10	0	1186.6571	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	0.00013351	127.4	1	0	7	1	0	7													1	1	1	1													1	1	1																	1	1	1	1													1	1	1					1429600	0	0	0	0	0	0	0	0	0	0	0	0	201000	236290	410230	370230	0	0	0	0	0	0	0	0	0	0	0	0	52475	56864	102530	0	0	0	0		
16	74	16	155;156;157;158	80	80		AIACLLFGGSR	2	1	0	0	1	0	0	2	0	1	2	0	0	1	0	1	0	0	0	0	0	11	0	1163.6121	P33992	P33992	CDC46;MCM5	CDC46 homolog;DNA replication licensing factor MCM5;P1-CDC46	yes	yes	2	0.026738	82.749	1	0	4	1	0	4													1		1	1																		1														1		1	1																		1		206260	0	0	0	0	0	0	0	0	0	0	0	0	31681	0	87327	49355	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37899	0		
17	54	17	159;160;161;162;163;164	81;82;83;84	81		AKFEELNMDLFR	1	1	1	1	0	0	2	0	0	0	2	1	1	2	0	0	0	0	0	0	0	12	1	1511.7442	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	3	0.034208	79.659	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														420460	75416	125300	33099	49703	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73870	63075	0	0	0	0	0	0	0	0	0	0	0	0	0		
18	16	18	165;166;167;168;169;170;171;172;173;174;175;176;177;178;179;180;181;182;183;184	85;86;87	86		ALEESNYELEGK	1	0	1	0	0	0	4	1	0	0	2	1	0	0	0	1	0	0	1	0	0	12	0	1380.6409	CON__P13645;P13645;CON__P02535-1	CON__P13645	KPP;KRT10;KPP;KRT10;Krt10;Krt1-10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa	yes	no	2	0.0016979	131.17	1	0	20	1	0	20			1	1	1	1	1	1			1	1			1	1	1	1		1	1	1			1	1			1		1			1				1	1	1	1	1	1			1	1			1	1	1	1		1	1	1			1	1			1		1			1		1212800	0	0	36096	38994	94981	71109	32962	43130	0	0	42679	38320	0	0	55486	48790	89229	98078	0	29002	98833	86170	0	0	44433	53623	0	0	21307	0	121950	0	0	67597	0		+
19	26	19	185;186;187;188;189;190;191;192;193;194;195;196;197;198;199;200;201;202;203;204;205;206;207;208;209;210;211;212;213;214;215;216;217;218;219;220;221;222;223;224;225;226;227;228;229;230;231;232;233;234;235;236;237;238;239;240;241;242;243	88;89;90;91;92;93;94;95;96;97;98;99;100;101;102;103;104;105;106;107;108;109;110;111;112;113;114;115;116;117;118;119;120;121;122;123;124;125;126;127;128;129;130;131;132;133;134;135;136;137;138;139;140;141;142;143;144	96		ALGATFGPLLLR	2	1	0	0	0	0	0	2	0	0	4	0	0	1	1	0	1	0	0	0	0	12	0	1227.7339	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	1.0763E-17	204.5	1	0	59	1	0	59					1	1	1	1					1	1	1	1	10	8	7	11							1				1	3	2	5	3					1	1	1	1					1	1	1	1	10	8	7	11							1				1	3	2	5	3	128390000	0	0	0	0	311940	383000	930080	983910	0	0	0	0	65060	79557	162180	191350	21305000	20647000	30709000	23991000	0	0	0	0	0	0	241470	0	0	0	57227	4813000	57810	11690000	11770000		
20	37	20	244;245;246;247;248;249;250	145;146;147	147		ALGTEVIQLFPEK	1	0	0	0	0	1	2	1	0	1	2	1	0	1	1	0	1	0	0	1	0	13	0	1443.7973	O95831	O95831	AIF;AIFM1;PDCD8	Apoptosis-inducing factor 1, mitochondrial;Programmed cell death protein 8	yes	yes	2	0.0059347	110.8	1	0	7	1	0	7				1	1	1	1	1																			1	1											1	1	1	1	1																			1	1								852240	0	0	0	29145	80734	111410	239350	240450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	83681	67471	0	0	0	0	0	0	0		
21	28	21	251	148	148		ALKTRGNTPK	1	1	1	0	0	0	0	1	0	0	1	2	0	0	1	0	2	0	0	0	0	10	2	1084.6353	O00567	O00567	NOL5A;NOP56	Nucleolar protein 56;Nucleolar protein 5A	yes	yes	2	0.034769	55.567	1	0	1	1	0	1																				1																																			1																112330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
22	96	22	252;253;254;255;256;257;258	149;150;151	151		ALLANALTSALR	4	1	1	0	0	0	0	0	0	0	4	0	0	0	0	1	1	0	0	0	0	12	0	1212.719	P57088	P57088	DB83;TMEM33	Protein DB83;Transmembrane protein 33	yes	yes	2	0.00086257	140.78	1	0	7	1	0	7	1	1	1	1											1						1	1														1	1	1	1											1						1	1														481870	45780	76048	43047	43508	0	0	0	0	0	0	0	0	0	0	22033	0	0	0	0	0	121500	129950	0	0	0	0	0	0	0	0	0	0	0	0	0		
23	35	23	259;260;261	152;153	152		ALLLSTYIK	1	0	0	0	0	0	0	0	0	1	3	1	0	0	0	1	1	0	1	0	0	9	0	1020.6219	O95782;O94973	O95782	ADTAA;AP2A1;CLAPA1;ADTAB;AP2A2;CLAPA2;HIP9;HYPJ;KIAA0899	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit;100 kDa coated vesicle protein C;Adapter-related protein complex 2 alpha-2 subunit;Adaptor protein complex AP-2 subunit alpha-2;Alpha2-adaptin;Alpha-adaptin C;AP-2 complex subunit alpha-2;Clathrin assembly protein complex 2 alpha-C large chain;Huntingtin yeast partner J;Huntingtin-interacting protein 9;Huntingtin-interacting protein J;Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit	yes	no	2	0.06182	77.923	1	0	3	1	0	3														1	1	1																																	1	1	1																				139060	0	0	0	0	0	0	0	0	0	0	0	0	0	45537	47341	46184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
24	29	24	262;263;264;265;266;267;268;269;270;271;272;273;274;275;276;277;278;279;280;281;282;283;284;285;286;287;288;289;290;291;292;293;294;295;296;297;298;299;300;301;302;303	154;155;156;157;158;159;160;161;162;163;164;165;166	155		ALLSEPPEPGGEDGPVNLPHASR	2	1	1	1	0	0	3	3	1	0	3	0	0	0	5	2	0	0	0	1	0	23	0	2338.1553	O15482	O15482	CXorf2;TEX28	Testis-specific protein TEX28	yes	yes	3	0.0023643	79.489	1	0	42	1	0	42	2	1	2	2	2	1	1	1	2	1		1	2	2	1	2	1	1	1	2	1	2					1	2			1	1	2	2	2	2	1	2	2	2	1	1	1	2	1		1	2	2	1	2	1	1	1	2	1	2					1	2			1	1	2	2	2	45587000	1461400	1352600	3233700	3216800	63812	114290	2665500	2856000	1513600	1292800	0	57765	744460	851110	2137200	2045800	1130800	1030600	275160	3921600	1937300	1866200	0	0	0	0	3022400	3344700	0	0	2364400	517560	773560	904360	891450		
25	42	25	304;305;306;307	167;168;169	168		ALNSIIDVYHK	1	0	1	1	0	0	0	0	1	2	1	1	0	0	0	1	0	0	1	1	0	11	0	1271.6874	P05109	P05109	CAGA;CFAG;MRP8;S100A8	Calgranulin-A;Calprotectin L1L subunit;Cystic fibrosis antigen;Leukocyte L1 complex light chain;Migration inhibitory factor-related protein 8;Protein S100-A8;S100 calcium-binding protein A8;Urinary stone protein band A	yes	yes	2	0.0013014	94.692	1	0	4	1	0	4											1	1																			2															1	1																			2					208650	0	0	0	0	0	0	0	0	0	0	43963	46303	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	118390	0	0	0	0		
26	85	26	308;309;310;311;312;313;314;315;316;317;318;319;320;321;322;323;324	170;171;172;173;174;175;176;177	177		ALPHFILVECCK	1	0	0	0	2	0	1	0	1	1	2	1	0	1	1	0	0	0	0	1	0	12	0	1485.7472	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2,3	0.0025356	111.61	1	0	17	1	0	17						1		1									2	2	2	2												2	1	2	2						1		1									2	2	2	2												2	1	2	2	2006800	0	0	0	0	0	32105	0	41307	0	0	0	0	0	0	0	0	290790	281980	370880	290660	0	0	0	0	0	0	0	0	0	0	0	83483	73122	280660	261760		
27	35	27	325;326;327;328;329;330;331	178;179;180;181;182	182		ALQVGCLLR	1	1	0	0	1	1	0	1	0	0	3	0	0	0	0	0	0	0	0	1	0	9	0	1028.5801	O95782	O95782	ADTAA;AP2A1;CLAPA1	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit	yes	yes	2	0.0014257	121.96	1	0	7	1	0	7	1	1		1									1	1	1	1																				1	1		1									1	1	1	1																				351590	0	34746	0	42474	0	0	0	0	0	0	0	0	69233	76459	56989	71693	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
28	31	28	332;333;334;335;336;337;338;339;340;341;342;343	183	183		ALSAIADLLTNEHER	3	1	1	1	0	0	2	0	1	1	3	0	0	0	0	1	1	0	0	0	0	15	0	1651.8529	O60716	O60716	CTNND1;KIAA0384	Cadherin-associated Src substrate;Catenin delta-1;p120 catenin;p120(cas)	yes	yes	3	0.011817	92.925	1	0	12	1	0	12	1	1						1					1		1	1	1		1	1	1	1									1					1	1						1					1		1	1	1		1	1	1	1									1					696710	77567	81329	0	0	0	0	0	18390	0	0	0	0	24844	0	96711	109460	47763	0	45045	41807	56067	42680	0	0	0	0	0	0	0	0	55048	0	0	0	0		
29	46	29	344;345;346;347;348;349;350;351;352;353;354;355;356;357;358;359;360;361;362;363;364;365;366	184;185;186;187;188;189;190;191;192;193	187		ALTVPELTQQVFDAK	2	0	0	1	0	2	1	0	0	0	2	1	0	1	1	0	2	0	0	2	0	15	0	1658.8879	P07437	P07437	OK/SW-cl.56;TUBB;TUBB5	Tubulin beta chain;Tubulin beta-5 chain	yes	yes	2,3	0.00026778	151.99	1	0	23	1	0	23	2	2	3	3			1	3							2	2			1		2	1						1								2	2	3	3			1	3							2	2			1		2	1						1								3732700	844400	937620	569480	543560	0	0	65224	133390	0	0	0	0	0	0	152240	140850	0	0	19821	0	205140	92832	0	0	0	0	0	28184	0	0	0	0	0	0	0		
30	119	30	367;368	194;195	195		ALVLDCHYPEDEVGQEDEAESDIFSIR	2	1	0	4	1	1	5	1	1	2	2	0	0	1	1	2	0	0	1	2	0	27	0	3135.3979	Q07021	Q07021	C1QBP;GC1QBP;HABP1;SF2P32	Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33	yes	yes	3	2.7077E-08	103.27	1	0	2	1	0	2									1	1																																		1	1																										557640	0	0	0	0	0	0	0	0	277950	279690	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
31	122	31	369;370;371;372	196;197;198;199	198		ALVSSESYLQR	1	1	0	0	0	1	1	0	0	0	2	0	0	0	0	3	0	0	1	1	0	11	0	1251.6459	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	1.294E-05	162.36	1	0	4	1	0	4													1	1	1	1																																1	1	1	1																				331370	0	0	0	0	0	0	0	0	0	0	0	0	55070	70370	101480	104450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
32	86	32	373;374;375;376	200;201;202	200		ALYEHLTAK	2	0	0	0	0	0	1	0	1	0	2	1	0	0	0	0	1	0	1	0	0	9	0	1044.5604	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2	0.0063335	105.14	1	0	4	1	0	4	1		1	1																				1												1		1	1																				1												215250	67866	0	74913	72472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
33	47	33	377	203	203		APFDLFENR	1	1	1	1	0	0	1	0	0	0	1	0	0	2	1	0	0	0	0	0	0	9	0	1107.5349	P07900	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38	yes	yes	2	0.0095187	80.438	1	0	1	1	0	1																											1																																			1									0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
34	26	34	378;379;380;381;382;383	204;205;206;207	205		APPPPSSPPPGGAPDGSEPSPDFPALLVEK	3	0	0	2	0	0	2	3	0	0	2	1	0	1	11	4	0	0	0	1	0	30	0	2906.4338	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	4.6538E-18	134.47	1	0	6	1	0	6																	1	1	1	1														1	1																	1	1	1	1														1	1	2300200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	447230	395610	608110	534030	0	0	0	0	0	0	0	0	0	0	0	0	0	128480	186750		
35	37	35	384;385;386;387;388	208;209	209		APSHVPFLLIGGGTAAFAAAR	6	1	0	0	0	0	0	3	1	1	2	0	0	2	2	1	1	0	0	1	0	21	0	2023.1003	O95831	O95831	AIF;AIFM1;PDCD8	Apoptosis-inducing factor 1, mitochondrial;Programmed cell death protein 8	yes	yes	3	0.048977	68.576	1	0	5	1	0	5		1					1	1											1									1									1					1	1											1									1								394950	0	37473	0	0	0	0	133310	132790	0	0	0	0	0	0	0	0	0	0	38908	0	0	0	0	0	0	0	0	52466	0	0	0	0	0	0	0		
36	81	36	389;390;391;392;393;394;395;396	210;211;212;213	210		AQFEGIVTDLIR	1	1	0	1	0	1	1	1	0	2	1	0	0	1	0	0	1	0	0	1	0	12	0	1360.7351	P38646	P38646	GRP75;HSPA9;HSPA9B	75 kDa glucose-regulated protein;Heat shock 70 kDa protein 9;Mortalin;Peptide-binding protein 74;Stress-70 protein, mitochondrial	yes	yes	2	0.0018839	128.54	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														644440	138860	147670	90460	73494	0	0	0	0	0	0	0	0	0	0	47863	46236	0	0	0	0	57958	41899	0	0	0	0	0	0	0	0	0	0	0	0	0		
37	40	37	397;398;399;400;401;402;403;404;405;406;407;408;409;410;411;412;413;414;415;416;417	214;215;216;217;218;219;220;221;222	214		AQYEDIAQK	2	0	0	1	0	2	1	0	0	1	0	1	0	0	0	0	0	0	1	0	0	9	0	1064.5138	P04264	P04264	KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	yes	2	0.0087383	99.815	1	0	21	1	0	21			1	1	1	1	1			1	1	1	1		1	1	1	1			1	1			1	1			1		1			1	1			1	1	1	1	1			1	1	1	1		1	1	1	1			1	1			1	1			1		1			1	1	1347300	0	0	48939	43429	71627	81045	45323	0	0	39684	61141	67723	61799	0	0	0	82508	82221	0	0	92541	76345	0	0	78002	83121	0	0	40861	0	148940	0	0	61840	80232		+
38	79;39;18	38	418;419;420;421;422;423;424	223;224;225;226;227;228	223		AQYEEIAQR	2	1	0	0	0	2	2	0	0	1	0	0	0	0	0	0	0	0	1	0	0	9	0	1106.5356	P35908;CON__P35908;Q01546;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P19013;P19013	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;KRT2B;KRT2P;KRT76;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;CYK4;KRT4;CYK4;KRT4	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-2P;Keratin, type II cytoskeletal 2 oral;Keratin-76;Type-II keratin Kb9;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4	no	no	2	4.5894E-08	149.72	1	0	7	NaN	NaN						1						1			1			1	1			1										1																																								165650	0	0	0	0	47093	0	0	0	0	0	16502	0	0	0	0	0	0	41533	0	0	0	0	0	0	0	0	0	0	0	0	60521	0	0	0	0		+
39	55	39	425;426;427;428;429;430;431;432;433;434;435;436;437	229;230;231;232;233;234;235	231		ARFEELNADLFR	2	2	1	1	0	0	2	0	0	0	2	0	0	2	0	0	0	0	0	0	0	12	1	1479.747	P11142;P54652	P11142	HSC70;HSP73;HSPA10;HSPA8;HSPA2	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	yes	no	2,3	0.0039309	106.49	1	0	13	1	0	13	2	2	2	2			1														2	2														2	2	2	2			1														2	2														1734300	333570	299640	307650	340060	0	0	48360	0	0	0	0	0	0	0	0	0	0	0	0	0	216420	188580	0	0	0	0	0	0	0	0	0	0	0	0	0		
40	162	40	438;439	236;237	237		ARIQEAVYKNVR	2	2	1	0	0	1	1	0	0	1	0	1	0	0	0	0	0	0	1	2	0	12	2	1445.8103	Q8TEM1	Q8TEM1	KIAA0906;NUP210;PSEC0245	Nuclear envelope pore membrane protein POM 210;Nuclear pore membrane glycoprotein 210;Nucleoporin Nup210;Pore membrane protein of 210 kDa	yes	yes	3	0.0015906	57.532	1	0	2	1	0	2																			1	1																																		1	1																148110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76025	72086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
41	106	41	440;441;442;443;444;445;446;447	238;239;240	240		ATADDELSFK	2	0	0	2	0	0	1	0	0	0	1	1	0	1	0	1	1	0	0	0	0	10	0	1095.5084	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	0.00048135	120.99	1	0	8	1	0	8		1											1	1	1	1													1	1	1						1											1	1	1	1													1	1	1					1202300	0	24427	0	0	0	0	0	0	0	0	0	0	166080	154750	220380	221630	0	0	0	0	0	0	0	0	0	0	0	0	123570	147170	144250	0	0	0	0		
42	38	42	448;449;450;451;452;453;454;455;456;457;458;459;460;461;462;463;464;465;466;467;468;469;470	241;242;243;244;245;246;247;248;249	242		ATGQVCHALCSPEGCWGPEPR	2	1	0	0	3	1	2	3	1	0	1	0	0	0	3	1	1	1	0	1	0	21	0	2368.0147	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	4.297E-10	155.2	1	0	23	1	0	23	2	1	2	3									1	1	2	2			1	1	2	2							1	1	1					2	1	2	3									1	1	2	2			1	1	2	2							1	1	1					19633000	4801900	110920	4006300	4310400	0	0	0	0	0	0	0	0	670370	680530	1084900	975280	0	0	57725	49098	1429300	1152400	0	0	0	0	0	0	24997	39990	238940	0	0	0	0		
43	122	43	471;472;473;474;475;476;477;478;479;480	250;251;252	252		ATLSNQEHQWLFSR	1	1	1	0	0	2	1	0	1	0	2	0	0	1	0	2	1	1	0	0	0	14	0	1715.838	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2,3	0.00023828	155.66	1	0	10	1	0	10													2	2	2	2														1	1																	2	2	2	2														1	1					2077300	0	0	0	0	0	0	0	0	0	0	0	0	261150	297570	691350	689690	0	0	0	0	0	0	0	0	0	0	0	0	0	25132	112380	0	0	0	0		
44	134	44	481;482	253;254	254		ATMIPPVK	1	0	0	0	0	0	0	0	0	1	0	1	1	0	2	0	1	0	0	1	0	8	0	855.48881	Q15751	Q15751	HERC1	HECT domain and RCC1-like domain-containing protein 1;p532;p619;Probable E3 ubiquitin-protein ligase HERC1	yes	yes	2	0.082935	31.372	1	0	2	1	0	2														1						1																													1						1																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
45	5;150;109	45	483;484	255;256	256		AVCMLSNTTAIAEAWAR	5	1	1	0	1	0	1	0	0	1	1	0	1	0	0	1	2	1	0	1	0	17	0	1863.8971	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q13748;Q6PEY2;Q9NY65;P68366	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	no	no	3	0.0043871	81.311	1	0	2	NaN	NaN		1	1																																																																					212260	106160	106100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
46	1	46	485;486;487;488;489	257	257		AVFPSIVGRPR	1	2	0	0	0	0	0	1	0	1	0	0	0	1	2	1	0	0	0	2	0	11	1	1197.6982	A5A3E0;P0CG38;Q6S8J3;P68032;P68133;CON__P60712;P60709;P63261;Q9BYX7;P62736;P63267	A5A3E0	A26C1B;POTEF;A26C1A;POTE2;POTEE;ACTC;ACTC1;ACTA;ACTA1;ACTB;ACTB;ACTG;ACTG1;ACTBL3;FKSG30;POTEKP;ACTA2;ACTSA;ACTVS;GIG46;ACTA3;ACTG2;ACTL3;ACTSG	ANKRD26-like family C member 1B;Chimeric POTE-actin protein;POTE ankyrin domain family member F;ANKRD26-like family C member 1A;POTE ankyrin domain family member E;Prostate, ovary, testis-expressed protein on chromosome 2;Actin, alpha cardiac muscle 1;Alpha-cardiac actin;Actin, alpha skeletal muscle;Alpha-actin-1;Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Beta-actin;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Gamma-actin;Kappa-actin;POTE ankyrin domain family member K;Putative beta-actin-like protein 3;Actin, aortic smooth muscle;Alpha-actin-2;Cell growth-inhibiting gene 46 protein;Actin, gamma-enteric smooth muscle;Alpha-actin-3;Gamma-2-actin;Smooth muscle gamma-actin	yes	no	2	0.035919	76.943	1	0	5	1	0	5	1	1	1	1						1																										1	1	1	1						1																										254710	46154	56484	73265	66506	0	0	0	0	0	12300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
47	109	47	490;491	258;259	258		AVFVDLEPTVIDEIR	1	1	0	2	0	0	2	0	0	2	1	0	0	1	1	0	1	0	0	3	0	15	0	1714.9142	P68366	P68366	TUBA1;TUBA4A	Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	yes	yes	3	0.12995	66.989	1	0	2	1	0	2	1	1																																		1	1																																		202450	112770	89674	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
48	5;150	48	492;493;494;495;496;497;498;499;500;501;502;503;504;505;506;507;508;509;510;511;512;513;514;515;516;517;518;519;520	260;261;262;263;264;265;266;267;268;269;270	263		AVFVDLEPTVIDEVR	1	1	0	2	0	0	2	0	0	1	1	0	0	1	1	0	1	0	0	4	0	15	0	1700.8985	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain	no	no	2,3	2.882E-20	211.38	1	0	29	NaN	NaN		2	2	2	2			2	2					1		2	2	1	1	2	2	2	2					1	1																																											11713000	2830100	2451200	1560800	1401900	0	0	357510	326240	0	0	0	0	25354	0	460040	442250	51917	41708	274340	198560	626990	525870	0	0	0	0	94723	43265	0	0	0	0	0	0	0		+
49	174	49	521;522;523;524;525	271	271		AVQFFVQALR	2	1	0	0	0	2	0	0	0	0	1	0	0	2	0	0	0	0	0	2	0	10	0	1177.6608	Q99615	Q99615	DNAJC7;TPR2;TTC2	DnaJ homolog subfamily C member 7;Tetratricopeptide repeat protein 2	yes	yes	2	0.027095	85.29	1	0	5	1	0	5	1	1	1	1				1																												1	1	1	1				1																												210590	48787	35974	56477	56290	0	0	0	13066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
50	113	50	526;527;528;529;530	272;273	273		AWGILTFK	1	0	0	0	0	0	0	1	0	1	1	1	0	1	0	0	1	1	0	0	0	8	0	934.52764	P82930	P82930	MRPS34	28S ribosomal protein S34, mitochondrial	yes	yes	2	0.12041	79.116	1	0	5	1	0	5					1	1	1	1																				1												1	1	1	1																				1								451870	0	0	0	0	78475	74406	137950	106090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54950	0	0	0	0	0	0	0		
51	78	51	531;532;533	274	274		CGHSENFFFIEVGR	0	1	1	0	1	0	2	2	1	1	0	0	0	3	0	1	0	0	0	1	0	14	0	1697.762	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	3	0.010562	96.745	1	0	3	1	0	3																		1	1	1																																	1	1	1																225550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26649	116850	82051	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
52	202	52	534;535;536;537;538;539;540;541;542;543;544;545;546;547;548;549;550;551;552;553;554;555;556;557;558;559;560;561;562	275;276;277;278	276		CHRNLLDCLMLMMR	0	2	1	1	2	0	0	0	1	0	4	0	3	0	0	0	0	0	0	0	0	14	1	1861.8606	REV__Q8WX94	REV__Q8WX94			yes	yes	3	0.088848	34.685	1	0	29	1	0	29		1	1	1	1	1	1	1	1	1	1		1	2	1	2	1	2	2	1	2	1						1				1		1	1		1	1	1	1	1	1	1	1	1	1		1	2	1	2	1	2	2	1	2	1						1				1		1	1	3203200	0	44615	92145	118780	116760	152730	76139	69328	67246	95190	37737	0	261470	297420	134680	142960	178900	190760	216170	26497	160880	79098	0	0	0	0	0	21729	0	0	0	80273	0	270210	271500	+	
53	73	53	563;564;565;566	279;280;281;282	281		CMMAQYNR	1	1	1	0	1	1	0	0	0	0	0	0	2	0	0	0	0	0	1	0	0	8	0	1072.4252	P31948	P31948	STIP1	Hsc70/Hsp90-organizing protein;Renal carcinoma antigen NY-REN-11;Stress-induced-phosphoprotein 1;Transformation-sensitive protein IEF SSP 3521	yes	yes	2	0.082907	13.053	1	0	4	1	0	4																1										2			1																						1										2			1							0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
54	38	54	567;568;569;570;571;572;573;574;575;576;577	283;284;285;286;287;288;289	284		CNLLEGEPR	0	1	1	0	1	0	2	1	0	0	2	0	0	0	1	0	0	0	0	0	0	9	0	1086.5128	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	6.7954E-12	107.57	1	0	11	1	0	11	1	1	2	1										1							2	1	1	1												1	1	2	1										1							2	1	1	1												714700	152760	127560	151830	107700	0	0	0	0	0	0	0	0	0	24835	0	0	0	0	0	0	104360	0	0	45663	0	0	0	0	0	0	0	0	0	0	0		
55	16	55	578;579;580;581;582;583;584;585;586;587;588;589;590;591;592;593	290;291;292;293;294;295;296;297;298	290		DAEAWFNEK	2	0	1	1	0	0	2	0	0	0	0	1	0	1	0	0	0	1	0	0	0	9	0	1108.4825	CON__P13645;P13645;CON__Q7Z3Y7;CON__Q148H6;Q7Z3Y7;CON__Q7Z3Y8;Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Z0	CON__P13645	KPP;KRT10;KPP;KRT10;KRT25D;KRT28;KRT25D;KRT28;KRT25C;KRT27;KRT25C;KRT27;KRT25;KRT25A;KRT25;KRT25A	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-28;Keratin, type I cytoskeletal 28;Keratin-25D;Keratin-28;Type I inner root sheath-specific keratin-K25irs4;Cytokeratin-27;Keratin, type I cytoskeletal 27;Keratin-25C;Keratin-27;Type I inner root sheath-specific keratin-K25irs3;Cytokeratin-25;Keratin, type I cytoskeletal 25;Keratin-25;Keratin-25A;Type I inner root sheath-specific keratin-K25irs1	yes	no	2	3.7884E-12	116.05	1	0	16	1	0	16				1	1	1	1	1			1				1	1	1	1	1	1	1	1									1				1				1	1	1	1	1			1				1	1	1	1	1	1	1	1									1				1	817100	0	0	0	43266	46155	71498	37672	37352	0	0	30302	0	0	0	41854	0	103020	87910	29421	25013	70563	60490	0	0	0	0	0	0	0	0	83251	0	0	0	49328		+
56	8	56	594;595;596;597	299;300	300		DAEEWFFTK	1	0	0	1	0	0	2	0	0	0	0	1	0	2	0	0	1	1	0	0	0	9	0	1171.5186	CON__P02533;P02533;CON__Q6IFX2	CON__P02533	KRT14;KRT14;Ka22;Krt42	Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-42;Keratin, type I cytoskeletal 42;Keratin-17n;Keratin-42;Type I keratin Ka22	yes	no	2	0.0098159	97.431	1	0	4	1	0	4													1				1	1													1																	1				1	1													1					103120	0	0	0	0	0	0	0	0	0	0	0	0	26039	0	0	0	0	40684	0	0	0	0	0	0	0	0	0	0	0	0	36394	0	0	0	0		+
57	55	57	598;599;600;601;602;603;604;605;606;607;608;609;610;611;612;613;614;615;616;617;618;619;620;621;622;623;624;625;626;627;628;629;630;631;632;633;634;635;636;637;638;639;640	301;302;303;304;305;306;307;308;309;310;311;312;313;314;315;316;317;318;319;320;321;322;323;324;325;326;327;328	307		DAGTIAGLNVLR	2	1	1	1	0	0	0	2	0	1	2	0	0	0	0	0	1	0	0	1	0	12	0	1198.667	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	2	1.2361E-45	199.43	1	0	43	1	0	43	2	1	2	1	1	1	1	2	1	1	1	1	1	1	1	1	2	2	1	2	1	1	1	1	1	1	2	2	1	1	1	1	1	2		2	1	2	1	1	1	1	2	1	1	1	1	1	1	1	1	2	2	1	2	1	1	1	1	1	1	2	2	1	1	1	1	1	2		17017000	2115200	2225500	2148700	2401700	334600	324570	431070	489740	139910	134670	160140	166880	152100	176930	154400	202750	173290	123430	102660	154280	1319500	1245800	146780	168510	60322	78756	570730	548920	57466	70282	47693	67452	64466	257900	0		
58	52	58	641;642;643;644;645;646;647;648;649;650;651;652;653;654;655;656;657;658;659;660	329;330;331;332;333;334;335;336;337;338;339;340;341;342;343	329		DAGVIAGLNVLR	2	1	1	1	0	0	0	2	0	1	2	0	0	0	0	0	0	0	0	2	0	12	0	1196.6877	P0DMV8;P0DMV9	P0DMV8			no	no	2	2.2739E-05	163.12	1	0	20	NaN	NaN		1	1	1	1	1	1	1	1					1	1	1	1	1	1	1	1	1	1					1	1																																											2347900	352060	354390	279040	302320	73672	62483	67414	62365	0	0	0	0	44529	54552	67923	78037	40724	34384	44855	34865	146710	154800	0	0	0	0	43483	49313	0	0	0	0	0	0	0		
59	85;25	59	661;662;663;664	344;345;346	345		DALLNWLK	1	0	1	1	0	0	0	0	0	0	3	1	0	0	0	0	0	1	0	0	0	8	0	971.54402	P42338;O00329	P42338	PIK3C1;PIK3CB;PIK3CD	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform;Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform	no	no	2	0.0032099	127.02	1	0	4	NaN	NaN																		1	1	1	1																																																			751440	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	247150	203640	176930	123730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
60	58	60	665;666;667;668;669;670;671;672;673;674;675;676;677;678;679	347;348;349;350;351;352;353;354;355;356;357;358;359	348		DFLAGGIAAAISK	4	0	0	1	0	0	0	2	0	2	1	1	0	1	0	1	0	0	0	0	0	13	0	1232.6765	P12236	P12236	ANT3;CDABP0051;SLC25A6	Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6	yes	yes	2	1.2049E-21	172.92	1	0	15	1	0	15	1	1	1	1		1	1	1					1		1	1	1				1	1						1			1					1	1	1	1		1	1	1					1		1	1	1				1	1						1			1					1655400	351280	284340	184240	209280	0	30275	46739	52739	0	0	0	0	0	0	80915	91761	18644	0	0	0	143340	124510	0	0	0	0	0	37346	0	0	0	0	0	0	0		
61	43	61	680;681;682;683;684;685;686;687;688;689;690;691;692;693;694;695;696;697;698;699;700;701;702	360;361;362;363;364;365;366;367;368;369;370;371;372;373;374;375;376;377	373		DFLAGGVAAAISK	4	0	0	1	0	0	0	2	0	1	1	1	0	1	0	1	0	0	0	1	0	13	0	1218.6608	P05141	P05141	ANT2;SLC25A5	Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5	yes	yes	2	2.5752E-43	205.46	1	0	23	1	0	23	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1		1	1					1	1	1	1	1			1		1	1	1	1	1	1	1	1					1	1	1	1	1	1	1		1	1					1	1	1	1	1			1		4621800	712810	740110	588950	573990	118270	126410	116350	124590	0	0	0	0	147220	156350	179180	163460	0	41226	42135	0	287850	253130	0	0	0	0	59150	51084	0	26380	81190	0	0	31948	0		
62	35	62	703;704;705;706;707;708;709;710;711	378;379;380	380		DFLTPPLLSVR	0	1	0	1	0	0	0	0	0	0	3	0	0	1	2	1	1	0	0	1	0	11	0	1256.7129	O95782	O95782	ADTAA;AP2A1;CLAPA1	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit	yes	yes	2	0.035104	77.662	1	0	9	1	0	9	1	1	1	1										1	1	1						1									1					1	1	1	1										1	1	1						1									1					506930	60288	61262	46610	45290	0	0	0	0	0	0	0	0	0	39073	107380	87692	0	0	0	0	0	24901	0	0	0	0	0	0	0	0	34438	0	0	0	0		
63	84	63	712;713;714;715;716;717	381;382;383;384;385	381		DFLWSHR	0	1	0	1	0	0	0	0	1	0	1	0	0	1	0	1	0	1	0	0	0	7	0	959.46135	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.015366	122.79	1	0	6	1	0	6																	1	1	1	1														1	1																	1	1	1	1														1	1	641670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	125940	135090	134150	111750	0	0	0	0	0	0	0	0	0	0	0	0	0	61854	72878		
64	26	64	718;719	386;387	386		DGAPEPGLTLPDLPEQFSPPDVAPPLLVK	2	0	0	3	0	1	2	2	0	0	5	1	0	1	8	1	1	0	0	2	0	29	0	3008.5747	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	1.3222E-08	103.9	1	0	2	1	0	2																			1	1																																		1	1																11976000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6106800	5869100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
65	163	65	720;721	388	388		DGFVCALLR	1	1	0	1	1	0	0	1	0	0	2	0	0	1	0	0	0	0	0	1	0	9	0	1049.5328	Q8WUY1	Q8WUY1	C8orf55;PSEC0098	Mesenchymal stem cell protein DSCD75;UPF0670 protein C8orf55	yes	yes	2	0.0095436	98.033	1	0	2	1	0	2				1																	1																		1																	1															78885	0	0	0	56864	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22021	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
66	197	66	722;723	389	389		DHQFILR	0	1	0	1	0	1	0	0	1	1	1	0	0	1	0	0	0	0	0	0	0	7	0	927.49265	REV__Q6IE37	REV__Q6IE37			yes	yes	2	0.049035	101.64	1	0	2	1	0	2														1	1																																		1	1																					2330700	0	0	0	0	0	0	0	0	0	0	0	0	0	25763	2305000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
67	32	67	724;725;726;727	390;391	391		DIVQFVPFR	0	1	0	1	0	1	0	0	0	1	0	0	0	2	1	0	0	0	0	2	0	9	0	1119.6077	Q9UBL6;Q9HCH3;Q86YQ8;O95741;Q96A23;Q8IYJ1;Q96FN4;O75131	Q9UBL6	CPNE7;CPNE5;KIAA1599;CPNE8;CPNE6;CPNE4;CPNE9;CPNE2;CPN3;CPNE3;KIAA0636	Copine VII;Copine-7;Copine V;Copine-5;Copine VIII;Copine-8;Copine VI;Copine-6;Neuronal-copine;Copine IV;Copine-4;Copine IX;Copine-9;Copine II;Copine-2;Copine III;Copine-3	yes	no	2	0.0081552	101.11	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																160180	38969	40669	40183	40356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
68	84	68	728;729;730;731	392;393	392		DKNKGEIYDAAIDLFTR	2	1	1	3	0	0	1	1	0	2	1	2	0	1	0	0	1	0	1	0	0	17	2	1967.9953	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	3	0.004851	90.367	1	0	4	1	0	4																	1	1	1	1																																1	1	1	1																406350	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	93089	105430	106500	101320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
69	91	69	732;733;734;735;736;737;738;739	394;395	395		DLEKPFLLPVEAVYSVPGR	1	1	0	1	0	0	2	1	0	0	3	1	0	1	3	1	0	0	1	3	0	19	1	2128.1568	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial;P43	yes	yes	3	0.0021616	82.259	1	0	8	1	0	8	1	1	1	1				1								1					1	1														1	1	1	1				1								1					1	1														1853800	532560	595720	144060	157900	0	0	0	43231	0	0	0	0	0	0	0	68198	0	0	0	0	150360	161740	0	0	0	0	0	0	0	0	0	0	0	0	0		
70	49	70	740;741;742;743;744;745;746;747;748;749;750;751;752	396;397;398;399;400;401;402;403;404;405	399		DLIGFGLQVAK	1	0	0	1	0	1	0	2	0	1	2	1	0	1	0	0	0	0	0	1	0	11	0	1159.6601	P08581	P08581	MET	Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met	yes	yes	2	0.00057186	129.89	1	0	13	1	0	13	1												1		1	1					1	1					1	1	1	1	1			1	1	1												1		1	1					1	1					1	1	1	1	1			1	1	1126500	36690	0	0	0	0	0	0	0	0	0	0	0	28854	0	74291	55753	0	0	0	0	145350	128050	0	0	0	0	42115	39497	71548	73250	330050	0	0	51709	49388		
71	54	71	753;754;755;756;757;758;759;760;761;762;763;764;765;766;767;768;769;770;771;772;773;774;775;776;777;778;779;780;781;782;783;784;785;786;787;788;789;790;791;792;793;794;795;796;797;798	406;407;408;409;410;411;412;413;414;415;416;417	410		DNHLLGTFDLTGIPPAPR	1	1	1	2	0	0	0	2	1	1	3	0	0	1	3	0	2	0	0	0	0	18	0	1933.0058	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2,3	0.00055502	111.01	1	0	46	1	0	46	4	7	4	4			3	4							2	2			1	2	4	4					1	2			2					4	7	4	4			3	4							2	2			1	2	4	4					1	2			2					13609000	2854300	2343800	1327700	1503300	0	0	562890	573530	0	0	0	0	0	0	88575	125680	0	0	29210	66862	1632300	1847500	0	0	0	0	261900	317720	0	0	73635	0	0	0	0		
72	84	72	799;800	418;419	418		DPLSEITEQEKDFLWSHR	0	1	0	2	0	1	3	0	1	1	2	1	0	1	1	2	1	1	0	0	0	18	1	2229.0702	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	3	0.00054666	102.5	1	0	2	1	0	2																			1	1																																		1	1																900490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	451580	448910	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
73	26	73	801;802;803;804;805;806;807;808;809;810;811;812;813;814;815	420;421;422;423;424;425;426;427;428;429;430	421		DQYLVWLTQK	0	0	0	1	0	2	0	0	0	0	2	1	0	0	0	0	1	1	1	1	0	10	0	1292.6765	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	8.0914E-08	173.64	1	0	15	1	0	15						1	1	1									3	2	2	1												1	1	1	1						1	1	1									3	2	2	1												1	1	1	1	11441000	0	0	0	0	0	23940	62531	82052	0	0	0	0	0	0	0	0	4440000	4316400	43045	0	0	0	0	0	0	0	0	0	0	0	0	492450	480800	723320	776180		
74	87	74	816;817	431	431		DSLIIIDELGR	0	1	0	2	0	0	1	1	0	3	2	0	0	0	0	1	0	0	0	0	0	11	0	1242.682	P43246	P43246	MSH2	DNA mismatch repair protein Msh2;MutS protein homolog 2	yes	yes	2	0.077264	70.977	1	0	2	1	0	2													1	1																																		1	1																						72406	0	0	0	0	0	0	0	0	0	0	0	0	32096	40310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
75	113	75	818;819;820;821	432	432		DSQLYAVDYETLTRPFSGR	1	2	0	2	0	1	1	1	0	0	2	0	0	1	1	2	2	0	2	1	0	19	1	2217.0702	P82930	P82930	MRPS34	28S ribosomal protein S34, mitochondrial	yes	yes	3	0.0019854	83.37	1	0	4	1	0	4							1	1																			1	1														1	1																			1	1								342040	0	0	0	0	0	0	82413	125350	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67413	66856	0	0	0	0	0	0	0		
76	157	76	822	433	433		DSSVKRGYFQK	0	1	0	1	0	1	0	1	0	0	0	2	0	1	0	2	0	0	1	1	0	11	2	1313.6728	Q8NEG7	Q8NEG7	FAM116B	Protein FAM116B	yes	yes	2	0.08203	35.652	1	0	1	1	0	1																	1																																			1																			1376200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1376200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
77	101;70	77	823;824;825;826;827;828;829;830	434;435	434		DSTLIMQLLR	0	1	0	1	0	1	0	0	0	1	3	0	1	0	0	1	1	0	0	0	0	10	0	1188.6536	P62258;P31947;P61981;P31946;Q04917;P63104;P27348	P62258	YWHAE;HME1;SFN;YWHAG;YWHAB;YWHA1;YWHAH;YWHAZ;YWHAQ	14-3-3 protein epsilon;14-3-3 protein sigma;Epithelial cell marker protein 1;Stratifin;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;Protein kinase C inhibitor protein 1;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;Protein 1054;14-3-3 protein eta;Protein AS1;14-3-3 protein zeta/delta;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1	no	no	2	0.0034526	105.98	1	0	8	NaN	NaN		1	1													1	1	1	1	1	1																																																			601060	83757	74147	0	0	0	0	0	0	0	0	0	0	0	0	87782	62041	69073	82737	71383	70138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
78	26	78	831;832;833;834;835;836;837;838	436;437;438;439;440	439		DTPDGTFLVR	0	1	0	2	0	0	0	1	0	0	1	0	0	1	1	0	2	0	0	1	0	10	0	1119.556	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.00087659	113.71	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	1246000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	151230	176180	286450	249400	0	0	0	0	0	0	0	0	0	0	0	80754	83728	108200	110050		
79	5;150	79	839;840;841;842	441;442;443;444	441		DVNAAIATIK	3	0	1	1	0	0	0	0	0	2	0	1	0	0	0	0	1	0	0	1	0	10	0	1014.571	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain	no	no	2	0.002013	109.42	1	0	4	NaN	NaN		1	1	1	1																																																																			230990	50939	63868	52103	64084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
80	26	80	843;844;845;846;847;848;849;850;851;852;853;854;855;856;857;858;859;860;861;862;863;864;865;866;867;868;869;870;871;872	445;446;447;448;449;450;451;452	446		EAAGPVGPALEPPTLPLHR	3	1	0	0	0	0	2	2	1	0	3	0	0	0	5	0	1	0	0	1	0	19	0	1921.0421	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	0.0001128	129.01	1	0	30	1	0	30		1			1	1	1	1					1		1	1	3	2	4	2								1				3	3	2	2		1			1	1	1	1					1		1	1	3	2	4	2								1				3	3	2	2	40371000	0	145360	0	0	96485	96376	240790	308000	0	0	0	0	19307	0	95236	41052	5340000	5171300	9761000	7290500	0	0	0	0	0	0	0	63342	0	0	0	2527100	2603000	3247200	3325000		
81	166	81	873;874;875;876;877;878	453;454;455;456;457	455		EALDVLGAVLK	2	0	0	1	0	0	1	1	0	0	3	1	0	0	0	0	0	0	0	2	0	11	0	1126.6598	Q92552	Q92552	KIAA0264;MRPS27	28S ribosomal protein S27, mitochondrial	yes	yes	2	0.00087624	112.36	1	0	6	1	0	6					1	1	1	1																			1	1												1	1	1	1																			1	1								959600	0	0	0	0	149290	189620	211030	189320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	109260	111090	0	0	0	0	0	0	0		
82	85	82	879;880	458	458		EALELLDFNYPDQYVR	1	1	1	2	0	1	2	0	0	0	3	0	0	1	1	0	0	0	2	1	0	16	0	1983.9578	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2	0.0039645	120.7	1	0	2	1	0	2																			1	1																																		1	1																514920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	260890	254030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
83	128	83	881;882	459;460	459		EALSVALEEAQAWR	4	1	0	0	0	1	3	0	0	0	2	0	0	0	0	1	0	1	0	1	0	14	0	1571.7944	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	3	0.0081786	124.42	1	0	2	1	0	2																			1	1																																		1	1																167820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104460	63351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
84	26	84	883;884;885;886;887;888	461;462;463;464;465	463		EDSVEAVGAQLK	2	0	0	1	0	1	2	1	0	0	1	1	0	0	0	1	0	0	0	2	0	12	0	1244.6248	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.0028082	110.66	1	0	6	1	0	6																	1	1	1	1														1	1																	1	1	1	1														1	1	398780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55483	60843	93867	83881	0	0	0	0	0	0	0	0	0	0	0	0	0	49374	55331		
85	114	85	889	466	466		EEGVLTLWR	0	1	0	0	0	0	2	1	0	0	2	0	0	0	0	0	1	1	0	1	0	9	0	1101.5819	Q02978	Q02978	SLC20A4;SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11	yes	yes	2	0.11783	51.066	1	0	1	1	0	1				1																																			1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
86	194	86	890;891;892;893;894;895;896;897	467	467		EFKAEINKLLQEEK	1	0	1	0	0	1	4	0	0	1	2	3	0	1	0	0	0	0	0	0	0	14	2	1717.9251	REV__Q0VFZ6	REV__Q0VFZ6			yes	yes	3	0.088848	83.204	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														1494200	453930	411620	218710	201300	0	0	0	0	0	0	0	0	0	0	38379	51807	0	0	0	0	59827	58648	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
87	120;121	87	898;899;900;901;902	468	468		EFTDYLFNK	0	0	1	1	0	0	1	0	0	0	1	1	0	2	0	0	1	0	1	0	0	9	0	1175.5499	Q07889;Q07890	Q07889	SOS1;SOS2	Son of sevenless homolog 1;Son of sevenless homolog 2	no	no	2	0.060002	78.516	1	0	5	NaN	NaN								1						1	1		1				1																																																			212240	0	0	0	0	0	0	24611	0	0	0	0	0	35903	72032	0	46865	0	0	0	32828	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
88	67	88	903;904;905;906;907;908;909	469;470;471	471		EGFYLFPDGR	0	1	0	1	0	0	1	2	0	0	1	0	0	2	1	0	0	0	1	0	0	10	0	1199.5611	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	2	0.017875	101.65	1	0	7	1	0	7															1	1	1	1	2	1																														1	1	1	1	2	1																483170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42290	41695	69470	73768	190550	65402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
89	108	89	910;911;912	472	472		EHALLAYTLGVK	2	0	0	0	0	0	1	1	1	0	3	1	0	0	0	0	1	0	1	1	0	12	0	1313.7343	Q05639;P68104;Q5VTE0	Q05639	EEF1A2;EEF1AL;STN;EEF1A;EEF1A1;EF1A;LENG7;EEF1AL3	Elongation factor 1-alpha 2;Eukaryotic elongation factor 1 A-2;Statin-S1;Elongation factor 1-alpha 1;Elongation factor Tu;Eukaryotic elongation factor 1 A-1;Leukocyte receptor cluster member 7;Eukaryotic elongation factor 1 A-like 3;Putative elongation factor 1-alpha-like 3	yes	no	2	0.0046044	104.43	1	0	3	1	0	3	1		1	1																																1		1	1																																159010	58335	0	46189	54485	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
90	38	90	913;914;915	473;474	474		EHKDNIGSQYLLNWCVQIAK	1	0	2	1	1	2	1	1	1	2	2	2	0	0	0	1	0	1	1	1	0	20	1	2415.2005	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	2.3732E-06	115.8	1	0	3	1	0	3	1	1													1																					1	1													1																					717860	328020	270390	0	0	0	0	0	0	0	0	0	0	0	0	119450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
91	5;150	91	916;917;918;919;920;921;922;923;924;925;926;927;928;929;930;931	475;476;477;478;479;480;481;482;483;484;485	477		EIIDLVLDR	0	1	0	2	0	0	1	0	0	2	2	0	0	0	0	0	0	0	0	1	0	9	0	1084.6128	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain	no	no	2	0.0042642	109.71	1	0	16	NaN	NaN		1	1	1	1	1	1	1	1					1	1	1	1	1				1	1					1																																												2381800	513950	517160	316740	347920	55785	59700	73746	75043	0	0	0	0	40387	38125	79446	78943	32448	0	0	0	74441	53795	0	0	0	0	24137	0	0	0	0	0	0	0	0		+
92	94	92	932;933;934;935;936	486;487;488	488		EIIELLFHK	0	0	0	0	0	0	2	0	1	2	2	1	0	1	0	0	0	0	0	0	0	9	0	1140.6543	P52735	P52735	VAV2	Guanine nucleotide exchange factor VAV2	yes	yes	2	0.0070845	78.516	1	0	5	1	0	5			1										1	1	1	1																						1										1	1	1	1																				139250	0	0	36728	0	0	0	0	0	0	0	0	0	0	42183	60335	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
93	38	93	937;938;939;940;941	489	489		EILDEAYVMASVDNPHVCR	2	1	1	2	1	0	2	0	1	1	1	0	1	0	1	1	0	0	1	3	0	19	0	2217.0194	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.075365	63.128	1	0	5	1	0	5	1	1													1						1	1														1	1													1						1	1														1031600	325640	270730	0	0	0	0	0	0	0	0	0	0	0	0	76713	0	0	0	0	0	198810	159730	0	0	0	0	0	0	0	0	0	0	0	0	0		
94	38	94	942;943;944;945;946;947;948;949;950;951;952;953	490;491;492;493;494;495;496;497;498	496		EISDGDVIISGNK	0	0	1	2	0	0	1	2	0	3	0	1	0	0	0	2	0	0	0	1	0	13	0	1345.6725	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	4.444E-19	215.08	1	0	12	1	0	12	1	1	1	1									1	1	1	1					1	1	1	1												1	1	1	1									1	1	1	1					1	1	1	1												2487700	466530	498690	277990	327300	0	0	0	0	0	0	0	0	57282	74862	94154	78824	0	0	0	0	166150	170010	143370	132500	0	0	0	0	0	0	0	0	0	0	0		
95	138	95	954	499	499		EKEEMEMEIMEMEEEK	0	0	0	0	0	0	9	0	0	1	0	2	4	0	0	0	0	0	0	0	0	16	1	2072.8298	Q4G1C9	Q4G1C9	GLIPR1L2	GLIPR1-like protein 2	yes	yes	4	0.05097	5.4286	1	0	1	1	0	1														1																																			1																						101790	0	0	0	0	0	0	0	0	0	0	0	0	0	101790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
96	66	96	955;956;957;958;959;960;961;962;963	500;501;502	501		ELANEFTR	1	1	1	0	0	0	2	0	0	0	1	0	0	1	0	0	1	0	0	0	0	8	0	978.47706	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	0.00051478	136.11	1	0	9	1	0	9					1	1	1	1										1		1					1	1	1													1	1	1	1										1		1					1	1	1									717730	0	0	0	0	116200	124980	129510	124280	0	0	0	0	0	0	0	0	0	32493	0	43250	0	0	0	0	45076	46143	55807	0	0	0	0	0	0	0	0		
97	54	97	964;965;966;967;968;969;970;971;972;973;974;975;976	503;504;505;506;507;508;509;510;511	503		ELEEIVQPIISK	0	0	0	0	0	1	3	0	0	3	1	1	0	0	1	1	0	0	0	1	0	12	0	1396.7813	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.00017107	155.48	1	0	13	1	0	13	1	1	1	1	1	1	1	1													1	1					1	1		1						1	1	1	1	1	1	1	1													1	1					1	1		1						4265100	492730	523920	504840	512610	298140	301730	298730	235000	0	0	0	0	0	0	0	0	0	0	0	0	396350	415570	0	0	0	0	150140	120030	0	15279	0	0	0	0	0		
98	38	98	977;978;979;980;981;982;983;984;985;986;987;988;989;990;991;992;993;994;995;996	512;513;514;515;516;517;518	515		ELIIEFSK	0	0	0	0	0	0	2	0	0	2	1	1	0	1	0	1	0	0	0	0	0	8	0	977.54335	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.029827	100.19	1	0	20	1	0	20	1	1	1	1	1	1	1	1					1	1		1	1	1	1	1	1		1					1	1	1						1	1	1	1	1	1	1	1					1	1		1	1	1	1	1	1		1					1	1	1						22588000	3494800	3159700	3937700	4543200	55833	45593	75102	79680	0	0	0	0	1087000	977170	0	1304600	99087	151140	174210	134790	2368200	0	358030	0	0	0	0	48222	235500	258610	0	0	0	0	0		
99	160	99	997;998;999;1000;1001;1002;1003;1004;1005;1006;1007;1008	519	519		ELPRPEMPMFLGLAFATQYR	2	2	0	0	0	1	2	1	0	0	3	0	2	2	3	0	1	0	1	0	0	20	1	2366.1915	Q8NFI3	Q8NFI3	ENGASE	Cytosolic endo-beta-N-acetylglucosaminidase	yes	yes	3	0.18691	12.714	1	0	12	1	0	12		1					1	1								1		1	1	1		1					1	1			1			1			1					1	1								1		1	1	1		1					1	1			1			1		5241800	0	401400	0	0	0	0	500210	461880	0	0	0	0	0	0	0	448840	0	338830	237630	170120	0	473850	0	0	0	0	653160	654260	0	0	558930	0	0	342660	0		
100	129	100	1009;1010;1011;1012	520;521;522	522		ELQNFLR	0	1	1	0	0	1	1	0	0	0	2	0	0	1	0	0	0	0	0	0	0	7	0	918.49232	Q14571	Q14571	ITPR2	Inositol 1,4,5-trisphosphate receptor type 2;IP3 receptor isoform 2;Type 2 inositol 1,4,5-trisphosphate receptor	yes	yes	2	0.069662	89.296	1	0	4	1	0	4														1	1	1														1																			1	1	1														1						232220	0	0	0	0	0	0	0	0	0	0	0	0	0	47481	89627	67958	0	0	0	0	0	0	0	0	0	0	0	0	0	27153	0	0	0	0	0		
101	83	101	1013;1014;1015;1016	523;524;525	524		ELSAVTFPDIIR	1	1	0	1	0	0	1	0	0	2	1	0	0	1	1	1	1	0	0	1	0	12	0	1359.7398	P42224	P42224	STAT1	Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84	yes	yes	2	3.7066E-05	162.38	1	0	4	1	0	4	1		1	1											1																					1		1	1											1																					579980	181450	0	178730	191830	0	0	0	0	0	0	0	0	0	0	27980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
102	16	102	1017;1018;1019;1020;1021;1022;1023;1024;1025;1026;1027;1028;1029	526;527;528;529;530;531;532;533	528		ELTTEIDNNIEQISSYK	0	0	2	1	0	1	3	0	0	3	1	1	0	0	0	2	2	0	1	0	0	17	0	1995.9637	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	1.511E-24	214.53	1	0	13	1	0	13			1	1				1	1						1	1	1	1	1	1	1	1									1							1	1				1	1						1	1	1	1	1	1	1	1									1					2100500	0	0	100510	75811	0	0	0	27983	50249	0	0	0	0	0	158590	161660	250200	195930	121490	128140	239770	223370	0	0	0	0	0	0	0	0	366790	0	0	0	0		+
103	38	103	1030;1031;1032;1033;1034;1035;1036;1037;1038;1039;1040;1041;1042;1043;1044;1045;1046;1047;1048;1049;1050;1051;1052;1053;1054;1055;1056;1057;1058;1059;1060;1061;1062;1063;1064;1065;1066	534;535;536;537;538;539;540;541;542;543;544;545;546;547;548;549;550;551;552;553;554;555;556;557;558;559	544		ELVEPLTPSGEAPNQALLR	2	1	1	0	0	1	3	1	0	0	4	0	0	0	3	1	1	0	0	1	0	19	0	2033.0793	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	2.4222E-16	184.02	1	0	37	1	0	37	2	2	3	3	1	1	1	1					2	2	2	3	1	1	2	2	2	3							1	1	1					2	2	3	3	1	1	1	1					2	2	2	3	1	1	2	2	2	3							1	1	1					51252000	7397400	7701700	9860600	10103000	24667	34951	77730	93499	0	0	0	0	1642000	1778400	2184800	2194800	135980	125060	326770	240460	3494600	3086300	0	0	0	0	0	0	160330	216380	372540	0	0	0	0		
104	43;58	104	1067;1068;1069;1070;1071;1072;1073;1074;1075;1076;1077;1078;1079;1080;1081;1082;1083;1084	560;561;562;563;564;565;566	565		EQGVLSFWR	0	1	0	0	0	1	1	1	0	0	1	0	0	1	0	1	0	1	0	1	0	9	0	1120.5665	P05141;P12236	P05141	ANT2;SLC25A5;ANT3;CDABP0051;SLC25A6	Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6	no	no	2	0.0021207	118.18	1	0	18	NaN	NaN		1	1	1	1	1	1	1	1					1	1	1	1		1		1	1	1						1			1																																								3400700	542010	469710	525500	483170	48197	57610	84978	94788	0	0	0	0	53835	75517	163150	146150	0	32327	0	29474	268480	236180	0	0	0	0	0	36856	0	0	52773	0	0	0	0		
105	151	105	1085;1086;1087;1088;1089;1090	567;568;569	567		EQPLDLIK	0	0	0	1	0	1	1	0	0	1	2	1	0	0	1	0	0	0	0	0	0	8	0	954.5386	Q75V66	Q75V66	ANO5;GDD1;TMEM16E	Anoctamin-5;Gnathodiaphyseal dysplasia 1 protein;Transmembrane protein 16E	yes	yes	2	0.019307	111.17	1	0	6	1	0	6	1	1	1												1							1									1					1	1	1												1							1									1					2111500	526100	459260	588830	0	0	0	0	0	0	0	0	0	0	0	207160	0	0	0	0	0	0	269340	0	0	0	0	0	0	0	0	60793	0	0	0	0		
106	26	106	1091;1092;1093;1094;1095;1096;1097;1098;1099;1100;1101;1102;1103;1104;1105;1106;1107;1108;1109;1110;1111;1112;1113;1114;1115;1116;1117;1118	570;571;572;573;574;575;576;577;578;579;580;581;582;583;584;585	578		ERPEDLELLPGDVLVVSR	0	2	0	2	0	0	3	1	0	0	4	0	0	0	2	1	0	0	0	3	0	18	1	2035.095	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	1.2925E-06	156.5	1	0	28	1	0	28							1	2								1	2	2	6	5							1	1				1	2	2	2							1	2								1	2	2	6	5							1	1				1	2	2	2	56634000	0	0	0	0	0	0	248100	342880	0	0	0	0	0	0	0	63570	7567300	7012100	21436000	15806000	0	0	0	0	0	0	95855	60116	0	0	0	344780	495680	1571800	1589900		
107	38	107	1119;1120;1121;1122;1123;1124;1125;1126;1127;1128;1129;1130	586;587;588	586		ESDCLVCR	0	1	0	1	2	0	1	0	0	0	1	0	0	0	0	1	0	0	0	1	0	8	0	1037.427	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.064802	89.142	1	0	12	1	0	12	1	1	1	1									1	1	1	1					1	1	1	1												1	1	1	1									1	1	1	1					1	1	1	1												3533300	685930	580410	551780	563050	0	0	0	0	0	0	0	0	64552	80374	104790	119010	0	0	0	0	159220	138560	233180	252410	0	0	0	0	0	0	0	0	0	0	0		
108	106	108	1131;1132;1133;1134;1135;1136;1137;1138;1139;1140;1141;1142	589;590;591;592	590		ESESAPGDFSLSVK	1	0	0	1	0	0	2	1	0	0	1	1	0	1	1	4	0	0	0	1	0	14	0	1451.678	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	0.07481	74.46	1	0	12	1	0	12							1						2	1	1	1		1	1			1							1	1	1											1						2	1	1	1		1	1			1							1	1	1					1841000	0	0	0	0	0	0	22064	0	0	0	0	0	292450	277880	275550	323360	0	37772	35971	0	0	34479	0	0	0	0	0	0	159670	195920	185900	0	0	0	0		
109	51	109	1143;1144;1145;1146;1147;1148;1149;1150;1151;1152;1153;1154;1155;1156;1157;1158;1159;1160;1161;1162;1163;1164;1165;1166;1167;1168;1169;1170;1171;1172	593;594;595;596;597;598;599;600;601	598		ESTLHLVLR	0	1	0	0	0	0	1	0	1	0	3	0	0	0	0	1	1	0	0	1	0	9	0	1066.6135	P0CG48;P0CG47;P62979;P62987	P0CG48	RPS27A;UBA80;UBCEP1;UBA52;UBCEP2	40S ribosomal protein S27a;60S ribosomal protein L40;CEP52	yes	no	2	0.0033491	111.74	1	0	30	1	0	30	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1		1	1	1	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1		1	1	1	4255400	177150	172630	302360	333460	112960	115420	135690	128970	0	0	0	0	159710	192620	241310	268930	154320	119900	218480	239730	181750	163610	58283	64814	50599	63571	81318	85022	73658	68950	85253	0	41907	89885	73091		
110	71	110	1173;1174;1175;1176;1177;1178;1179;1180;1181;1182;1183;1184;1185;1186;1187;1188;1189;1190;1191;1192;1193;1194;1195;1196;1197;1198;1199	602;603;604;605;606;607	603		ESTTTPGQYVLTGLQSGQPK	0	0	0	0	0	3	1	3	0	0	2	1	0	0	2	2	4	0	1	1	0	20	0	2091.0484	P29353	P29353	SHC;SHC1;SHCA	SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1	yes	yes	2,3	2.162E-14	165.8	1	0	27	1	0	27	1	2	2	2			1						2	2	2	2	1	1	2	1									2	2	2					1	2	2	2			1						2	2	2	2	1	1	2	1									2	2	2					3644200	54938	118540	161710	158960	0	0	25716	0	0	0	0	0	638800	728500	547540	576120	40425	36920	119230	52984	0	0	0	0	0	0	0	0	54444	111300	218110	0	0	0	0		
111	49	111	1200	608	608		EVFNILQAAYVSKPGAQLAR	4	1	1	0	0	2	1	1	0	1	2	1	0	1	1	1	0	0	1	2	0	20	1	2174.1848	P08581	P08581	MET	Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met	yes	yes	3	1.4909E-07	140.96	1	0	1	1	0	1																															1																																			1					485740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485740	0	0	0	0		
112	119	112	1201;1202;1203;1204	609;610	609		EVSFQSTGESEWK	0	0	0	0	0	1	3	1	0	0	0	1	0	1	0	3	1	1	0	1	0	13	0	1512.6733	Q07021	Q07021	C1QBP;GC1QBP;HABP1;SF2P32	Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33	yes	yes	2	6.262E-13	198.55	1	0	4	1	0	4									1	1	1	1																																1	1	1	1																								354840	0	0	0	0	0	0	0	0	122710	127520	48954	55659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
113	78	113	1205;1206;1207;1208;1209;1210;1211	611;612;613;614;615	615		EVWQVILKPK	0	0	0	0	0	1	1	0	0	1	1	2	0	0	1	0	0	1	0	2	0	10	1	1238.7387	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	2	0.0020257	109.29	1	0	7	1	0	7																	1	1	1	1												1	1		1																	1	1	1	1												1	1		1	1306100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	218050	181470	199820	135810	0	0	0	0	0	0	0	0	0	0	0	111160	113180	0	346620		
114	26	114	1212;1213;1214;1215;1216;1217;1218;1219	616;617;618;619	617		EYDQLYEEYTR	0	1	0	1	0	1	3	0	0	0	1	0	0	0	0	0	1	0	3	0	0	11	0	1507.6467	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	9.4494E-05	150.04	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	795460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	91912	115340	179000	181650	0	0	0	0	0	0	0	0	0	0	0	46254	32705	83105	65499		
115	18	115	1220;1221	620;621	620		FASFIDKVQFLEQQNK	1	0	1	1	0	3	1	0	0	1	1	2	0	3	0	1	0	0	0	1	0	16	1	1940.9996	CON__P19013;P19013	CON__P19013	CYK4;KRT4;CYK4;KRT4	Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4	yes	no	3	0.0035805	125.03	1	0	2	1	0	2																	1	1																																		1	1																		168570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71954	96612	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
116	79;39;17;23;14;12	116	1222;1223;1224;1225;1226;1227;1228;1229;1230;1231;1232;1233;1234;1235;1236;1237;1238;1239;1240;1241;1242;1243	622;623;624;625;626;627;628;629;630;631;632;633;634;635;636;637;638	637		FASFIDKVR	1	1	0	1	0	0	0	0	0	1	0	1	0	2	0	1	0	0	0	1	0	9	1	1081.592	CON__Q6NXH9;CON__Q7Z794;Q7Z794;CON__Q6IFZ6;CON__Q32MB2;Q86Y46;CON__Q9R0H5;CON__Q01546;CON__P12035;P12035;CON__Q6ISB0;CON__Q9NSB2;Q9NSB2;CON__Q7RTS7;Q7RTS7;CON__P07744;CON__Q3SY84;Q3SY84;CON__Q6IME9;CON__Q14CN4-1;Q14CN4;CON__Q9DCV7;P35908;CON__P35908;Q01546;CON__O95678;O95678;CON__Q5XKE5;Q5XKE5;CON__Q8VED5;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P05787;P05787;CON__P13647;P13647;CON__P08729;CON__Q3KNV1;P08729	P35908	Kb36;Krt73;KRT1B;KRT77;KRT1B;KRT77;Krt1b;Krt77;K6IRS3;KB36;KRT6IRS3;KRT73;K6IRS3;KB36;KRT6IRS3;KRT73;K6irs1;Kb34;Krt2-6g;Krt6g;Krt71;KRT2B;KRT2P;KRT76;KRT3;KRT3;KRT84;KRTHB4;KRT84;KRTHB4;KRT84;KRTHB4;K6IRS4;KB37;KRT5C;KRT6IRS4;KRT74;K6IRS4;KB37;KRT5C;KRT6IRS4;KRT74;Krt2-4;Krt4;K6IRS1;KB34;KRT6IRS1;KRT71;K6IRS1;KB34;KRT6IRS1;KRT71;Kb35;Krt72;K6IRS2;KB35;KRT6;KRT6IRS2;KRT72;K6IRS2;KB35;KRT6;KRT6IRS2;KRT72;Krt2-7;Krt7;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;KRT2B;KRT2P;KRT76;K6HF;KB18;KRT75;K6HF;KB18;KRT75;K6L;KB38;KRT6L;KRT79;K6L;KB38;KRT6L;KRT79;Kb38;Krt79;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;CYK8;KRT8;CYK8;KRT8;KRT5;KRT5;KRT7;SCL;KRT7;KRT7;SCL	Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-1B;Keratin, type II cytoskeletal 1b;Keratin-77;Type-II keratin Kb39;Embryonic type II keratin-1;Cytokeratin-6G;Cytokeratin-71;Keratin, type II cytoskeletal 71;Keratin-6G;Keratin-71;Type II inner root sheath-specific keratin-K6irs1;Type-II keratin Kb34;Cytokeratin-2P;Keratin, type II cytoskeletal 2 oral;Keratin-76;Type-II keratin Kb9;65 kDa cytokeratin;Cytokeratin-3;Keratin, type II cytoskeletal 3;Keratin-3;Type-II keratin Kb3;Keratin, type II cuticular Hb4;Keratin-84;Type II hair keratin Hb4;Type-II keratin Kb24;Cytokeratin-74;Keratin, type II cytoskeletal 74;Keratin-5c;Keratin-74;Type II inner root sheath-specific keratin-K6irs4;Type-II keratin Kb37;Cytokeratin-4;Cytoskeletal 57 kDa keratin;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4;Cytokeratin-72;Keratin, type II cytoskeletal 72;Keratin-72;Type II inner root sheath-specific keratin-K6irs2;Type-II keratin Kb35;Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Type-II keratin Kb7;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-75;Keratin, type II cytoskeletal 75;Keratin-6 hair follicle;Keratin-75;Type II keratin-K6hf;Type-II keratin Kb18;Cytokeratin-79;Keratin, type II cytoskeletal 79;Keratin-6-like;Keratin-79;Type-II keratin Kb38;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;Cytokeratin-8;Keratin, type II cytoskeletal 8;Keratin-8;Type-II keratin Kb8;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5;Sarcolectin;KRT7 protein;Putative uncharacterized protein	no	no	2	8.446E-12	128.36	1	0	22	NaN	NaN				1	1	1	1	1	1			1	1			1	2	1	1			1	1			1	1			1	1	1			1	1																																				1550700	0	0	77683	62401	73454	81850	58266	64254	0	0	46419	37149	0	0	52962	44486	112250	115030	0	0	56689	67687	0	0	0	42435	0	0	50527	46430	330130	0	0	68448	62149		+
117	117	117	1244;1245;1246;1247;1248;1249;1250;1251;1252;1253	639;640;641;642;643	641		FDSLTDLVEHYK	0	0	0	2	0	0	1	0	1	0	2	1	0	1	0	1	1	0	1	1	0	12	0	1465.7089	Q06124	Q06124	PTP2C;PTPN11;SHPTP2	Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11	yes	yes	3	0.0024346	112.36	1	0	10	1	0	10															1	1	1	1	1	1											1		1	1	1															1	1	1	1	1	1											1		1	1	1	1306700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	108380	75201	243550	164800	240040	207230	0	0	0	0	0	0	0	0	0	0	74918	0	21809	78302	92480		
118	52;64	118	1254;1255;1256;1257	644;645;646	645		FEELCSDLFR	0	1	0	1	1	0	2	0	0	0	2	0	0	2	0	1	0	0	0	0	0	10	0	1314.5914	P0DMV8;P0DMV9;P17066;P48741	P0DMV8	HSP70B;HSPA6;HSP70B;HSPA7	Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7	no	no	2	0.00063394	118.18	1	0	4	NaN	NaN		1	1	1	1																																																																			300870	78881	92083	65628	64280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
119	55	119	1258;1259;1260;1261;1262;1263;1264;1265;1266;1267;1268;1269;1270;1271;1272;1273;1274;1275;1276;1277;1278;1279;1280;1281;1282;1283;1284	647;648;649;650;651;652;653;654;655;656;657;658	647		FEELNADLFR	1	1	1	1	0	0	2	0	0	0	2	0	0	2	0	0	0	0	0	0	0	10	0	1252.6088	P11142;P54652	P11142	HSC70;HSP73;HSPA10;HSPA8;HSPA2	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	yes	no	2	3.2548E-18	215.06	1	0	27	1	0	27	2	1	2	1	1	1	1	2	1	1	1	1	1	1	1	1		1			1	1					1	1			1			1	1	2	1	2	1	1	1	1	2	1	1	1	1	1	1	1	1		1			1	1					1	1			1			1	1	6902700	952260	1018000	1206300	1214700	87266	132660	103660	331300	61562	61195	42622	54881	60456	53264	129010	110690	0	21300	0	0	495270	398660	0	0	0	0	121780	127220	0	0	36918	0	0	42017	39654		
120	54	120	1285;1286;1287;1288;1289;1290	659;660;661;662	659		FEELNMDLFR	0	1	1	1	0	0	2	0	0	0	2	0	1	2	0	0	0	0	0	0	0	10	0	1312.6122	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	5.6807E-05	128.81	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														757750	198970	211730	83398	84515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	103680	75451	0	0	0	0	0	0	0	0	0	0	0	0	0		
121	9	121	1291;1292;1293;1294;1295;1296;1297;1298;1299	663;664;665	665		FFVAPFPEVFGK	1	0	0	0	0	0	1	1	0	0	0	1	0	4	2	0	0	0	0	2	0	12	0	1383.7227	CON__P02662	CON__P02662			yes	yes	2	0.0060079	99.568	1	0	9	1	0	9	1	1	1	1																	1	1					1							1	1	1	1	1	1																	1	1					1							1	1	1568600	421340	504360	50023	44124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30242	39974	0	0	0	0	37873	0	0	0	0	0	0	213320	227380		+
122	84	122	1300;1301;1302;1303;1304;1305;1306;1307;1308;1309;1310;1311;1312;1313;1314;1315;1316;1317;1318;1319	666;667;668;669;670;671;672;673;674;675;676;677;678;679;680	678		FGLLLESYCR	0	1	0	0	1	0	1	1	0	0	3	0	0	1	0	1	0	0	1	0	0	10	0	1256.6223	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	2.3794E-05	133.57	1	0	20	1	0	20		1			1	1	1	1							1	1	1	2	1	1							1	1			1	1	1	1	2		1			1	1	1	1							1	1	1	2	1	1							1	1			1	1	1	1	2	12312000	0	48035	0	0	153290	169810	318490	287380	0	0	0	0	0	0	62085	44800	1572500	1570900	2311000	1718300	0	0	0	0	0	0	98008	120120	0	0	39806	550620	497660	1371500	1377500		
123	106	123	1320;1321;1322;1323;1324;1325;1326	681;682;683;684;685;686;687	683		FGNDVQHFK	0	0	1	1	0	1	0	1	1	0	0	1	0	2	0	0	0	0	0	1	0	9	0	1090.5196	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	4.0999E-06	145.72	1	0	7	1	0	7													1	1	1	1													1	1	1																	1	1	1	1													1	1	1					797340	0	0	0	0	0	0	0	0	0	0	0	0	93426	95862	151370	180240	0	0	0	0	0	0	0	0	0	0	0	0	76744	65613	134090	0	0	0	0		
124	95	124	1327;1328;1329;1330;1331;1332;1333;1334;1335;1336;1337	688;689;690;691;692;693	692		FILIQNR	0	1	1	0	0	1	0	0	0	2	1	0	0	1	0	0	0	0	0	0	0	7	0	902.53379	P53680	P53680	AP17;AP2S1;CLAPS2	Adapter-related protein complex 2 sigma subunit;Adaptor protein complex AP-2 subunit sigma;AP-2 complex subunit sigma;Clathrin assembly protein 2 small chain;Clathrin coat assembly protein AP17;Clathrin coat-associated protein AP17;HA2 17 kDa subunit;Plasma membrane adaptor AP-2 17 kDa protein;Sigma2-adaptin	yes	yes	2	0.016653	122.15	1	0	11	1	0	11	1	1	1	1									1	1	1	1					1			1							1					1	1	1	1									1	1	1	1					1			1							1					840800	121120	88809	63848	67888	0	0	0	0	0	0	0	0	84370	83082	113040	111140	0	0	0	0	53367	0	0	25387	0	0	0	0	0	0	28736	0	0	0	0		
125	111	125	1338	694	694		FLASVSTVLTSK	1	0	0	0	0	0	0	0	0	0	2	1	0	1	0	3	2	0	0	2	0	12	0	1251.7075	P69905	P69905	HBA1;HBA2	Alpha-globin;Hemoglobin alpha chain;Hemoglobin subunit alpha	yes	yes	2	7.9446E-05	66.595	1	0	1	1	0	1																																		1																																			1		0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
126	40;79;23	126	1339;1340;1341;1342;1343;1344;1345;1346;1347;1348;1349;1350;1351;1352;1353;1354;1355;1356;1357;1358;1359;1360;1361;1362;1363;1364;1365;1366;1367;1368;1369;1370;1371;1372;1373;1374	695;696;697;698;699;700;701;702;703;704;705;706;707;708;709;710;711;712;713;714;715;716;717;718;719;720;721;722;723;724;725;726	715		FLEQQNQVLQTK	0	0	1	0	0	4	1	0	0	0	2	1	0	1	0	0	1	0	0	1	0	12	0	1474.778	CON__Q6NXH9;CON__Q7Z794;Q7Z794;CON__Q6IFZ6;CON__Q9R0H5;P04264;CON__P04264;P35908;CON__P35908	P04264	Kb36;Krt73;KRT1B;KRT77;KRT1B;KRT77;Krt1b;Krt77;K6irs1;Kb34;Krt2-6g;Krt6g;Krt71;KRT1;KRTA;KRT1;KRTA;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-1B;Keratin, type II cytoskeletal 1b;Keratin-77;Type-II keratin Kb39;Embryonic type II keratin-1;Cytokeratin-6G;Cytokeratin-71;Keratin, type II cytoskeletal 71;Keratin-6G;Keratin-71;Type II inner root sheath-specific keratin-K6irs1;Type-II keratin Kb34;67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	no	no	2	2.0084E-47	262.54	1	0	36	NaN	NaN		1	1	1	1	1	1	1	1	1	1	1	1	2	1	1	2	1	1	1	1	1	1	1	1	1	1	1		1	1	1	1	1	1	1																																				34877000	246500	282210	1049000	992050	1246500	1257100	673610	630640	783650	718640	1691600	1617900	1543300	1541500	1003900	1011600	1617900	1839100	342720	366430	1616300	1537000	194080	198000	1193900	1266100	356580	0	575940	554950	3122500	348060	361080	1518300	1578100		+
127	26	127	1375;1376;1377;1378;1379;1380;1381;1382;1383;1384;1385;1386;1387;1388;1389;1390;1391;1392;1393;1394;1395;1396;1397;1398;1399;1400;1401;1402;1403;1404;1405;1406;1407;1408	727;728;729;730;731;732;733;734;735;736;737;738;739;740;741;742;743;744;745;746;747;748;749;750;751;752;753;754;755;756;757;758;759;760;761;762;763;764	744		FLLQHLGR	0	1	0	0	0	1	0	1	1	0	3	0	0	1	0	0	0	0	0	0	0	8	0	982.57123	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	8.6452E-25	138.9	1	0	34	1	0	34					1	1	1	1					1	1	1	1	3	4	4	6							1	1			1	1	1	3	1					1	1	1	1					1	1	1	1	3	4	4	6							1	1			1	1	1	3	1	80915000	0	0	0	0	426570	379180	535590	485630	0	0	0	0	48236	58485	83332	82554	10898000	11442000	14982000	14931000	0	0	0	0	0	0	118840	115900	0	0	0	4515300	4601500	8525000	8685500		
128	82	128	1409;1410;1411;1412;1413;1414	765;766;767	767		FLQESNVLYQHNLR	0	1	2	0	0	2	1	0	1	0	3	0	0	1	0	1	0	0	1	1	0	14	0	1759.9006	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	3	0.011814	93.959	1	0	6	1	0	6	1	1	1	1											1	1																				1	1	1	1											1	1																				1742600	442890	517690	327400	338970	0	0	0	0	0	0	0	0	0	0	64545	51098	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
129	122	129	1415;1416;1417;1418;1419;1420;1421;1422;1423	768;769;770;771;772;773	773		FLVFDHAPFSSIR	1	1	0	1	0	0	0	0	1	1	1	0	0	3	1	2	0	0	0	1	0	13	0	1534.7932	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2,3	0.0059588	110.66	1	0	9	1	0	9													1	2	2	2															2																	1	2	2	2															2					3428700	0	0	0	0	0	0	0	0	0	0	0	0	171530	237780	1362100	1371800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	285450	0	0	0	0		
130	106	130	1424;1425;1426;1427;1428;1429;1430;1431;1432;1433;1434;1435;1436;1437;1438;1439;1440;1441;1442;1443;1444;1445;1446;1447;1448;1449;1450;1451;1452;1453;1454;1455;1456;1457;1458;1459;1460;1461;1462;1463;1464;1465;1466;1467;1468;1469;1470;1471;1472;1473;1474	774;775;776;777;778;779;780;781;782;783;784;785;786;787;788;789;790;791;792;793;794;795;796;797;798;799;800;801;802;803;804;805;806	801		FNSLNELVDYHR	0	1	2	1	0	0	1	0	1	0	2	0	0	1	0	1	0	0	1	1	0	12	0	1505.7263	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2,3	1.5601E-18	214.82	1	0	51	1	0	51	3	2	2	2			1	1					3	5	4	6	2	1	1	2	1	2							2	3	3	1	2	1	1	3	2	2	2			1	1					3	5	4	6	2	1	1	2	1	2							2	3	3	1	2	1	1	87873000	1183700	1176400	1036900	1083100	0	0	47284	61809	0	0	0	0	10981000	12273000	18748000	19726000	413690	334290	409630	375150	401970	419530	0	0	0	0	0	0	4491000	4814200	8817300	174060	216600	375060	314570		
131	2	131	1475;1476;1477;1478;1479;1480;1481;1482;1483;1484;1485	807	807		FPAHLSTHWVADAAASVR	5	1	0	1	0	0	0	0	2	0	1	0	0	1	1	2	1	1	0	2	0	18	0	1934.9751	A6NK06	A6NK06	IRG1	Immune-responsive gene 1 protein homolog	yes	yes	2	0.074191	62.378	1	0	11	1	0	11			1	1			1		1	1						1		1	1	1							1	1										1	1			1		1	1						1		1	1	1							1	1								1623300	0	0	196830	216370	0	0	161320	0	154000	144760	0	0	0	0	0	281250	0	46133	123160	91215	0	0	0	0	0	0	105160	103080	0	0	0	0	0	0	0		
132	153	132	1486;1487;1488;1489;1490;1491;1492;1493;1494	808;809	809		FPSNIIVTNGAAR	2	1	2	0	0	0	0	1	0	2	0	0	0	1	1	1	1	0	0	1	0	13	0	1358.7306	Q86WR7	Q86WR7	C10orf47	Uncharacterized protein C10orf47	yes	yes	2	0.064837	74.392	1	0	9	1	0	9			1	1		1	1	1					1	2					1																			1	1		1	1	1					1	2					1																	1426800	0	0	308710	289740	0	63361	110270	101100	0	0	0	0	108370	208030	0	0	0	0	237220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
133	10	133	1495	810	810		FQNALLVR	1	1	1	0	0	1	0	0	0	0	2	0	0	1	0	0	0	0	0	1	0	8	0	959.55525	CON__P02768-1;P02768	CON__P02768-1	ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341;ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341	Serum albumin	yes	no	2	2.4769E-06	96.492	1	0	1	1	0	1												1																																			1																								0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
134	38	134	1496;1497;1498;1499;1500;1501;1502;1503;1504;1505;1506;1507;1508	811;812;813;814;815;816;817;818;819;820;821	820		FRELIIEFSK	0	1	0	0	0	0	2	0	0	2	1	1	0	2	0	1	0	0	0	0	0	10	1	1280.7129	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	8.7335E-06	151.15	1	0	13	1	0	13	1	1	1	1									1	1	1	1					1	1							1	1	1					1	1	1	1									1	1	1	1					1	1							1	1	1					9789700	2156100	2039100	1319900	1170200	0	0	0	0	0	0	0	0	280780	316140	519510	499920	0	0	0	0	650530	664210	0	0	0	0	0	0	37731	48143	87417	0	0	0	0		
135	83	135	1509	822	822		FSLENNFLLQHNIR	0	1	3	0	0	1	1	0	1	1	3	0	0	2	0	1	0	0	0	0	0	14	0	1743.9057	P42224	P42224	STAT1	Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84	yes	yes	3	0.01034	54.7	1	0	1	1	0	1		1																																			1																																		59382	0	59382	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
136	112	136	1510	823	823		FSMKMKMIDSAR	1	1	0	1	0	0	0	0	0	1	0	2	3	1	0	2	0	0	0	0	0	12	2	1443.7036	P78527	P78527	HYRC;HYRC1;PRKDC	DNA-dependent protein kinase catalytic subunit;DNPK1;p460	yes	yes	2	0.1246	14.258	1	0	1	1	0	1									1																																			1																											27276	0	0	0	0	0	0	0	0	27276	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
137	38	137	1511;1512;1513;1514;1515;1516;1517;1518;1519;1520;1521;1522;1523;1524;1525;1526;1527;1528;1529;1530;1531;1532;1533;1534;1535;1536;1537;1538;1539;1540;1541;1542;1543;1544;1545;1546;1547;1548;1549;1550;1551;1552;1553;1554;1555;1556;1557;1558;1559	824;825;826;827;828;829;830;831;832;833;834;835;836;837;838;839;840;841;842;843;844;845;846;847;848;849;850;851	831		FSNNPALCNVESIQWR	1	1	3	0	1	1	1	0	0	1	1	0	0	1	1	2	0	1	0	1	0	16	0	1933.9105	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	1.5647E-20	210.34	1	0	49	1	0	49	5	2	4	3			2	2					3	2	2	3	2	2	2	2	2	4					2	2			3					5	2	4	3			2	2					3	2	2	3	2	2	2	2	2	4					2	2			3					250220000	60221000	62961000	16469000	17156000	0	0	154050	219250	0	0	0	0	1089500	1118200	18590000	18174000	392230	371430	1152700	1004900	25334000	21318000	0	0	0	0	132710	135770	0	0	4231000	0	0	0	0		
138	40	138	1560;1561;1562;1563;1564;1565;1566;1567;1568;1569;1570	852;853	853		FSSCGGGGGSFGAGGGFGSR	1	1	0	0	1	0	0	10	0	0	0	0	0	3	0	4	0	0	0	0	0	20	0	1764.7274	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	1.2085E-09	147.64	1	0	11	1	0	11				1					1	1					1	1	1	1			1	1									1			1					1					1	1					1	1	1	1			1	1									1			1		697460	0	0	0	50232	0	0	0	0	50041	45703	0	0	0	0	55357	44562	51254	60456	0	0	92597	86252	0	0	0	0	0	0	0	0	133490	0	0	27512	0		+
139	19	139	1571;1572;1573;1574;1575;1576;1577;1578;1579	854;855;856	856		FSSSSGYGGGSSR	0	1	0	0	0	0	0	4	0	0	0	0	0	1	0	6	0	0	1	0	0	13	0	1234.5214	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	2	1.7295E-13	129.34	1	0	9	1	0	9												1		1			1	1				1			1						1			1	1												1		1			1	1				1			1						1			1	1	369890	0	0	0	0	0	0	0	0	0	0	0	0	0	50230	0	0	33246	33640	0	0	0	40580	0	0	32439	0	0	0	0	0	96014	0	0	48767	34971		+
140	128	140	1580;1581;1582;1583;1584;1585;1586;1587;1588	857;858;859	859		FTDLLQLVEFHQLNR	0	1	1	1	0	2	1	0	1	0	4	0	0	2	0	0	1	0	0	1	0	15	0	1871.9894	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	3	0.0068219	129.37	1	0	9	1	0	9	1	1					1	1							1	1		1	1	1																1	1					1	1							1	1		1	1	1																1140200	38004	48171	0	0	0	0	106780	58040	0	0	0	0	0	0	35774	28739	0	24593	410900	389210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
141	112	141	1589;1590	860;861	860		FVPLLPGNR	0	1	1	0	0	0	0	1	0	0	2	0	0	1	2	0	0	0	0	1	0	9	0	1011.5866	P78527	P78527	HYRC;HYRC1;PRKDC	DNA-dependent protein kinase catalytic subunit;DNPK1;p460	yes	yes	2	0.036766	61.999	1	0	2	1	0	2	1			1																																1			1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
142	41	142	1591;1592;1593;1594;1595;1596;1597;1598;1599;1600	862;863;864	862		FVVIQNEDLGPASPLDSTFYR	1	1	1	2	0	1	1	1	0	1	2	0	0	2	2	2	1	0	1	2	0	21	0	2367.1747	P04626	P04626	ERBB2;HER2;MLN19;NEU;NGL	Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2	yes	yes	2,3	0.00026197	92.633	1	0	10	1	0	10	1	1													2	2			1		1										2					1	1													2	2			1		1										2					1369900	169920	206550	0	0	0	0	0	0	0	0	0	0	0	0	389840	402370	0	0	44081	0	70926	0	0	0	0	0	0	0	0	0	86225	0	0	0	0		
143	24	143	1601;1602;1603;1604;1605;1606;1607;1608	865;866;867;868	868		FYGPEGPYGVFAGR	1	1	0	0	0	0	1	4	0	0	0	0	0	2	2	0	0	0	2	1	0	14	0	1515.7147	O00264	O00264	HPR6.6;PGRMC;PGRMC1	Membrane-associated progesterone receptor component 1	yes	yes	2	1.2342E-07	177.1	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														1031000	187620	179530	163650	218180	0	0	0	0	0	0	0	0	0	0	40479	47453	0	0	0	0	101040	92996	0	0	0	0	0	0	0	0	0	0	0	0	0		
144	84	144	1609;1610;1611;1612;1613	869	869		GALQFNSHTLHQWLK	1	0	1	0	0	2	0	1	2	0	3	1	0	1	0	1	1	1	0	0	0	15	0	1778.9216	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	3	0.17311	62.088	1	0	5	1	0	5								1									1	1	1	1																							1									1	1	1	1																1660500	0	0	0	0	0	0	0	39951	0	0	0	0	0	0	0	0	402320	399700	455580	362930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
145	43;58	145	1614;1615;1616;1617;1618;1619;1620;1621;1622;1623;1624	870;871;872;873;874;875;876	876		GAWSNVLR	1	1	1	0	0	0	0	1	0	0	1	0	0	0	0	1	0	1	0	1	0	8	0	901.477	P05141;P12235;P12236	P05141	ANT2;SLC25A5;ANT1;SLC25A4;ANT3;CDABP0051;SLC25A6	Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6	no	no	2	1.9653E-06	111.04	1	0	11	NaN	NaN		1	1	1	1				1					1	1	1	1						1									1																																								1303200	240390	234390	252900	268090	0	0	0	44037	0	0	0	0	41080	63712	50422	0	0	0	0	0	0	87446	0	0	0	0	0	0	0	0	20722	0	0	0	0		
146	26	146	1625;1626;1627;1628;1629;1630;1631;1632;1633;1634;1635;1636;1637	877;878;879;880;881;882;883;884;885;886;887;888;889;890;891	888		GDFPGTYVEFLGPVALAR	2	1	0	1	0	0	1	3	0	0	2	0	0	2	2	0	1	0	1	2	0	18	0	1907.9781	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	1.2752E-46	250.31	1	0	13	1	0	13															1		3	2	4	3																														1		3	2	4	3																12898000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31819	0	470810	392050	6288800	5714300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
147	38	147	1638;1639;1640;1641;1642;1643;1644;1645;1646;1647;1648;1649;1650;1651;1652;1653;1654;1655;1656;1657;1658;1659;1660;1661;1662;1663;1664;1665;1666;1667;1668;1669;1670;1671;1672;1673;1674;1675;1676;1677;1678;1679	892;893;894;895;896;897;898;899;900;901;902;903;904;905;906;907;908;909;910;911;912;913;914;915;916	896		GDSFTHTPPLDPQELDILK	0	0	0	3	0	1	1	1	1	1	3	1	0	1	3	1	2	0	0	0	0	19	0	2122.0582	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	2.0661E-07	161.24	1	0	42	1	0	42	5	4	5	4			1	1					2	1	3	2	1	1	1	1	3	3					1	1			2					5	4	5	4			1	1					2	1	3	2	1	1	1	1	3	3					1	1			2					105010000	18724000	19342000	17151000	17400000	0	0	134560	175730	0	0	0	0	855290	892610	5332900	5081600	412020	405920	606620	466900	8972700	7652200	0	0	0	0	110560	100950	0	0	1195300	0	0	0	0		
148	84	148	1680;1681	917;918	917		GEIYDAAIDLFTR	2	1	0	2	0	0	1	1	0	2	1	0	0	1	0	0	1	0	1	0	0	13	0	1482.7355	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.0019116	140.31	1	0	2	1	0	2																			1	1																																		1	1																288180	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	176590	111580	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
149	88	149	1682;1683;1684	919;920	920		GFITIVDVQR	0	1	0	1	0	1	0	1	0	2	0	0	0	1	0	0	1	0	0	2	0	10	0	1146.6397	P43304	P43304	GPD2	Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD	yes	yes	2	0.0066822	98.249	1	0	3	1	0	3		1	1	1																																	1	1	1																																205360	0	61146	56896	87315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
150	66	150	1685;1686;1687;1688;1689;1690	921;922;923	921		GFSLLIMK	0	0	0	0	0	0	0	1	0	1	2	1	1	1	0	1	0	0	0	0	0	8	0	907.52011	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	0.054138	91.065	1	0	6	1	0	6					1	1	1	1																			1	1												1	1	1	1																			1	1								472000	0	0	0	0	92547	95474	70826	106570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45617	60968	0	0	0	0	0	0	0		
151	79	151	1691;1692;1693;1694;1695;1696;1697;1698;1699;1700;1701;1702;1703;1704;1705;1706	924;925;926;927;928;929;930;931;932;933;934	928		GFSSGSAVVSGGSR	1	1	0	0	0	0	0	4	0	0	0	0	0	1	0	5	0	0	0	2	0	14	0	1253.6	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	no	no	2	0.00012804	159.64	1	0	16	NaN	NaN				1	1	1	1			1					1	1		1	1			1	1			1	1					1			1	1																																				850910	0	0	61519	49935	63993	50658	0	0	26499	0	0	0	0	46813	23413	0	59523	62707	0	0	58595	55578	0	0	58337	48801	0	0	0	0	118450	0	0	30320	35769		+
152	79	152	1707;1708;1709;1710;1711;1712	935	935		GGGFGGGSSFGGGSGFSGGGFGGGGFGGGR	0	1	0	0	0	0	0	20	0	0	0	0	0	5	0	4	0	0	0	0	0	30	0	2398.0111	P35908	P35908	KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	yes	2	0.0034089	73.341	1	0	6	1	0	6																1			1	1	1	1									1																				1			1	1	1	1									1					518280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30008	0	0	48797	42266	48170	65156	0	0	0	0	0	0	0	0	283880	0	0	0	0		+
153	19	153	1713;1714;1715;1716;1717;1718	936;937	937		GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR	1	1	0	0	0	0	0	17	0	0	1	0	0	3	0	7	0	0	2	0	0	32	0	2704.1538	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	1.7444E-18	123.44	1	0	6	1	0	6										1					1				1	1		1									1														1					1				1	1		1									1					2161600	0	0	0	0	0	0	0	0	0	63822	0	0	0	0	127040	0	0	0	125060	84423	0	268010	0	0	0	0	0	0	0	0	1493300	0	0	0	0		+
154	156	154	1719	938	938	10;11;12	GGMPGKLIKINIMNMNK	0	0	3	0	0	0	0	3	0	3	1	3	3	0	1	0	0	0	0	0	0	17	2	1857.9991	Q8NDL9	Q8NDL9	AGBL5;CCP5	ATP/GTP-binding protein-like 5;Cytosolic carboxypeptidase-like protein 5	yes	yes	3	0.036336	10.593	1	0	1	1	0	1	1																																			1																																			47744	47744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
155	46;125	155	1720;1721;1722;1723;1724;1725;1726;1727;1728	939;940	939		GHYTEGAELVDSVLDVVR	1	1	0	2	0	0	2	2	1	0	2	0	0	0	0	1	1	0	1	4	0	18	0	1957.9745	P07437;P68371;Q13885;Q9BVA1;Q13509	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB2;TUBB2A;TUBB2B;TUBB3;TUBB4	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-4 chain;Tubulin beta-III	no	no	3	0.00010647	140.1	1	0	9	NaN	NaN		1	1													1	1			1	1	1	1									1																																								3866200	1451800	1296200	0	0	0	0	0	0	0	0	0	0	0	0	230300	224740	0	0	89458	79819	255050	214570	0	0	0	0	0	0	0	0	24225	0	0	0	0		
156	67	156	1729;1730	941	941		GIFPSGLFQGDTFR	0	1	0	1	0	1	0	3	0	1	1	0	0	3	1	1	1	0	0	0	0	14	0	1540.7674	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	2	0.036468	83.204	1	0	2	1	0	2															1				1																															1				1																	135420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44567	0	0	0	90855	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
157	128	157	1731;1732;1733;1734;1735;1736;1737;1738;1739;1740;1741;1742;1743	942;943;944;945;946;947;948;949	944		GILPCLLR	0	1	0	0	1	0	0	1	0	1	3	0	0	0	1	0	0	0	0	0	0	8	0	940.55281	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	2	0.032817	97.068	1	0	13	1	0	13					1	1	1	1									1	1	1	1								1				1	1	1	1					1	1	1	1									1	1	1	1								1				1	1	1	1	1742500	0	0	0	0	190480	168960	285900	293120	0	0	0	0	0	0	0	0	78446	75128	105560	84739	0	0	0	0	0	0	0	51260	0	0	0	65150	68440	153390	121880		
158	114	158	1744;1745;1746;1747;1748;1749;1750;1751	950;951;952	952		GIYTGLSAGLLR	1	1	0	0	0	0	0	3	0	1	3	0	0	0	0	1	1	0	1	0	0	12	0	1219.6925	Q02978	Q02978	SLC20A4;SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11	yes	yes	2	0.017102	89.266	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														473660	65165	58458	74201	95838	0	0	0	0	0	0	0	0	0	0	30503	24890	0	0	0	0	52493	72115	0	0	0	0	0	0	0	0	0	0	0	0	0		
159	35	159	1752;1753;1754;1755;1756;1757;1758;1759;1760;1761;1762;1763	953;954;955;956;957;958;959;960;961;962	959		GLAVFISDIR	1	1	0	1	0	0	0	1	0	2	1	0	0	1	0	1	0	0	0	1	0	10	0	1089.6182	O95782;O94973	O95782	ADTAA;AP2A1;CLAPA1;ADTAB;AP2A2;CLAPA2;HIP9;HYPJ;KIAA0899	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit;100 kDa coated vesicle protein C;Adapter-related protein complex 2 alpha-2 subunit;Adaptor protein complex AP-2 subunit alpha-2;Alpha2-adaptin;Alpha-adaptin C;AP-2 complex subunit alpha-2;Clathrin assembly protein complex 2 alpha-C large chain;Huntingtin yeast partner J;Huntingtin-interacting protein 9;Huntingtin-interacting protein J;Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit	yes	no	2	1.627E-05	141.88	1	0	12	1	0	12	1	1	1	1									1	1	1	1					2	1									1					1	1	1	1									1	1	1	1					2	1									1					1391300	128330	150610	121400	128430	0	0	0	0	0	0	0	0	91314	99245	215560	194540	0	0	0	0	134330	57043	0	0	0	0	0	0	0	0	70526	0	0	0	0		
160	118	160	1764;1765;1766;1767;1768	963	963		GLFIIDDK	0	0	0	2	0	0	0	1	0	2	1	1	0	1	0	0	0	0	0	0	0	8	0	919.50148	Q06830;Q13162	Q06830	PAGA;PAGB;PRDX1;TDPX2;PRDX4	Natural killer cell-enhancing factor A;Peroxiredoxin-1;Proliferation-associated gene protein;Thioredoxin peroxidase 2;Thioredoxin-dependent peroxide reductase 2;Antioxidant enzyme AOE372;Peroxiredoxin IV;Peroxiredoxin-4;Thioredoxin peroxidase AO372;Thioredoxin-dependent peroxide reductase A0372	yes	no	2	0.036407	94.262	1	0	5	1	0	5	1		1	1										1		1																				1		1	1										1		1																				182100	43879	0	30053	51807	0	0	0	0	0	0	0	0	0	21696	0	34664	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
161	89	161	1769;1770;1771;1772	964;965;966	965		GLFPFTHVK	0	0	0	0	0	0	0	1	1	0	1	1	0	2	1	0	1	0	0	1	0	9	0	1044.5757	P46109	P46109	CRKL	Crk-like protein	yes	yes	2	0.041461	84.568	1	0	4	1	0	4																	1	1	1	1																																1	1	1	1																160320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64893	49298	46130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
162	45	162	1773;1774;1775;1776;1777;1778;1779;1780;1781;1782;1783;1784;1785;1786;1787;1788;1789;1790	967;968;969;970;971;972;973;974;975;976	971		GLGTDEDSLIEIICSR	0	1	0	2	1	0	2	2	0	3	2	0	0	0	0	2	1	0	0	0	0	16	0	1776.8564	P07355;A6NMY6	P07355	ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B	Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein	yes	no	2,3	5.8684E-21	214.23	1	0	18	1	0	18	2	2		1											2	2			2	1	2	2									2					2	2		1											2	2			2	1	2	2									2					2931300	649780	600810	0	29499	0	0	0	0	0	0	0	0	0	0	466380	455220	0	0	67117	34722	265670	249280	0	0	0	0	0	0	0	0	112840	0	0	0	0		
163	180	163	1791;1792;1793;1794;1795	977;978	977		GLGWVQFSSEEGLR	0	1	0	0	0	1	2	3	0	0	2	0	0	1	0	2	0	1	0	1	0	14	0	1563.7682	Q9GZT3	Q9GZT3	C14orf156;DC23;DC50;PD04872;SLIRP	SRA stem-loop-interacting RNA-binding protein, mitochondrial	yes	yes	2	0.010273	102.87	1	0	5	1	0	5	1	1													1						1	1														1	1													1						1	1														710500	264500	242020	0	0	0	0	0	0	0	0	0	0	0	0	28286	0	0	0	0	0	95929	79765	0	0	0	0	0	0	0	0	0	0	0	0	0		
164	82	164	1796;1797;1798;1799	979;980	980		GLSIEQLTTLAEK	1	0	0	0	0	1	2	1	0	1	3	1	0	0	0	1	2	0	0	0	0	13	0	1401.7715	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	2	4.9662E-05	162.32	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																939800	255520	253790	197750	232740	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
165	38	165	1800;1801;1802;1803;1804;1805;1806;1807;1808;1809;1810;1811;1812;1813;1814;1815;1816;1817;1818	981;982;983;984;985;986;987;988;989	984		GLWIPEGEK	0	0	0	0	0	0	2	2	0	1	1	1	0	0	1	0	0	1	0	0	0	9	0	1027.5338	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.03704	86.011	1	0	19	1	0	19	1	1	1	1									1	1	1	1			1	1	1	1	1	1					2	1	2					1	1	1	1									1	1	1	1			1	1	1	1	1	1					2	1	2					11407000	1846100	1864300	1754400	1905800	0	0	0	0	0	0	0	0	374510	455090	421720	370100	0	0	44051	55446	840280	839200	85209	85968	0	0	0	0	188300	100050	176370	0	0	0	0		
166	38	166	1819;1820	990;991	990		GMNYLEDR	0	1	1	1	0	0	1	1	0	0	1	0	1	0	0	0	0	0	1	0	0	8	0	996.43348	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.028777	101.28	1	0	2	1	0	2	1	1																																		1	1																																		91584	52663	38921	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
167	21	167	1821	992	992		GNVLECLQDGER	0	1	1	1	1	1	2	2	0	0	2	0	0	0	0	0	0	0	0	1	0	12	0	1388.6354	CON__Q3SZ57	CON__Q3SZ57			yes	yes	2	0.072497	44.616	1	0	1	1	0	1				1																																			1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
168	55	168	1822;1823;1824;1825;1826;1827;1828;1829;1830	993;994	993		GPAVGIDLGTTYSCVGVFQHGK	1	0	0	1	1	1	0	5	1	1	1	1	0	1	1	1	2	0	1	3	0	22	0	2262.1103	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	3	0.00010782	93.768	1	0	9	1	0	9	1	1							1						1	1				1	1	1									1					1	1							1						1	1				1	1	1									1					1211200	324770	310160	0	0	0	0	0	0	33514	0	0	0	0	0	50641	38132	0	0	0	33043	149660	248010	0	0	0	0	0	0	0	0	23297	0	0	0	0		
169	38	169	1831;1832	995	995		GPDNCIQCAHYIDGPHCVK	1	0	1	2	3	1	0	2	2	2	0	1	0	0	2	0	0	0	1	1	0	19	0	2239.9561	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.00022801	105.14	1	0	2	1	0	2	1	1																																		1	1																																		281680	136990	144690	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
170	100	170	1833;1834;1835	996	996		GPLQSVQVFGR	0	1	0	0	0	2	0	2	0	0	1	0	0	1	1	1	0	0	0	2	0	11	0	1186.6459	P62249	P62249	RPS16	40S ribosomal protein S16	yes	yes	2	0.085818	69.721	1	0	3	1	0	3	1	1		1																																1	1		1																																122130	34698	41596	0	45838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
171	38	171	1836;1837;1838;1839;1840;1841;1842;1843;1844;1845;1846	997;998;999;1000;1001;1002;1003;1004	1000		GSHQISLDNPDYQQDFFPK	0	0	1	3	0	3	0	1	1	1	1	1	0	2	2	2	0	0	1	0	0	19	0	2235.0233	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.0001276	126.77	1	0	11	1	0	11	1	1	1	1									1	1	1	1					1	1									1					1	1	1	1									1	1	1	1					1	1									1					8528100	1602900	1423400	1467200	1597100	0	0	0	0	0	0	0	0	103730	122660	252030	324940	0	0	0	0	833540	681250	0	0	0	0	0	0	0	0	119390	0	0	0	0		
172	16	172	1847;1848;1849;1850;1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861;1862;1863;1864;1865;1866;1867;1868;1869;1870	1005;1006;1007;1008;1009;1010;1011;1012;1013;1014;1015;1016;1017;1018;1019;1020;1021;1022;1023;1024;1025;1026	1011		GSLGGGFSSGGFSGGSFSR	0	1	0	0	0	0	0	8	0	0	1	0	0	3	0	6	0	0	0	0	0	19	0	1706.7649	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	3.1971E-24	199.15	1	0	24	1	0	24	1	1	1	1	1		1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1			1			1	1	1	1	1	1	1		1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1			1			1	1	11018000	154110	153890	827520	800000	48778	0	343960	306150	459660	421180	0	0	142900	177240	468490	522470	820980	851490	231160	243840	816760	745250	0	0	0	0	193510	168310	0	0	1775200	0	0	174570	171110		+
173	16	173	1871;1872;1873;1874;1875;1876;1877;1878;1879	1027;1028	1028		GSSGGGCFGGSSGGYGGLGGFGGGSFR	0	1	0	0	1	0	0	15	0	0	1	0	0	3	0	5	0	0	1	0	0	27	0	2341.9771	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	7.6568E-14	113.24	1	0	9	1	0	9										1					1	1	1	1	1	1	1										1														1					1	1	1	1	1	1	1										1					1756200	0	0	0	0	0	0	0	0	0	158580	0	0	0	0	237950	239580	46588	60835	100360	80625	159610	0	0	0	0	0	0	0	0	0	672060	0	0	0	0		+
174	38	174	1880;1881;1882;1883;1884;1885;1886;1887;1888;1889;1890;1891	1029;1030;1031;1032;1033;1034;1035;1036;1037;1038;1039	1030		GSTAENAEYLR	2	1	1	0	0	0	2	1	0	0	1	0	0	0	0	1	1	0	1	0	0	11	0	1209.5626	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	3.3473E-07	169.65	1	0	12	1	0	12	1	1	1	1									1	1	1	1					1	1	1	1												1	1	1	1									1	1	1	1					1	1	1	1												5611800	976540	1072200	728650	814840	0	0	0	0	0	0	0	0	79199	85851	157550	108920	0	0	0	0	386710	373510	438300	389540	0	0	0	0	0	0	0	0	0	0	0		
175	60	175	1892;1893;1894;1895;1896;1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914;1915;1916;1917;1918	1040	1040		GTPMGMPPPGMRPPPPGMR	0	2	0	0	0	0	0	4	0	0	0	0	4	0	8	0	1	0	0	0	0	19	1	1959.9304	P14678	P14678	COD;SNRPB;SNRPB1	Sm protein B/B;Small nuclear ribonucleoprotein-associated proteins B and B	yes	yes	2	0.049745	4.4385	1	0	27	1	0	27	1	1	1	1			1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1	1	1	1	1	1	1			1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1	1	1	4779200	113130	97169	453180	511610	0	0	119310	125370	138560	152630	0	0	142720	184770	378670	351400	69283	96751	197810	189360	98118	120310	0	0	0	0	159810	154950	35534	36383	109940	332490	305070	55890	49002		
176	161	176	1919	1041	1041		GVASLCQLDN	1	0	1	1	1	1	0	1	0	0	2	0	0	0	0	1	0	0	0	1	0	10	0	1075.4968	Q8TD57	Q8TD57	DNAH3;DNAHC3B	Axonemal beta dynein heavy chain 3;Ciliary dynein heavy chain 3;Dnahc3-b;Dynein heavy chain 3, axonemal	yes	yes	2	0.044506	55.567	1	0	1	1	0	1																					1																																			1															0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
177	45	177	1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930;1931;1932;1933;1934;1935;1936;1937;1938;1939	1042;1043;1044;1045;1046;1047;1048;1049;1050;1051;1052;1053;1054	1047		GVDEVTIVNILTNR	0	1	2	1	0	0	1	1	0	2	1	0	0	0	0	0	2	0	0	3	0	14	0	1541.8413	P07355	P07355	ANX2;ANX2L4;ANXA2;CAL1H;LPC2D	Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I	yes	yes	2,3	8.3559E-08	178.58	1	0	20	1	0	20	2	2	1	1											2	2	1	1	1	1	2	2									2					2	2	1	1											2	2	1	1	1	1	2	2									2					3568400	626290	675560	102790	81176	0	0	0	0	0	0	0	0	0	0	589010	589620	58291	38826	70800	54029	272100	250900	0	0	0	0	0	0	0	0	158970	0	0	0	0		
178	87	178	1940;1941;1942;1943;1944	1055	1055		GVSTFMAEMLETASILR	2	1	0	0	0	0	2	1	0	1	2	0	2	1	0	2	2	0	0	1	0	17	0	1854.922	P43246	P43246	MSH2	DNA mismatch repair protein Msh2;MutS protein homolog 2	yes	yes	2	0.17899	22.475	1	0	5	1	0	5													1	1			1					1							1																			1	1			1					1							1							174860	0	0	0	0	0	0	0	0	0	0	0	0	37352	51915	0	0	21050	0	0	0	0	32786	0	0	0	0	0	0	31761	0	0	0	0	0	0		
179	47;48	179	1945;1946;1947;1948;1949;1950;1951;1952;1953	1056;1057;1058	1056		GVVDSEDLPLNISR	0	1	1	2	0	0	1	1	0	1	2	0	0	0	1	2	0	0	0	2	0	14	0	1512.7784	P07900;Q58FF7;P08238	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AB3P;HSP90BC;HSP90AB1;HSP90B;HSPC2;HSPCB	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-beta c;Putative heat shock protein HSP 90-beta-3;Heat shock 84 kDa;Heat shock protein HSP 90-beta	no	no	2	0.006134	132.79	1	0	9	NaN	NaN		1	1	1	1			1	1													1	1						1																																											1557800	193030	196010	231000	245640	0	0	142060	140850	0	0	0	0	0	0	0	0	0	0	0	0	139470	125290	0	0	0	0	0	144490	0	0	0	0	0	0	0		
180	66	180	1954;1955;1956;1957;1958;1959;1960;1961;1962;1963;1964;1965;1966;1967;1968;1969;1970;1971;1972	1059	1059		GVWIPEGESIK	0	0	0	0	0	0	2	2	0	2	0	1	0	0	1	1	0	1	0	1	0	11	0	1213.6343	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	0.14846	60.518	1	0	19	1	0	19	1	1	1	1	1	1	1	1					1	1	1		1	1	1	1	1						1	1							1	1	1	1	1	1	1	1	1					1	1	1		1	1	1	1	1						1	1							1	2586300	277190	340040	181610	169190	213850	210250	192340	219050	0	0	0	0	57948	40637	53534	0	45770	47832	91722	60447	102730	0	0	0	0	0	127260	116870	0	0	0	0	0	0	38033		
181	122	181	1973;1974;1975;1976	1060;1061;1062	1060		GWFPVQQVEFISNPEVR	0	1	1	0	0	2	2	1	0	1	0	0	0	2	2	1	0	1	0	3	0	17	0	2031.0214	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2,3	9.417E-05	143.25	1	0	4	1	0	4															2	1															1																			2	1															1					2712500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1906900	653630	0	0	0	0	0	0	0	0	0	0	0	0	0	0	151970	0	0	0	0		
182	106	182	1977;1978;1979;1980;1981;1982;1983;1984;1985;1986;1987;1988;1989;1990;1991;1992;1993	1063;1064;1065;1066;1067;1068;1069;1070;1071	1071		HDGAFLIR	1	1	0	1	0	0	0	1	1	1	1	0	0	1	0	0	0	0	0	0	0	8	0	927.49265	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	0.00011699	144.38	1	0	17	1	0	17	1	1	1	1									1	1		1	1	1	1	1		1	1						1	1	1		1			1	1	1	1									1	1		1	1	1	1	1		1	1						1	1	1		1			9491200	187490	136580	200170	195450	0	0	0	0	0	0	0	0	1550700	1650500	0	2270400	49470	110690	56425	68218	0	56957	31536	0	0	0	0	0	968860	975030	954360	0	28401	0	0		
183	187	183	1994	1072	1072		HELAEIVFK	1	0	0	0	0	0	2	0	1	1	1	1	0	1	0	0	0	0	0	1	0	9	0	1084.5917	Q9Y2R5	Q9Y2R5	HSPC011;MRPS17;RPMS17	28S ribosomal protein S17, mitochondrial	yes	yes	2	0.0022012	87.639	1	0	1	1	0	1								1																																			1																												0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
184	26	184	1995;1996;1997;1998	1073;1074;1075	1074		HESLAQYNAK	2	0	1	0	0	1	1	0	1	0	1	1	0	0	0	1	0	0	1	0	0	10	0	1159.5622	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.0029383	107.21	1	0	4	1	0	4																	1	1	1	1																																1	1	1	1																241090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50526	73020	54665	62874	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
185	19	185	1999;2000;2001;2002;2003;2004;2005;2006;2007;2008;2009;2010;2011;2012;2013;2014;2015;2016;2017;2018;2019;2020;2021;2022;2023;2024	1076;1077;1078;1079;1080;1081;1082;1083;1084;1085;1086;1087;1088;1089;1090;1091;1092	1088		HGVQELEIELQSQLSK	0	0	0	0	0	3	3	1	1	1	3	1	0	0	0	2	0	0	0	1	0	16	0	1836.9581	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	2,3	6.4078E-05	157.86	1	0	26	1	0	26	1	1	1				1	1	1	1					1	1	2	2	2	1	2	2					1	1			2			1	1	1	1	1				1	1	1	1					1	1	2	2	2	1	2	2					1	1			2			1	1	5936400	119450	119070	25507	0	0	0	93601	90734	279240	231430	0	0	0	0	151620	159580	541290	519970	417510	271970	867910	785830	0	0	0	0	54611	43515	0	0	978680	0	0	92136	92782		+
186	19	186	2025;2026;2027;2028;2029;2030;2031	1093;1094	1093		HGVQELEIELQSQLSKK	0	0	0	0	0	3	3	1	1	1	3	2	0	0	0	2	0	0	0	1	0	17	1	1965.0531	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	0.0062092	89.624	1	0	7	1	0	7																	1	1	1	1	1	1									1																					1	1	1	1	1	1									1					672960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	162640	205250	93571	44479	67120	47347	0	0	0	0	0	0	0	0	52553	0	0	0	0		+
187	47	187	2032;2033;2034;2035;2036	1095;1096;1097	1096		HIYYITGETK	0	0	0	0	0	0	1	1	1	2	0	1	0	0	0	0	2	0	2	0	0	10	0	1223.6186	P07900;Q58FG0	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA5P;HSP90AE	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-alpha E;Putative heat shock protein HSP 90-alpha A5	yes	no	2	0.0018895	109.71	1	0	5	1	0	5	1	1	1	1																	1															1	1	1	1																	1															255760	65793	53655	46993	60919	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28402	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
188	35	188	2037	1098	1098		HLCELLAQQF	1	0	0	0	1	2	1	0	1	0	3	0	0	1	0	0	0	0	0	0	0	10	0	1257.6176	O95782	O95782	ADTAA;AP2A1;CLAPA1	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit	yes	yes	2	0.080884	57.598	1	0	1	1	0	1															1																																			1																					94973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	94973	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
189	48	189	2038;2039;2040;2041;2042;2043;2044;2045;2046;2047	1099;1100;1101;1102;1103	1101		HLEINPDHPIVETLR	0	1	1	1	0	0	2	0	2	2	2	0	0	0	2	0	1	0	0	1	0	15	0	1781.9424	P08238	P08238	HSP90AB1;HSP90B;HSPC2;HSPCB	Heat shock 84 kDa;Heat shock protein HSP 90-beta	yes	yes	3	0.0068299	129.34	1	0	10	1	0	10	1	1	1	1	1	1	1	1													1						1									1	1	1	1	1	1	1	1													1						1									1535100	297720	260230	250380	243450	66954	58344	92256	116050	0	0	0	0	0	0	0	0	0	0	0	0	93022	0	0	0	0	0	56671	0	0	0	0	0	0	0	0		
190	47	190	2048;2049;2050;2051;2052;2053;2054;2055;2056;2057;2058;2059	1104;1105	1105		HLEINPDHSIIETLR	0	1	1	1	0	0	2	0	2	3	2	0	0	0	1	1	1	0	0	0	0	15	0	1785.9373	P07900	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38	yes	yes	3	0.0089624	98.902	1	0	12	1	0	12	1	1	1	1	1	1	1	1													1	1					1	1								1	1	1	1	1	1	1	1													1	1					1	1								2661000	414180	438580	315730	332620	37283	76482	127790	154660	0	0	0	0	0	0	0	0	0	0	0	0	250470	202300	0	0	0	0	167550	143400	0	0	0	0	0	0	0		
191	71	191	2060;2061;2062;2063;2064;2065;2066;2067;2068;2069;2070;2071;2072;2073;2074;2075;2076;2077;2078;2079	1106;1107;1108;1109;1110;1111;1112	1107		HLLLVDPEGVVR	0	1	0	1	0	0	1	1	1	0	3	0	0	0	1	0	0	0	0	3	0	12	0	1345.7718	P29353;P98077	P29353	SHC;SHC1;SHCA;SCK;SHC2;SHCB	SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1;Protein Sck;SHC-transforming protein 2;SHC-transforming protein B;Src homology 2 domain-containing-transforming protein C2	yes	no	2	0.00015165	156.48	1	0	20	1	0	20	1	1	1	1			1	1					1	1	1	1	1	1	1	1	1	1							1	1	1			1		1	1	1	1			1	1					1	1	1	1	1	1	1	1	1	1							1	1	1			1		4599500	141580	133350	217220	192030	0	0	57033	64669	0	0	0	0	569730	647410	737440	681990	79419	104310	221270	128480	50598	65728	0	0	0	0	0	0	143130	145610	177320	0	0	41158	0		
192	78	192	2080;2081;2082;2083;2084;2085;2086;2087	1113;1114;1115	1115		HLVALYTR	1	1	0	0	0	0	0	0	1	0	2	0	0	0	0	0	1	0	1	1	0	8	0	971.55525	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	2	0.095461	83.614	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	2251600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	226020	267120	267960	293070	0	0	0	0	0	0	0	0	0	0	0	265180	249400	318500	364380		
193	47	193	2088;2089;2090;2091;2092;2093;2094	1116;1117	1116		HSQFIGYPITLFVEK	0	0	0	0	0	1	1	1	1	2	1	1	0	2	1	1	1	0	1	1	0	15	0	1777.9403	P07900;Q58FG0	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA5P;HSP90AE	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-alpha E;Putative heat shock protein HSP 90-alpha A5	yes	no	3	0.040473	77.644	1	0	7	1	0	7	1	1						1													1	1					1	1								1	1						1													1	1					1	1								725570	230490	211190	0	0	0	0	0	46472	0	0	0	0	0	0	0	0	0	0	0	0	121460	45392	0	0	0	0	46634	23927	0	0	0	0	0	0	0		
194	78	194	2095;2096;2097;2098;2099;2100;2101;2102	1118	1118		HSSASFENVWLRPGELGGAPK	2	1	1	0	0	0	2	3	1	0	2	1	0	1	2	3	0	1	0	1	0	21	1	2238.1182	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	3	0.031136	71.697	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	2190000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	341600	286100	442120	302540	0	0	0	0	0	0	0	0	0	0	0	98601	95105	313630	310270		
195	84	195	2103;2104;2105;2106;2107;2108;2109;2110;2111;2112;2113	1119;1120;1121;1122;1123;1124	1124		HYCVTIPEILPK	0	0	0	0	1	0	1	0	1	2	1	1	0	0	2	0	1	0	1	1	0	12	0	1468.7748	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.00021692	153.12	1	0	11	1	0	11					1	1	1										1	1	1	1												1	1	1	1					1	1	1										1	1	1	1												1	1	1	1	1982300	0	0	0	0	38178	41856	49705	0	0	0	0	0	0	0	0	0	308970	308950	323580	259940	0	0	0	0	0	0	0	0	0	0	0	102410	79977	241160	227530		
196	173	196	2114;2115;2116;2117	1125	1125		IACANVLSDLYAMGITECDNMLMLLSVSQSMSEEER	3	1	2	2	2	1	4	1	0	2	5	0	4	0	0	5	1	0	1	2	0	36	0	4079.8328	Q99611	Q99611	SEPHS2;SPS2	Selenide, water dikinase 2;Selenium donor protein 2;Selenophosphate synthase 2	yes	yes	4	0.087166	5.5855	1	0	4	1	0	4	1	1													1						1															1	1													1						1															1829200	709330	632210	0	0	0	0	0	0	0	0	0	0	0	0	259710	0	0	0	0	0	227930	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
197	26	197	2118;2119;2120	1126	1126		IAEIHESR	1	1	0	0	0	0	2	0	1	2	0	0	0	0	0	1	0	0	0	0	0	8	0	953.49304	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	4.2062E-07	150.84	1	0	3	1	0	3																			1	1												1																						1	1												1				311130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	135360	140840	0	0	0	0	0	0	0	0	0	0	0	34926	0	0	0		
198	40;79	198	2121;2122;2123;2124;2125;2126;2127;2128;2129;2130;2131;2132;2133;2134;2135;2136;2137;2138;2139;2140;2141;2142;2143;2144;2145;2146;2147;2148	1127;1128;1129;1130;1131;1132;1133;1134;1135;1136;1137;1138;1139;1140;1141;1142;1143;1144;1145;1146;1147	1127		IEISELNR	0	1	1	0	0	0	2	0	0	2	1	0	0	0	0	1	0	0	0	0	0	8	0	972.52401	P04264;CON__P04264;P35908;CON__P35908	P04264	KRT1;KRTA;KRT1;KRTA;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	no	no	2	2.5666E-124	143.12	1	0	28	NaN	NaN		1		1	1	1	1	1	1	1	1	1	1	1	1	1		1	1	1		1	1	1		1	1	1		1	1	1			1	1																																				3332400	0	0	103180	100080	172360	186320	39683	45892	100460	102530	166750	134820	102340	106490	107250	0	252860	227110	52980	0	200890	214290	32116	0	118480	93740	31406	0	66891	66658	207280	0	0	153250	146330		+
199	54	199	2149;2150;2151;2152;2153;2154;2155	1148;1149;1150;1151	1149		IEWLESHQDADIEDFK	1	0	0	3	0	1	3	0	1	2	1	1	0	1	0	1	0	1	0	0	0	16	0	1973.9007	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	3	0.0045923	109.15	1	0	7	1	0	7	1	1	1	1			1														1	1														1	1	1	1			1														1	1														1174200	319800	263760	95096	118420	0	0	26053	0	0	0	0	0	0	0	0	0	0	0	0	0	200810	150300	0	0	0	0	0	0	0	0	0	0	0	0	0		
200	57	200	2156;2157	1152	1152		IFDLIGLPPEDDWPR	0	1	0	3	0	0	1	1	0	2	2	0	0	1	3	0	0	1	0	0	0	15	0	1781.8988	P11802	P11802	CDK4	Cell division protein kinase 4;Cyclin-dependent kinase 4;PSK-J3	yes	yes	2	0.0089606	98.531	1	0	2	1	0	2	1	1																																		1	1																																		194020	91968	102050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
201	26	201	2158;2159;2160;2161;2162;2163;2164	1153;1154;1155;1156;1157	1154		IFEEQGQTQEK	0	0	0	0	0	3	3	1	0	1	0	1	0	1	0	0	1	0	0	0	0	11	0	1335.6307	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	3.7464E-07	168.22	1	0	7	1	0	7																	1	1	1	1													1	1	1																	1	1	1	1													1	1	1	867080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	149960	119450	197140	195000	0	0	0	0	0	0	0	0	0	0	0	0	35713	84449	85371		
202	122	202	2165;2166;2167;2168;2169;2170;2171;2172;2173;2174;2175;2176	1158;1159;1160;1161;1162	1162		IFPLISQSR	0	1	0	0	0	1	0	0	0	2	1	0	0	1	1	2	0	0	0	0	0	9	0	1059.6077	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	0.0023307	117.04	1	0	12	1	0	12	1	1	1										1	1	1	2													2	1	1					1	1	1										1	1	1	2													2	1	1					9079800	28307	21898	14443	0	0	0	0	0	0	0	0	0	1577500	1386600	2296600	2428800	0	0	0	0	0	0	0	0	0	0	0	0	465480	406370	453760	0	0	0	0		
203	89	203	2177;2178;2179	1163;1164	1164		IGDQEFDHLPALLEFYK	1	0	0	2	0	1	2	1	1	1	3	1	0	2	1	0	0	0	1	0	0	17	0	2034.0098	P46109	P46109	CRKL	Crk-like protein	yes	yes	3	0.0030897	86.214	1	0	3	1	0	3															1				1	1																														1				1	1																573620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29574	0	0	0	306290	237760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
204	108	204	2180	1165	1165		IGGIGTVPVGR	0	1	0	0	0	0	0	4	0	2	0	0	0	0	1	0	1	0	0	2	0	11	0	1024.6029	Q05639;P68104;Q5VTE0	Q05639	EEF1A2;EEF1AL;STN;EEF1A;EEF1A1;EF1A;LENG7;EEF1AL3	Elongation factor 1-alpha 2;Eukaryotic elongation factor 1 A-2;Statin-S1;Elongation factor 1-alpha 1;Elongation factor Tu;Eukaryotic elongation factor 1 A-1;Leukocyte receptor cluster member 7;Eukaryotic elongation factor 1 A-like 3;Putative elongation factor 1-alpha-like 3	yes	no	2	4.8137E-08	70.028	1	0	1	1	0	1			1																																			1																																	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
205	84	205	2181;2182;2183;2184;2185	1166;1167	1166		IGHFFFWHLK	0	0	0	0	0	0	0	1	2	1	1	1	0	3	0	0	0	1	0	0	0	10	0	1330.6975	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.013279	91.853	1	0	5	1	0	5																	1	1	1	2																																1	1	1	2																383350	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48544	48093	130680	156030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
206	5;150;109	206	2186;2187;2188;2189;2190;2191;2192;2193;2194;2195;2196;2197;2198;2199;2200;2201;2202;2203	1168;1169;1170;1171;1172;1173	1168		IHFPLATYAPVISAEK	3	0	0	0	0	0	1	0	1	2	1	1	0	1	2	1	1	0	1	1	0	16	0	1755.956	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;P68366	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA1;TUBA4A	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	no	no	3	6.4264E-12	115.34	1	0	18	NaN	NaN		1		1	2			1	1							2	1	1	1			2	1					2	2																																											2450000	611870	0	411060	416990	0	0	134450	26996	0	0	0	0	0	0	180400	111520	29034	46817	0	0	188230	142830	0	0	0	0	62074	87736	0	0	0	0	0	0	0		+
207	89	207	2204;2205;2206;2207;2208;2209;2210;2211;2212;2213	1174;1175	1174		IHYLDTTTLIEPAPR	1	1	0	1	0	0	1	0	1	2	2	0	0	0	2	0	3	0	1	0	0	15	0	1738.9254	P46109	P46109	CRKL	Crk-like protein	yes	yes	3	0.04994	76.073	1	0	10	1	0	10	1		1										1		1		1	1														1	1	1	1	1		1										1		1		1	1														1	1	1	1	1075200	32567	0	34951	0	0	0	0	0	0	0	0	0	45604	0	51139	0	208300	212680	0	0	0	0	0	0	0	0	0	0	0	0	0	87851	91903	146110	164110		
208	15	208	2214;2215;2216;2217;2218;2219	1176;1177	1177		IIAATIENAQPILQIDNAR	4	1	2	1	0	2	1	0	0	5	1	0	0	0	1	0	1	0	0	0	0	19	0	2063.1375	CON__P08779;P08779	CON__P08779	KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16	yes	no	3	8.7361E-07	151.56	1	0	6	1	0	6			1	1					1	1							1														1							1	1					1	1							1														1					786730	0	0	254790	224940	0	0	0	0	43921	44071	0	0	0	0	0	0	42741	0	0	0	0	0	0	0	0	0	0	0	0	0	176270	0	0	0	0		+
209	38	209	2220;2221;2222;2223;2224;2225;2226;2227;2228;2229;2230;2231;2232;2233	1178;1179;1180;1181;1182;1183;1184;1185;1186;1187;1188;1189;1190;1191	1180		IICAQQCSGR	1	1	0	0	2	2	0	1	0	2	0	0	0	0	0	1	0	0	0	0	0	10	0	1191.5489	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	3.5595E-17	200.05	1	0	14	1	0	14	1	1	1	1									1	1	1	1					1	1	1	1						1	1					1	1	1	1									1	1	1	1					1	1	1	1						1	1					9655400	2034300	1890900	1255100	1343300	0	0	0	0	0	0	0	0	182210	230700	343460	289030	0	0	0	0	471370	470830	485180	485630	0	0	0	0	0	62194	111260	0	0	0	0		
210	184	210	2234;2235;2236;2237;2238	1192	1192		IIHNFIR	0	1	1	0	0	0	0	0	1	3	0	0	0	1	0	0	0	0	0	0	0	7	0	911.53412	Q9NS86	Q9NS86	GPR69B;LANCL2;TASP	LanC-like protein 2;Testis-specific adriamycin sensitivity protein	yes	yes	2	0.077364	86.113	1	0	5	1	0	5	1	1	1	1												1																				1	1	1	1												1																				287800	73415	77760	51654	51671	0	0	0	0	0	0	0	0	0	0	0	33305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
211	99	211	2239;2240;2241;2242;2243;2244;2245;2246;2247;2248	1193;1194;1195;1196;1197	1194		IILDLISESPIK	0	0	0	1	0	0	1	0	0	4	2	1	0	0	1	2	0	0	0	0	0	12	0	1339.7963	P61978	P61978	HNRNPK;HNRPK	Heterogeneous nuclear ribonucleoprotein K;Transformation up-regulated nuclear protein	yes	yes	2	0.00019514	154.24	1	0	10	1	0	10	1	1												1	1	1	1	1	1	1											1					1	1												1	1	1	1	1	1	1											1					1047200	67627	81254	0	0	0	0	0	0	0	0	0	0	0	66757	237850	236230	55649	63116	61472	70062	0	0	0	0	0	0	0	0	0	0	107190	0	0	0	0		
212	54;55	212	2249;2250;2251;2252;2253;2254;2255;2256;2257;2258;2259;2260;2261;2262;2263;2264;2265;2266;2267;2268;2269;2270;2271;2272;2273;2274;2275;2276;2277;2278;2279;2280	1198;1199;1200;1201;1202;1203;1204;1205;1206;1207;1208;1209;1210;1211;1212;1213;1214;1215;1216;1217;1218	1198		IINEPTAAAIAYGLDK	4	0	1	1	0	0	1	1	0	3	1	1	0	0	1	0	1	0	1	0	0	16	0	1658.8879	P11021;P11142;P54652	P11021	GRP78;HSPA5;HSC70;HSP73;HSPA10;HSPA8;HSPA2	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein;Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	no	no	2,3	6.6972E-05	157.58	1	0	32	NaN	NaN		2	2	2	2	2	2	2	2	1	1			1		1	2					2	2					2	2			1			1																																					11865000	2183500	2165600	1537400	1565900	232340	269380	336270	359570	58586	37204	0	0	47070	0	83868	157650	0	0	0	0	1005400	980160	0	0	0	0	369450	376640	0	0	68761	0	0	30609	0		
213	55	213	2281;2282;2283;2284;2285	1219	1219		IINEPTAAAIAYGLDKK	4	0	1	1	0	0	1	1	0	3	1	2	0	0	1	0	1	0	1	0	0	17	1	1786.9829	P11142;P54652	P11142	HSC70;HSP73;HSPA10;HSPA8;HSPA2	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2	yes	no	2	0.015522	77.222	1	0	5	1	0	5	1	1	1	1																		1														1	1	1	1																		1														387850	79966	82868	103510	97628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23873	0	0	0	0	0	0	0	0	0	0	0	0	0		
214	54	214	2286;2287;2288;2289;2290;2291;2292;2293;2294;2295;2296;2297;2298;2299;2300;2301;2302;2303;2304;2305;2306;2307;2308;2309;2310;2311	1220;1221;1222;1223;1224;1225;1226;1227;1228;1229;1230;1231;1232	1225		IINEPTAAAIAYGLDKR	4	1	1	1	0	0	1	1	0	3	1	1	0	0	1	0	1	0	1	0	0	17	1	1814.989	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2,3	9.2535E-05	145.69	1	0	26	1	0	26	2	2	2	2	1	1	2	2					1	1	1	1					2	2					1	2			1					2	2	2	2	1	1	2	2					1	1	1	1					2	2					1	2			1					31733000	5532300	5064300	3871500	3830500	449670	580250	1409000	1459800	0	0	0	0	60583	116250	103770	134330	0	0	0	0	3564500	3309300	0	0	0	0	1031500	1081600	0	0	134340	0	0	0	0		
215	52;64	215	2312;2313;2314;2315;2316;2317;2318;2319;2320;2321;2322;2323;2324;2325;2326;2327;2328;2329;2330;2331;2332	1233;1234;1235;1236;1237;1238;1239	1234		IINEPTAAAIAYGLDR	4	1	1	1	0	0	1	1	0	3	1	0	0	0	1	0	1	0	1	0	0	16	0	1686.8941	P0DMV8;P0DMV9;P17066	P0DMV8	HSP70B;HSPA6	Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B	no	no	2,3	0.00012495	151.8	1	0	21	NaN	NaN		2	2	2	2			1	1							2	2					2	2					1	2																																											3151900	626580	643370	493320	487430	0	0	29862	40881	0	0	0	0	0	0	141470	115060	0	0	0	0	257630	229120	0	0	0	0	28991	58214	0	0	0	0	0	0	0		
216	85	216	2333;2334;2335;2336	1240;1241	1240		IISHVWENNNPFQIVLVK	0	0	3	0	0	1	1	0	1	3	1	1	0	1	1	1	0	1	0	3	0	18	0	2149.1684	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	3	0.00045416	118.13	1	0	4	1	0	4																	1	1	1	1																																1	1	1	1																956230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67241	88449	439350	361180	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
217	7	217;218	2337;2338;2339;2340;2341;2342;2343;2344;2345;2346;2347;2348;2349;2350;2351;2352;2353;2354;2355;2356;2357;2358;2359;2360;2361;2362;2363;2364	1242;1243;1244;1245;1246;1247;1248;1249;1250	1243	0	IITHPNFNGNTLDNDIMLIK	0	0	4	2	0	0	0	1	1	4	2	1	1	1	1	0	2	0	0	0	0	20	0	2282.1729	CON__P00761	CON__P00761			yes	yes	3	7.2272E-06	95.347	1	0	28	1	0	28	2	2	2	1			1	1	1	1					1	1	2	2	1	1	2	1					2	1			1			1	1	2	2	2	1			1	1	1	1					1	1	2	2	1	1	2	1					2	1			1			1	1	10564000	1084500	1201100	422350	378290	0	0	449160	506960	183990	166070	0	0	0	0	94810	64796	919380	900260	222990	191960	1072800	98462	0	0	0	0	953460	1064700	0	0	226350	0	0	165670	196090		+
218	133	219	2365;2366;2367	1251;1252	1252		IITLAGPTNAIFK	2	0	1	0	0	0	0	1	0	3	1	1	0	1	1	0	2	0	0	0	0	13	0	1357.7969	Q15366	Q15366	PCBP2	Alpha-CP2;Heterogeneous nuclear ribonucleoprotein E2;Poly(rC)-binding protein 2	yes	yes	2	0.031859	83.314	1	0	3	1	0	3	1	1		1																																1	1		1																																143920	50673	52066	0	41184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
219	16	220	2368;2369;2370;2371;2372;2373;2374;2375;2376;2377;2378;2379;2380	1253;1254;1255	1253		IKEWYEK	0	0	0	0	0	0	2	0	0	1	0	2	0	0	0	0	0	1	1	0	0	7	1	994.51238	CON__P13645;P13645;CON__P02535-1	CON__P13645	KPP;KRT10;KPP;KRT10;Krt10;Krt1-10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa	yes	no	2	0.050631	81.297	1	0	13	1	0	13			1	1	1	1	1							1		1	1	1			1					1					1			1				1	1	1	1	1							1		1	1	1			1					1					1			1		605740	0	0	48042	37698	0	56979	24625	0	0	0	0	0	0	19048	0	43057	66161	79124	0	0	42315	0	0	0	0	31786	0	0	0	0	121970	0	0	34937	0		+
220	67	221	2381;2382;2383;2384;2385;2386;2387;2388	1256;1257;1258	1257		IKPSSSANAIYSLAAR	4	1	1	0	0	0	0	0	0	2	1	1	0	0	1	4	0	0	1	0	0	16	1	1647.8944	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	3	0.015579	83.087	1	0	8	1	0	8													1	1	1	1	1	1	1	1																												1	1	1	1	1	1	1	1																1127200	0	0	0	0	0	0	0	0	0	0	0	0	74796	78260	69152	67399	196850	205300	221770	213700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
221	38	222	2389;2390;2391;2392	1259	1259		IKVLGSGAFGTVYK	1	0	0	0	0	0	0	3	0	1	1	2	0	1	0	1	1	0	1	2	0	14	1	1438.8184	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.17344	63.662	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																508220	192370	161230	73975	80641	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
222	55	223	2393;2394	1260;1261	1260		ILDKCNEIINWLDK	0	0	2	2	1	0	1	0	0	3	2	2	0	0	0	0	0	1	0	0	0	14	1	1772.9131	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	3	0.010158	100.93	1	0	2	1	0	2	1	1																																		1	1																																		210110	119970	90135	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
223	76	224	2395;2396;2397;2398;2399	1262;1263;1264	1262		ILFRPVASQLPR	1	2	0	0	0	1	0	0	0	1	2	0	0	1	2	1	0	0	0	1	0	12	1	1395.8351	P35232	P35232	PHB	Prohibitin	yes	yes	3	0.006065	98.943	1	0	5	1	0	5	1	1	1	1																	1															1	1	1	1																	1															522800	167140	139730	91793	82001	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42140	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
224	124	225	2400;2401	1265;1266	1265		ILGIIDAIQDAVGPPK	2	0	0	2	0	1	0	2	0	4	1	1	0	0	2	0	0	0	0	1	0	16	0	1618.9294	Q13191	Q13191	CBLB;Nbla00127;RNF56	Casitas B-lineage lymphoma proto-oncogene b;E3 ubiquitin-protein ligase CBL-B;RING finger protein 56;SH3-binding protein CBL-B;Signal transduction protein CBL-B	yes	yes	2	0.0057814	93.237	1	0	2	1	0	2															1	1																																		1	1																				203260	0	0	0	0	0	0	0	0	0	0	0	0	0	0	107270	95989	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
225	38	226	2402;2403;2404;2405	1267;1268;1269	1267		ILKETEFK	0	0	0	0	0	0	2	0	0	1	1	2	0	1	0	0	1	0	0	0	0	8	1	1006.5699	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.050008	91.626	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																343670	95053	82337	89335	76942	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
226	38	227	2406;2407;2408	1270	1270		ILKETEFKK	0	0	0	0	0	0	2	0	0	1	1	3	0	1	0	0	1	0	0	0	0	9	2	1134.6649	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.080562	87.308	1	0	3	1	0	3	1	1		1																																1	1		1																																127380	45873	42235	0	39271	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
227	137	228	2409;2410;2411;2412	1271;1272;1273;1274	1271		ILMMNTGDVGAR	1	1	1	1	0	0	0	2	0	1	1	0	2	0	0	0	1	0	0	1	0	12	0	1276.6268	Q4G0P3	Q4G0P3	HYDIN;HYDIN1;HYDIN2;KIAA1864	Hydrocephalus-inducing protein homolog	yes	yes	2	0.088493	28.177	1	0	4	1	0	4		1											1				1												1								1											1				1												1							0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
228	145	229	2413;2414;2415;2416;2417;2418;2419;2420;2421	1275;1276;1277;1278;1279;1280;1281	1276		ILSFVYPIR	0	1	0	0	0	0	0	0	0	2	1	0	0	1	1	1	0	0	1	1	0	9	0	1106.6488	Q6P1M0	Q6P1M0	ACSVL4;FATP4;SLC27A4	Long-chain fatty acid transport protein 4;Solute carrier family 27 member 4	yes	yes	2	0.0010651	123.92	1	0	9	1	0	9	1	1	1	1									1	1		1					1	1														1	1	1	1									1	1		1					1	1														750520	124370	160230	94553	114610	0	0	0	0	0	0	0	0	29435	41363	0	42596	0	0	0	0	77044	66335	0	0	0	0	0	0	0	0	0	0	0	0	0		
229	93	230	2422;2423;2424;2425;2426	1282;1283	1282		ILSLLEGQK	0	0	0	0	0	1	1	1	0	1	3	1	0	0	0	1	0	0	0	0	0	9	0	999.59645	P51648	P51648	ALDH10;ALDH3A2;FALDH	Aldehyde dehydrogenase 10;Aldehyde dehydrogenase family 3 member A2;Fatty aldehyde dehydrogenase;Microsomal aldehyde dehydrogenase	yes	yes	2	0.054724	80.239	1	0	5	1	0	5	1	1	1	1																	1															1	1	1	1																	1															471260	134130	147350	66352	77305	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46125	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
230	6	231	2427;2428	1284	1284		ILTATIENNR	1	1	2	0	0	0	1	0	0	2	1	0	0	0	0	0	2	0	0	0	0	10	0	1143.6248	CON__P13646-1;P13646;CON__ENSEMBL:ENSP00000377550	CON__P13646-1	KRT13;KRT13	Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13	yes	no	2	0.017114	90.15	1	0	2	1	0	2																							1	1																																		1	1												66286	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35065	31222	0	0	0	0	0	0	0	0	0	0	0		+
231	8	232	2429;2430;2431;2432;2433	1285	1285		ILTATVDNANVLLQIDNAR	3	1	3	2	0	1	0	0	0	2	3	0	0	0	0	0	2	0	0	2	0	19	0	2053.1168	CON__P02533;P02533	CON__P02533	KRT14;KRT14	Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14	yes	no	3	0.00022872	102.65	1	0	5	1	0	5									1	1											1	1									1													1	1											1	1									1					504080	0	0	0	0	0	0	0	0	76693	49054	0	0	0	0	0	0	0	0	0	0	79289	62674	0	0	0	0	0	0	0	0	236370	0	0	0	0		+
232	155	233	2434;2435	1286	1286		ILYDILAFAK	2	0	0	1	0	0	0	0	0	2	2	1	0	1	0	0	0	0	1	0	0	10	0	1165.6747	Q8IXB1	Q8IXB1	DNAJC10;ERDJ5;UNQ495/PRO1012	DnaJ homolog subfamily C member 10;ER-resident protein ERdj5;Macrothioredoxin	yes	yes	2	0.03971	79.148	1	0	2	1	0	2	1	1																																		1	1																																		91727	42302	49425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
233	46;125	234	2436;2437;2438;2439	1287;1288	1287		IMNTFSVVPSPK	0	0	1	0	0	0	0	0	0	1	0	1	1	1	2	2	1	0	0	2	0	12	0	1318.6955	P07437;P68371;P04350;Q13509	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB3;TUBB4	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-3 chain;Tubulin beta-III	no	no	2	0.0023336	115.33	1	0	4	NaN	NaN		1	1	1	1																																																																			433710	154370	151850	59153	68339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
234	26	235	2440;2441;2442;2443;2444;2445;2446;2447;2448;2449;2450;2451;2452;2453	1289;1290;1291;1292;1293;1294;1295;1296;1297;1298	1292		INEWLGIK	0	0	1	0	0	0	1	1	0	2	1	1	0	0	0	0	0	1	0	0	0	8	0	971.54402	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	1.0131E-07	161.02	1	0	14	1	0	14					1	1	1	1								1	1	1		1							1	1				1	1	1	1					1	1	1	1								1	1	1		1							1	1				1	1	1	1	8691800	0	0	0	0	127630	110880	47942	58951	0	0	0	0	0	0	0	19824	1267700	1351000	0	1180800	0	0	0	0	0	0	0	35064	0	0	0	465210	510810	1678900	1837100		
235	84	236	2454;2455;2456;2457;2458;2459;2460;2461;2462;2463	1299;1300;1301;1302;1303;1304;1305;1306;1307	1306		INHDCVPEQVIAEAIR	2	1	1	1	1	1	2	0	1	3	0	0	0	0	1	0	0	0	0	2	0	16	0	1862.9309	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	3	1.012E-07	164.68	1	0	10	1	0	10							1	1									1	1	1	1												1	1	1	1							1	1									1	1	1	1												1	1	1	1	3731500	0	0	0	0	0	0	103520	104530	0	0	0	0	0	0	0	0	387910	409760	1095700	788830	0	0	0	0	0	0	0	0	0	0	0	138360	137860	260910	304170		
236	66	237	2464;2465;2466;2467;2468;2469;2470;2471;2472;2473;2474	1308;1309;1310;1311;1312;1313	1313		IPALDPEKLNVFR	1	1	1	1	0	0	1	0	0	1	2	1	0	1	2	0	0	0	0	1	0	13	1	1510.8508	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	3	0.0078335	98.898	1	0	11	1	0	11					1	1	1	1									1	1	1	1							1	1						1						1	1	1	1									1	1	1	1							1	1						1		1702400	0	0	0	0	132260	172300	293370	297590	0	0	0	0	0	0	0	0	62002	72107	103830	85339	0	0	0	0	0	0	216340	221760	0	0	0	0	0	45484	0		
237	103	238	2475;2476;2477;2478	1314;1315	1314		IPDWFLNR	0	1	1	1	0	0	0	0	0	1	1	0	0	1	1	0	0	1	0	0	0	8	0	1059.5502	P62269	P62269	D6S218E;RPS18	40S ribosomal protein S18;Ke-3	yes	yes	2	0.019431	111.04	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																315210	103200	80817	67147	64048	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
238	38	239	2479;2480;2481;2482;2483;2484;2485;2486;2487;2488;2489;2490;2491;2492;2493;2494;2495;2496;2497;2498;2499;2500;2501;2502;2503;2504;2505;2506;2507;2508;2509;2510;2511;2512;2513;2514;2515;2516;2517;2518;2519;2520;2521;2522;2523;2524;2525;2526;2527;2528;2529;2530;2531;2532;2533;2534;2535;2536;2537;2538;2539;2540;2541;2542;2543;2544;2545;2546;2547;2548;2549;2550;2551;2552;2553;2554;2555;2556;2557;2558;2559;2560;2561;2562;2563;2564;2565;2566;2567;2568;2569;2570;2571;2572;2573;2574;2575;2576;2577;2578;2579;2580;2581	1316;1317;1318;1319;1320;1321;1322;1323;1324;1325;1326;1327;1328;1329;1330;1331;1332;1333;1334;1335;1336;1337;1338;1339;1340;1341;1342;1343;1344;1345;1346;1347;1348;1349;1350;1351;1352;1353;1354;1355;1356;1357;1358;1359;1360;1361;1362;1363;1364;1365;1366;1367;1368;1369;1370;1371;1372;1373;1374;1375;1376;1377;1378;1379;1380;1381;1382;1383;1384;1385;1386;1387;1388;1389;1390;1391;1392;1393;1394;1395	1390		IPLENLQIIR	0	1	1	0	0	1	1	0	0	3	2	0	0	0	1	0	0	0	0	0	0	10	0	1207.7289	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	7.2209E-67	266.91	1	0	103	1	0	103	14	12	10	10	1	1	1	1					3	2	9	8	1	1	1	2	6	9	1	1			1	1	1	1	1	1	1	1	1	14	12	10	10	1	1	1	1					3	2	9	8	1	1	1	2	6	9	1	1			1	1	1	1	1	1	1	1	1	257050000	38826000	42206000	26863000	28117000	459670	454810	461420	510430	0	0	0	0	8154200	8053900	17633000	18133000	1169700	1124100	1056300	943770	26826000	27224000	184040	219040	0	0	286420	220560	1975300	2420100	3079900	71571	92392	146700	142990		
239	26	240	2582;2583;2584;2585;2586;2587;2588;2589;2590	1396;1397;1398;1399;1400	1397		IQGEYTLTLR	0	1	0	0	0	1	1	1	0	1	2	0	0	0	0	0	2	0	1	0	0	10	0	1192.6452	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.00076398	115.78	1	0	9	1	0	9						1											1	1	1	1												1	1	1	1						1											1	1	1	1												1	1	1	1	5719600	0	0	0	0	0	25716	0	0	0	0	0	0	0	0	0	0	805430	736120	1220800	1147200	0	0	0	0	0	0	0	0	0	0	0	362530	303210	569580	548950		
240	26	241	2591;2592;2593;2594;2595;2596;2597;2598;2599	1401;1402;1403;1404;1405;1406;1407;1408	1403		IRDQYLVWLTQK	0	1	0	1	0	2	0	0	0	1	2	1	0	0	0	0	1	1	1	1	0	12	1	1561.8617	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	0.0073306	94.465	1	0	9	1	0	9							1										1	1	1	1												1	1	1	1							1										1	1	1	1												1	1	1	1	13080000	0	0	0	0	0	0	54711	0	0	0	0	0	0	0	0	0	2835900	2724700	3769800	3144000	0	0	0	0	0	0	0	0	0	0	0	151130	132670	137110	129860		
241	16	242	2600;2601;2602;2603;2604;2605;2606;2607;2608;2609;2610;2611;2612;2613;2614;2615;2616;2617;2618;2619;2620;2621	1409;1410;1411;1412;1413;1414	1410		IRLENEIQTYR	0	2	1	0	0	1	2	0	0	2	1	0	0	0	0	0	1	0	1	0	0	11	1	1433.7627	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2,3	0.00077248	117.52	1	0	22	1	0	22			1	1	1	1			1	1		1	1	1	1	1	1	1	1	1	2	1									2			1	1			1	1	1	1			1	1		1	1	1	1	1	1	1	1	1	2	1									2			1	1	1681700	0	0	58077	53029	87570	77092	0	0	49482	32900	0	56693	49145	39389	90177	95730	125770	107260	48767	42298	177530	99726	0	0	0	0	0	0	0	0	275820	0	0	53052	62168		+
242	17	243	2622;2623;2624;2625;2626;2627;2628;2629;2630;2631;2632;2633;2634;2635	1415;1416;1417;1418;1419;1420;1421;1422;1423	1419		ISISTSGGSFR	0	1	0	0	0	0	0	2	0	2	0	0	0	1	0	4	1	0	0	0	0	11	0	1110.5669	CON__P13647;P13647	CON__P13647	KRT5;KRT5	58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5	yes	no	2	2.0339E-08	96.342	1	0	14	1	0	14			1	1	1	1					1	1	1	1			1				1									1	1			1	1			1	1	1	1					1	1	1	1			1				1									1	1			1	1	551560	0	0	38342	48584	0	28136	0	0	0	0	41831	40464	70194	74129	0	0	41390	0	0	0	22829	0	0	0	0	0	0	0	0	19394	73749	0	0	52519	0		+
243	105	244	2636;2637;2638;2639;2640;2641;2642;2643;2644;2645;2646;2647;2648;2649;2650;2651;2652	1424;1425;1426	1425		ISLGLPVGAVINCADNTGAK	3	0	2	1	1	0	0	3	0	2	2	1	0	0	1	1	1	0	0	2	0	20	0	1969.0303	P62829	P62829	RPL23	60S ribosomal protein L17;60S ribosomal protein L23	yes	yes	2,3	2.2216E-06	117.18	1	0	17	1	0	17	2	1	1	2			2	1							1		1	1	1		2	1						1								2	1	1	2			2	1							1		1	1	1		2	1						1								2100200	548340	294740	240710	309020	0	0	87197	85091	0	0	0	0	0	0	18754	0	81710	64133	50914	0	208370	64170	0	0	0	0	0	47040	0	0	0	0	0	0	0		
244	53	245	2653;2654;2655;2656;2657;2658;2659;2660;2661	1427;1428	1428		ISSIQSIVPALEIANAHR	3	1	1	0	0	1	1	0	1	4	1	0	0	0	1	3	0	0	0	1	0	18	0	1918.0636	P10809	P10809	HSP60;HSPD1	60 kDa chaperonin;60 kDa heat shock protein, mitochondrial;Chaperonin 60;Heat shock protein 60;HuCHA60;Mitochondrial matrix protein P1;P60 lymphocyte protein	yes	yes	3	0.081167	60.918	1	0	9	1	0	9	1	1	1	1											1	1		1			1	1														1	1	1	1											1	1		1			1	1														1241800	242050	237920	148730	147620	0	0	0	0	0	0	0	0	0	0	99773	70499	0	37232	0	0	126200	131730	0	0	0	0	0	0	0	0	0	0	0	0	0		
245	8;15	246	2662	1429	1429		ISSVLAGGSCR	1	1	0	0	1	0	0	2	0	1	1	0	0	0	0	3	0	0	0	1	0	11	0	1105.555	CON__P02533;P02533;CON__P08779;P08779	CON__P02533	KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16	no	no	2	0.024909	83.862	1	0	1	NaN	NaN																																1																																								45931	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45931	0	0	0	0		+
246	127	247	2663	1430	1430		ISTLSCENK	0	0	1	0	1	0	1	0	0	1	1	1	0	0	0	2	1	0	0	0	0	9	0	1050.5016	Q14116	Q14116	IGIF;IL18;IL1F4	Iboctadekin;Interferon gamma-inducing factor;Interleukin-1 gamma;Interleukin-18	yes	yes	2	0.047418	59.35	1	0	1	1	0	1																1																																			1																				0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
247	38	248	2664;2665;2666;2667;2668;2669;2670;2671;2672;2673;2674;2675	1431;1432;1433;1434;1435	1432		ITDFGLAK	1	0	0	1	0	0	0	1	0	1	1	1	0	1	0	0	1	0	0	0	0	8	0	863.47527	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	1	0.020078	110.36	1	0	12	1	0	12	1	1	1	1									1	1	1	1					1	1	1	1												1	1	1	1									1	1	1	1					1	1	1	1												2146500	390030	377440	363670	345040	0	0	0	0	0	0	0	0	65021	42324	94375	92312	0	0	0	0	98556	84815	94132	98746	0	0	0	0	0	0	0	0	0	0	0		
248	54	249	2676;2677;2678;2679;2680;2681;2682	1436;1437;1438;1439	1437		ITITNDQNR	0	1	2	1	0	1	0	0	0	2	0	0	0	0	0	0	2	0	0	0	0	9	0	1073.5465	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.0076738	83.005	1	0	7	1	0	7	1	1	1	1																	1		1	1												1	1	1	1																	1		1	1												253670	60634	55323	0	52838	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44546	40333	0	0	0	0	0	0	0	0	0	0	0		
249	54	250	2683;2684;2685;2686;2687;2688;2689;2690;2691;2692;2693;2694	1440;1441;1442;1443;1444;1445;1446;1447;1448;1449	1449		ITPSYVAFTPEGER	1	1	0	0	0	0	2	1	0	1	0	0	0	1	2	1	2	0	1	1	0	14	0	1565.7726	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.0052466	134.99	1	0	12	1	0	12	1	1	1	1	1	1	1	1													1	1				1		1								1	1	1	1	1	1	1	1													1	1				1		1								3096000	453390	446630	484550	473560	168880	129500	127640	146230	0	0	0	0	0	0	0	0	0	0	0	0	301840	251010	0	0	0	18489	0	94225	0	0	0	0	0	0	0		
250	141	251	2695;2696;2697;2698;2699;2700;2701;2702	1450;1451;1452;1453;1454	1450		ITVLEALR	1	1	0	0	0	0	1	0	0	1	2	0	0	0	0	0	1	0	0	1	0	8	0	913.55967	Q5T9A4;Q9NVI7;Q5T2N8	Q5T9A4	ATAD3B;KIAA1273;ATAD3A;ATAD3C	ATPase family AAA domain-containing protein 3B;ATPase family AAA domain-containing protein 3A;ATPase family AAA domain-containing protein 3C	yes	no	2	0.013007	117.4	1	0	8	1	0	8	1	1	1	1									1		1						1	1														1	1	1	1									1		1						1	1														607590	99465	74540	89159	101150	0	0	0	0	0	0	0	0	0	0	42076	0	0	0	0	0	111720	89477	0	0	0	0	0	0	0	0	0	0	0	0	0		
251	13	252	2703;2704;2705;2706;2707;2708	1455	1455		IVLQIDNAR	1	1	1	1	0	1	0	0	0	2	1	0	0	0	0	0	0	0	0	1	0	9	0	1040.5978	CON__P19001;CON__P08727;P08727;CON__P05784;P05783	CON__P19001	Krt1-19;Krt19;KRT19;KRT19;Kerd;Krt1-18;Krt18;CYK18;KRT18;PIG46	Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin endo B;Cytokeratin-18;Keratin, type I cytoskeletal 18;Keratin-18;Cell proliferation-inducing gene 46 protein	yes	no	2	0.12479	71.223	1	0	6	1	0	6	1	1		1									1									1								1						1	1		1									1									1								1						257150	68823	64981	0	35652	0	0	0	0	0	0	0	0	20126	0	0	0	0	0	0	0	0	31737	0	0	0	0	0	0	0	35835	0	0	0	0	0		+
252	1	253	2709;2710;2711;2712;2713;2714;2715;2716;2717;2718;2719	1456;1457;1458;1459	1456		IWHHTFYNELR	0	1	1	0	0	0	1	0	2	1	1	0	0	1	0	0	1	1	1	0	0	11	0	1514.7419	A5A3E0;P0CG38;Q6S8J3;P68032;P68133;CON__P60712;P60709;P63261;Q9BYX7;P0CG39	A5A3E0	A26C1B;POTEF;A26C1A;POTE2;POTEE;ACTC;ACTC1;ACTA;ACTA1;ACTB;ACTB;ACTG;ACTG1;ACTBL3;FKSG30;POTEKP	ANKRD26-like family C member 1B;Chimeric POTE-actin protein;POTE ankyrin domain family member F;ANKRD26-like family C member 1A;POTE ankyrin domain family member E;Prostate, ovary, testis-expressed protein on chromosome 2;Actin, alpha cardiac muscle 1;Alpha-cardiac actin;Actin, alpha skeletal muscle;Alpha-actin-1;Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Beta-actin;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Gamma-actin;Kappa-actin;POTE ankyrin domain family member K;Putative beta-actin-like protein 3	yes	no	3	0.0053797	100.02	1	0	11	1	0	11	1	1	1	1									1	1	1		1				1	1									1					1	1	1	1									1	1	1		1				1	1									1					900210	140560	156300	125950	141400	0	0	0	0	0	0	0	0	60171	55565	48683	0	26926	0	0	0	53145	51625	0	0	0	0	0	0	0	0	39892	0	0	0	0		+
253	30	254	2720	1460	1460		KELENLDSR	0	1	1	1	0	0	2	0	0	0	2	1	0	0	0	1	0	0	0	0	0	9	1	1102.5619	O43196	O43196	MSH5	MutS protein homolog 5	yes	yes	2	0.089257	48.423	1	0	1	1	0	1																	1																																			1																			54977	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54977	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
254	107	255	2721;2722;2723;2724;2725;2726;2727;2728	1461;1462	1461		KIEEIKDFLLTAR	1	1	0	1	0	0	2	0	0	2	2	2	0	1	0	0	1	0	0	0	0	13	2	1574.9032	P63173	P63173	RPL38	60S ribosomal protein L38	yes	yes	3	0.040758	90.614	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														877320	246010	229770	68836	76677	0	0	0	0	0	0	0	0	0	0	54016	49658	0	0	0	0	84523	67834	0	0	0	0	0	0	0	0	0	0	0	0	0		
255	26	256	2729;2730;2731;2732;2733;2734;2735;2736;2737;2738;2739	1463;1464;1465;1466;1467	1464		KINEWLGIK	0	0	1	0	0	0	1	1	0	2	1	2	0	0	0	0	0	1	0	0	0	9	1	1099.639	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.0045517	120.99	1	0	11	1	0	11					1	1		1									1	1	1	1												1	1	1	1					1	1		1									1	1	1	1												1	1	1	1	5733800	0	0	0	0	0	30091	0	32440	0	0	0	0	0	0	0	0	1223100	1247300	884760	895840	0	0	0	0	0	0	0	0	0	0	0	163840	201650	519070	535750		
256	26	257	2740;2741;2742;2743;2744	1468;1469;1470;1471	1469		KIRDQYLVWLTQK	0	1	0	1	0	2	0	0	0	1	2	2	0	0	0	0	1	1	1	1	0	13	2	1689.9566	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	0.011777	123.67	1	0	5	1	0	5																	1	1	1	1														1																		1	1	1	1														1		1914600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	496680	409200	555530	414810	0	0	0	0	0	0	0	0	0	0	0	0	0	38336	0		
257	54	258	2745;2746;2747;2748;2749;2750;2751;2752;2753	1472;1473;1474;1475;1476	1473		KKELEEIVQPIISK	0	0	0	0	0	1	3	0	0	3	1	3	0	0	1	1	0	0	0	1	0	14	2	1652.9713	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	3	0.024708	105.65	1	0	9	1	0	9	1	1	1	1	1	1		1													1	1														1	1	1	1	1	1		1													1	1														1374700	280140	239730	159710	164980	82866	69297	0	75262	0	0	0	0	0	0	0	0	0	0	0	0	169700	133040	0	0	0	0	0	0	0	0	0	0	0	0	0		
258	38	259	2754;2755;2756;2757;2758;2759;2760;2761	1477;1478;1479	1478		KLFGTSGQK	0	0	0	0	0	1	0	2	0	0	1	2	0	1	0	1	1	0	0	0	0	9	1	964.53418	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.042808	93.178	1	0	8	1	0	8	1	1		1									1	1	1	1					1															1	1		1									1	1	1	1					1															1223100	285730	239860	0	317170	0	0	0	0	0	0	0	0	73953	59953	63969	63137	0	0	0	0	119300	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
259	148	260	2762;2763;2764;2765;2766;2767;2768;2769;2770;2771;2772;2773;2774;2775;2776;2777;2778;2779;2780;2781;2782;2783;2784;2785;2786;2787;2788;2789;2790;2791;2792;2793;2794;2795;2796;2797;2798;2799;2800;2801;2802	1480;1481;1482;1483;1484;1485;1486;1487;1488;1489;1490;1491;1492;1493;1494	1485		KRAEGLSGYAVR	2	2	0	0	0	0	1	2	0	0	1	1	0	0	0	1	0	0	1	1	0	12	2	1305.7153	Q6URK8	Q6URK8	TEPP	Testis, prostate and placenta-expressed protein	yes	yes	2	0.0092704	113.69	1	0	41	1	0	41	3	2	2	3	1	2	2	1					2	2	2	2	1	1	1	1	2	2	2	1			1		2	2	1					3	2	2	3	1	2	2	1					2	2	2	2	1	1	1	1	2	2	2	1			1		2	2	1					93997000	12804000	12310000	18207000	17882000	61768	156100	180850	94246	0	0	0	0	2743300	3148600	5775500	5864400	133510	125910	177730	184420	6281600	6126900	45446	40342	0	0	61317	0	378680	635670	577150	0	0	0	0		
260	65	261	2803	1495	1495		KVDVYGFVSR	0	1	0	1	0	0	0	1	0	0	0	1	0	1	0	1	0	0	1	3	0	10	1	1168.6241	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	2	8.3065E-05	85.355	1	0	1	1	0	1																1																																			1																				0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
261	54	262	2804;2805;2806;2807;2808;2809;2810;2811;2812;2813;2814	1496;1497;1498	1498		KVTHAVVTVPAYFNDAQR	3	1	1	1	0	1	0	0	1	0	0	1	0	1	1	0	2	0	1	4	0	18	1	2015.0589	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	3	0.026251	75.968	1	0	11	1	0	11	1	1	1	1	1	1	1	1													1	1						1								1	1	1	1	1	1	1	1													1	1						1								937630	167600	159530	123360	132330	31681	46236	38302	39761	0	0	0	0	0	0	0	0	0	0	0	0	95320	76522	0	0	0	0	0	26983	0	0	0	0	0	0	0		
262	17	263	2815	1499	1499		LAELEEALQK	2	0	0	0	0	1	3	0	0	0	3	1	0	0	0	0	0	0	0	0	0	10	0	1142.6183	CON__P13647;P13647	CON__P13647	KRT5;KRT5	58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5	yes	no	2	8.9475E-05	71.349	1	0	1	1	0	1												1																																			1																								0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
263	66	264	2816;2817;2818;2819;2820;2821;2822;2823;2824;2825;2826;2827;2828	1500;1501;1502;1503;1504;1505;1506;1507;1508	1508		LAEVPDLLEK	1	0	0	1	0	0	2	0	0	0	3	1	0	0	1	0	0	0	0	1	0	10	0	1125.6281	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	0.0026706	90.629	1	0	13	1	0	13					1	1	1	1									1	1	1	1						1	1	1						1	1					1	1	1	1									1	1	1	1						1	1	1						1	1	3414600	0	0	0	0	547470	549600	496200	537860	0	0	0	0	0	0	0	0	104750	103140	0	143440	0	0	0	0	0	77618	333450	365250	0	0	0	0	0	67663	88191		
264	88	265	2829;2830	1509	1509		LAFLNVQAAEEALPR	4	1	1	0	0	1	2	0	0	0	3	0	0	1	1	0	0	0	0	1	0	15	0	1640.8886	P43304	P43304	GPD2	Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD	yes	yes	3	0.0089866	104.17	1	0	2	1	0	2	1	1																																		1	1																																		172710	66460	106250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
265	40	266	2831;2832;2833;2834;2835;2836;2837;2838;2839;2840;2841;2842;2843;2844;2845;2846;2847;2848;2849;2850;2851;2852	1510;1511;1512;1513;1514;1515;1516;1517;1518;1519;1520;1521;1522;1523;1524	1522		LALDLEIATYR	2	1	0	1	0	0	1	0	0	1	3	0	0	0	0	0	1	0	1	0	0	11	0	1276.7027	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	6.057E-12	196.27	1	0	22	1	0	22		1					1	1	1	1			1		1	1	1	1	1	1	1	1					1	1			2	1	1	1	1		1					1	1	1	1			1		1	1	1	1	1	1	1	1					1	1			2	1	1	1	1	3395300	0	31424	0	0	0	0	57685	37018	369850	373320	0	0	41387	0	145920	134050	139330	100040	259820	206360	228910	203010	0	0	0	0	65298	65332	0	0	703880	23771	30170	101220	77478		+
266	16;19;8;15;13	267	2853	1525	1525		LASYLDK	1	0	0	1	0	0	0	0	0	0	2	1	0	0	0	1	0	0	1	0	0	7	0	808.43307	CON__P35527;P35527;CON__P13645;P13645;CON__Q99456;Q99456;CON__P08730-1;CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P05784;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779	CON__P13645	KRT9;KRT9;KPP;KRT10;KPP;KRT10;KRT12;KRT12;Krt1-13;Krt13;Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;Kerd;Krt1-18;Krt18;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9;Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-12;Keratin, type I cytoskeletal 12;Keratin-12;47 kDa cytokeratin;Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13;Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin endo B;Cytokeratin-18;Keratin, type I cytoskeletal 18;Keratin-18;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16	no	no	1	0.097602	77.748	1	0	1	NaN	NaN																																1																																								126310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	126310	0	0	0	0		+
267	19	268	2854;2855;2856;2857;2858;2859;2860;2861;2862;2863;2864;2865;2866	1526;1527	1527		LASYLDKVQALEEANNDLENK	3	0	3	2	0	1	3	0	0	0	4	2	0	0	0	1	0	0	1	1	0	21	1	2376.1809	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	5.9425E-10	151.48	1	0	13	1	0	13				1					1	1					1	1	1	1	1	1	1	1									1				1				1					1	1					1	1	1	1	1	1	1	1									1				1	1897000	0	0	0	63564	0	0	0	0	101180	75359	0	0	0	0	60778	75196	108070	115860	107990	96090	232140	258000	0	0	0	0	0	0	0	0	579220	0	0	0	23514		+
268	16;8;15;13	269	2867;2868;2869;2870;2871;2872;2873;2874;2875;2876;2877;2878;2879;2880;2881;2882;2883;2884;2885;2886;2887;2888;2889;2890	1528;1529;1530;1531;1532;1533;1534;1535;1536;1537;1538;1539	1533		LASYLDKVR	1	1	0	1	0	0	0	0	0	0	2	1	0	0	0	1	0	0	1	1	0	9	1	1063.6026	CON__P13645;P13645;CON__Q99456;Q99456;CON__P08730-1;CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779	CON__P13645	KPP;KRT10;KPP;KRT10;KRT12;KRT12;Krt1-13;Krt13;Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-12;Keratin, type I cytoskeletal 12;Keratin-12;47 kDa cytokeratin;Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13;Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16	no	no	2	5.1544E-08	147.51	1	0	24	NaN	NaN				1	1	1	1	1	1	1	1	1	1		1	1	1	1	1			1	1			1	1			1	1	1			1	1																																				3314800	0	0	146260	152200	111880	69020	57481	62960	58534	59800	81201	116960	0	42920	157570	120690	104640	89793	0	0	99409	120330	0	0	103420	118440	0	0	120700	118860	1033100	0	0	90600	78092		+
269	46;125	270	2891;2892;2893;2894	1540;1541;1542	1542		LAVNMVPFPR	1	1	1	0	0	0	0	0	0	0	1	0	1	1	2	0	0	0	0	2	0	10	0	1142.627	P07437;P68371;P04350;Q13885;Q9BVA1;A6NNZ2;Q3ZCM7;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7;Q13509	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB8;TUBB1;TUBB3;TUBB4	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-8 chain B;Tubulin beta-8 chain;Tubulin beta-1 chain;Tubulin beta-3 chain;Tubulin beta-III	no	no	2	0.018969	89.247	1	0	4	NaN	NaN		1	1	1	1																																																																			435370	120290	144720	90215	80133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
270	85	271	2895;2896;2897;2898;2899;2900;2901;2902;2903;2904;2905;2906;2907;2908;2909;2910;2911;2912;2913;2914;2915;2916;2917	1543;1544;1545;1546;1547;1548;1549;1550	1550		LCDVRPFLPVLK	0	1	0	1	1	0	0	0	0	0	3	1	0	1	2	0	0	0	0	2	0	12	1	1455.8272	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2,3	0.015232	90.108	1	0	23	1	0	23					1	1	1	1								2	2	2	2	2							1	1				1	2	2	2					1	1	1	1								2	2	2	2	2							1	1				1	2	2	2	4214000	0	0	0	0	71487	58688	96258	102420	0	0	0	0	0	0	0	34844	536250	536000	593120	424160	0	0	0	0	0	0	37958	40304	0	0	0	143520	190260	680330	668430		
271	96	272	2918;2919	1551;1552	1552		LCLQSIAFISR	1	1	0	0	1	1	0	0	0	2	2	0	0	1	0	2	0	0	0	0	0	11	0	1306.7067	P57088	P57088	DB83;TMEM33	Protein DB83;Transmembrane protein 33	yes	yes	2	7.0731E-09	86.014	1	0	2	1	0	2	1																					1														1																					1														0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
272	84	273	2920;2921;2922;2923;2924;2925;2926;2927;2928;2929;2930;2931	1553;1554;1555;1556;1557;1558	1555		LCLSICSVK	0	0	0	0	2	0	0	0	0	1	2	1	0	0	0	2	0	0	0	1	0	9	0	1078.5515	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.00086889	124.98	1	0	12	1	0	12					1	1	1	1									1	1	1	1												1	1	1	1					1	1	1	1									1	1	1	1												1	1	1	1	2576500	0	0	0	0	60934	61870	62910	59419	0	0	0	0	0	0	0	0	381170	352380	373640	358400	0	0	0	0	0	0	0	0	0	0	0	164920	154390	267430	279090		
273	84	274	2932;2933;2934;2935;2936;2937;2938	1559;1560;1561;1562	1561		LCVLEYQGK	0	0	0	0	1	1	1	1	0	0	2	1	0	0	0	0	0	0	1	1	0	9	0	1108.5587	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.0032631	88.819	1	0	7	1	0	7																	1	1	1	1												1		1	1																	1	1	1	1												1		1	1	319480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56823	60047	54809	77925	0	0	0	0	0	0	0	0	0	0	0	16438	0	0	53437		
274	55	275	2939;2940;2941;2942;2943;2944;2945;2946;2947;2948;2949;2950;2951	1563;1564;1565;1566;1567;1568;1569	1563		LDKSQIHDIVLVGGSTR	0	1	0	2	0	1	0	2	1	2	2	1	0	0	0	2	1	0	0	2	0	17	1	1837.0058	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	3	5.472E-10	167.89	1	0	13	1	0	13	1	1	1	1	1	1	1	1							1	1					1	1						1								1	1	1	1	1	1	1	1							1	1					1	1						1								2152100	419370	375480	290750	269640	41929	25454	80772	81282	0	0	0	0	0	0	28697	29749	0	0	0	0	255030	228140	0	0	0	0	0	25840	0	0	0	0	0	0	0		
275	183	276	2952;2953;2954;2955	1570;1571	1571		LDNWLNELETYCTR	0	1	2	1	1	0	2	0	0	0	3	0	0	0	0	0	2	1	1	0	0	14	0	1825.8305	Q9NP72	Q9NP72	RAB18	Ras-related protein Rab-18	yes	yes	2	0.010119	106.13	1	0	4	1	0	4	1	1													1							1														1	1													1							1														279390	119400	102980	0	0	0	0	0	0	0	0	0	0	0	0	23950	0	0	0	0	0	0	33065	0	0	0	0	0	0	0	0	0	0	0	0	0		
276	12	277	2956;2957;2958;2959;2960;2961;2962;2963;2964;2965;2966;2967;2968	1572;1573;1574;1575;1576;1577;1578;1579	1573		LEGLTDEINFLR	0	1	1	1	0	0	2	1	0	1	3	0	0	1	0	0	1	0	0	0	0	12	0	1418.7405	CON__P05787;P05787;CON__H-INV:HIT000292931	CON__P05787	CYK8;KRT8;CYK8;KRT8	Cytokeratin-8;Keratin, type II cytoskeletal 8;Keratin-8;Type-II keratin Kb8	yes	no	2	2.7118E-07	176.78	1	0	13	1	0	13	1	1	1	1					1	1					1	1	1	1			1	1									1					1	1	1	1					1	1					1	1	1	1			1	1									1					2403100	446990	448470	226600	225790	0	0	0	0	79298	69013	0	0	0	0	158660	124660	27975	24175	0	0	227660	190300	0	0	0	0	0	0	0	0	153490	0	0	0	0		+
277	199	278	2969;2970;2971;2972;2973;2974	1580	1580		LEIEQKDIELR	0	1	0	1	0	1	3	0	0	2	2	1	0	0	0	0	0	0	0	0	0	11	1	1384.7562	REV__Q86SQ7	REV__Q86SQ7			yes	yes	2	0.088848	69.01	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														506070	99652	101850	57041	68992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	105610	72931	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
278	195	279	2975;2976	1581	1581		LELESVQR	0	1	0	0	0	1	2	0	0	0	2	0	0	0	0	1	0	0	0	1	0	8	0	972.52401	REV__Q2M243	REV__Q2M243			yes	yes	2	0.026253	103.92	1	0	2	1	0	2																1				1																															1				1																138530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86667	0	0	0	51862	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
279	16	280	2977;2978;2979;2980;2981;2982;2983;2984;2985;2986;2987;2988;2989;2990;2991;2992;2993;2994;2995	1582;1583;1584;1585;1586;1587;1588;1589;1590;1591;1592	1587		LENEIQTYR	0	1	1	0	0	1	2	0	0	1	1	0	0	0	0	0	1	0	1	0	0	9	0	1164.5775	CON__P13645;P13645;CON__P02535-1	CON__P13645	KPP;KRT10;KPP;KRT10;Krt10;Krt1-10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa	yes	no	2	4.7429E-05	134.26	1	0	19	1	0	19	1	1	1	1	1	1					1	1			1	1	1	1		1	1	1			1	1					1				1	1	1	1	1	1	1					1	1			1	1	1	1		1	1	1			1	1					1				1	902510	52508	48461	35628	45342	58182	49510	0	0	0	0	34257	51044	0	0	50022	0	87444	75457	0	0	68246	70415	0	0	38920	28057	0	0	0	0	69679	0	0	0	39335		+
280	82	281	2996;2997;2998;2999;3000;3001;3002	1593;1594;1595;1596	1596		LENWITSLAESQLQTR	1	1	1	0	0	2	2	0	0	1	3	0	0	0	0	2	2	1	0	0	0	16	0	1887.969	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	2,3	1.0147E-06	164.15	1	0	7	1	0	7	2	2													1	2																				2	2													1	2																				2422100	1145100	1087900	0	0	0	0	0	0	0	0	0	0	0	0	66179	122920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
281	206	282	3003;3004;3005;3006;3007;3008;3009;3010;3011;3012;3013;3014	1597	1597		LETSEELIAEVK	1	0	0	0	0	0	4	0	0	1	2	1	0	0	0	1	1	0	0	1	0	12	0	1359.7133	REV__Q96K76	REV__Q96K76			yes	yes	2	0.034903	79.659	1	0	12	1	0	12	1	1							1	1					1	1	1	1	1		1	1									1					1	1							1	1					1	1	1	1	1		1	1									1					976020	41099	48924	0	0	0	0	0	0	36216	40372	0	0	0	0	65968	76150	47755	54778	49974	0	172570	143800	0	0	0	0	0	0	0	0	198410	0	0	0	0	+	
282	141	283	3015	1598	1598		LFDWANTSR	1	1	1	1	0	0	0	0	0	0	1	0	0	1	0	1	1	1	0	0	0	9	0	1108.5302	Q5T9A4;Q9NVI7;Q5T2N8	Q5T9A4	ATAD3B;KIAA1273;ATAD3A;ATAD3C	ATPase family AAA domain-containing protein 3B;ATPase family AAA domain-containing protein 3A;ATPase family AAA domain-containing protein 3C	yes	no	2	0.04071	60.91	1	0	1	1	0	1			1																																			1																																	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
283	67	284	3016;3017;3018;3019;3020;3021;3022	1599;1600;1601;1602;1603;1604;1605	1605		LFQPWSSLLR	0	1	0	0	0	1	0	0	0	0	3	0	0	1	1	2	0	1	0	0	0	10	0	1245.687	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	2	0.026963	85.355	1	0	7	1	0	7															1	1	2	1	1	1																														1	1	2	1	1	1																856790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112330	120430	117750	95136	208890	202250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
284	65	285	3023;3024;3025	1606;1607	1607		LFREEFNALPACPIQATCEAASK	5	1	1	0	2	1	3	0	0	1	2	1	0	2	2	1	1	0	0	0	0	23	1	2622.257	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	3	0.0011872	86.8	1	0	3	1	0	3															1	1															1																			1	1															1					646000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	214230	235170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	196590	0	0	0	0		
285	120	286	3026;3027	1608	1608		LFSANDVENIFSR	1	1	2	1	0	0	1	0	0	1	1	0	0	2	0	2	0	0	0	1	0	13	0	1510.7416	Q07889	Q07889	SOS1	Son of sevenless homolog 1	yes	yes	2	1.6148E-11	184.1	1	0	2	1	0	2															1	1																																		1	1																				420600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	219200	201400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
286	131	287	3028;3029;3030;3031;3032;3033;3034;3035;3036;3037;3038;3039	1609;1610;1611;1612;1613;1614;1615;1616	1610		LFVYDPNNPPSSEVLR	0	1	2	1	0	0	1	0	0	0	2	0	0	1	3	2	0	0	1	2	0	16	0	1845.9261	Q15165	Q15165	PON2	Aromatic esterase 2;Serum aryldialkylphosphatase 2;Serum paraoxonase/arylesterase 2	yes	yes	2	5.0375E-07	164.2	1	0	12	1	0	12	1	1	1	1	1	1	1	1													1	1					1	1								1	1	1	1	1	1	1	1													1	1					1	1								3075900	515510	481250	587550	633050	54502	67833	137580	116440	0	0	0	0	0	0	0	0	0	0	0	0	201970	160420	0	0	0	0	50776	68983	0	0	0	0	0	0	0		
287	67	288	3040;3041;3042;3043;3044;3045	1617;1618;1619;1620;1621	1621		LGDSWLPRPIPK	0	1	0	1	0	0	0	1	0	1	2	1	0	0	3	1	0	1	0	0	0	12	1	1377.7769	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	3	0.0068926	96.015	1	0	6	1	0	6													1	1		1		1	1	1																												1	1		1		1	1	1																1380600	0	0	0	0	0	0	0	0	0	0	0	0	98483	125410	0	127340	0	307310	374840	347240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
288	7	289	3046;3047;3048;3049;3050;3051;3052;3053;3054;3055;3056;3057;3058;3059;3060;3061;3062;3063;3064;3065;3066;3067;3068;3069;3070;3071;3072;3073;3074;3075;3076;3077;3078;3079;3080;3081;3082;3083;3084;3085;3086;3087;3088;3089;3090;3091;3092;3093;3094;3095;3096;3097;3098;3099;3100;3101;3102;3103;3104;3105;3106;3107;3108;3109;3110;3111;3112;3113;3114;3115;3116;3117;3118;3119;3120;3121;3122;3123;3124;3125;3126;3127;3128;3129;3130;3131;3132;3133;3134;3135;3136;3137;3138;3139;3140;3141;3142;3143;3144;3145;3146;3147;3148;3149;3150;3151;3152;3153;3154;3155;3156;3157;3158;3159;3160;3161;3162;3163;3164;3165;3166;3167;3168	1622;1623;1624;1625;1626;1627;1628;1629;1630;1631;1632;1633;1634;1635;1636;1637;1638;1639;1640;1641;1642;1643;1644;1645;1646;1647;1648;1649;1650;1651;1652;1653;1654;1655;1656;1657;1658;1659;1660;1661;1662;1663;1664;1665;1666;1667;1668;1669;1670;1671;1672;1673;1674;1675;1676	1633		LGEHNIDVLEGNEQFINAAK	2	0	3	1	0	1	3	2	1	2	2	1	0	1	0	0	0	0	0	1	0	20	0	2210.0968	CON__P00761	CON__P00761			yes	yes	2,3	1.4256E-40	227.04	1	0	123	1	0	123	3	3	5	6	2	2	7	6	3	5	1	2	5	4	2	2	7	5	7	4	5	4				1	6	6	1	1	5	3	2	4	4	3	3	5	6	2	2	7	6	3	5	1	2	5	4	2	2	7	5	7	4	5	4				1	6	6	1	1	5	3	2	4	4	454270000	10987000	12169000	15726000	16543000	896890	1382100	21293000	21031000	13102000	12286000	339310	765080	6722500	7328500	11288000	11675000	20060000	19583000	82989000	34119000	15733000	14209000	0	0	0	89990	26278000	26619000	208280	437930	18095000	4444700	5597600	11094000	11176000		+
289	114	290	3169;3170;3171;3172;3173;3174;3175	1677;1678;1679;1680	1677		LGIYTVLFER	0	1	0	0	0	0	1	1	0	1	2	0	0	1	0	0	1	0	1	1	0	10	0	1209.6758	Q02978	Q02978	SLC20A4;SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11	yes	yes	2	0.013589	91.867	1	0	7	1	0	7	1	1	1	1											1						1	1														1	1	1	1											1						1	1														475270	69576	84798	41962	44304	0	0	0	0	0	0	0	0	0	0	38805	0	0	0	0	0	99472	96355	0	0	0	0	0	0	0	0	0	0	0	0	0		
290	178	291	3176	1681	1681		LGLQLGQGR	0	1	0	0	0	2	0	3	0	0	3	0	0	0	0	0	0	0	0	0	0	9	0	940.54541	Q9BYK8	Q9BYK8	KIAA1769;PRIC285	ATP-dependent helicase PRIC285;Peroxisomal proliferator-activated receptor A-interacting complex 285 kDa protein;PPAR-alpha-interacting complex protein 285;PPAR-gamma DNA-binding domain-interacting protein 1	yes	yes	2	0.031383	63.486	1	0	1	1	0	1																											1																																			1									0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
291	135	292	3177;3178;3179;3180;3181;3182;3183	1682;1683;1684;1685;1686	1686		LGPGGLDPVEVYESLPEELQK	0	0	0	1	0	1	4	3	0	0	4	1	0	0	3	1	0	0	1	2	0	21	0	2268.1525	Q16543	Q16543	CDC37;CDC37A	Hsp90 chaperone protein kinase-targeting subunit;Hsp90 co-chaperone Cdc37;p50Cdc37	yes	yes	3	2.3522E-06	110.22	1	0	7	1	0	7	1	2													1	1					1	1														1	2													1	1					1	1														3507100	1055800	1367800	0	0	0	0	0	0	0	0	0	0	0	0	179520	175310	0	0	0	0	377500	351190	0	0	0	0	0	0	0	0	0	0	0	0	0		
292	46	293	3184;3185;3186;3187;3188	1687;1688	1688		LHFFMPGFAPLTSR	1	1	0	0	0	0	0	1	1	0	2	0	1	3	2	1	1	0	0	0	0	14	0	1619.8283	P07437;P68371;P04350;Q13885;Q9BVA1;A6NNZ2;Q3ZCM7	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB8	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-8 chain B;Tubulin beta-8 chain	no	no	3	0.010656	94.767	1	0	5	NaN	NaN		1	1		1												1						1																																																	461460	215490	185740	0	16236	0	0	0	0	0	0	0	0	0	0	0	19796	0	0	0	0	0	24206	0	0	0	0	0	0	0	0	0	0	0	0	0		
293	101	294	3189;3190;3191;3192;3193;3194;3195;3196;3197	1689;1690;1691;1692;1693;1694	1691		LICCDILDVLDK	0	0	0	3	2	0	0	0	0	2	3	1	0	0	0	0	0	0	0	1	0	12	0	1475.7364	P62258	P62258	YWHAE	14-3-3 protein epsilon	yes	yes	2	0.0024425	112.13	1	0	9	1	0	9	1	1	1												1	1	1	1	1	1																1	1	1												1	1	1	1	1	1																865520	78067	74304	24471	0	0	0	0	0	0	0	0	0	0	0	116910	91298	106710	100840	137770	135140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
294	203	295	3198;3199;3200;3201;3202;3203;3204;3205;3206	1695;1696	1696		LIDLDPSVDTLK	0	0	0	3	0	0	0	0	0	1	3	1	0	0	1	1	1	0	0	1	0	12	0	1327.7235	REV__Q8WXH0	REV__Q8WXH0			yes	yes	2	0.03484	79.693	1	0	9	1	0	9	1	1							1	1					1	1					1	1									1					1	1							1	1					1	1					1	1									1					899780	38549	45310	0	0	0	0	0	0	42817	37892	0	0	0	0	63964	71747	0	0	0	0	180340	164610	0	0	0	0	0	0	0	0	254550	0	0	0	0	+	
295	51	296	3207;3208;3209;3210;3211	1697;1698;1699	1699		LIFAGK	1	0	0	0	0	0	0	1	0	1	1	1	0	1	0	0	0	0	0	0	0	6	0	647.40065	P0CG48;P0CG47;P62979;P62987	P0CG48	RPS27A;UBA80;UBCEP1;UBA52;UBCEP2	40S ribosomal protein S27a;60S ribosomal protein L40;CEP52	yes	no	1	0.033356	87.042	1	0	5	1	0	5	1	1	1	1											1																					1	1	1	1											1																					284450	49656	65506	56710	59417	0	0	0	0	0	0	0	0	0	0	53165	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
296	128	297	3212;3213;3214;3215;3216;3217;3218;3219;3220;3221;3222;3223;3224;3225;3226;3227	1700;1701;1702;1703;1704;1705	1702		LIGQQGLVDGLFLVR	0	1	0	1	0	2	0	3	0	1	4	0	0	1	0	0	0	0	0	2	0	15	0	1626.9457	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	2,3	0.0074636	124.3	1	0	16	1	0	16	1	1					2	1							1	1	1	1	2	2							1	1						1		1	1					2	1							1	1	1	1	2	2							1	1						1		1948200	52549	77188	0	0	0	0	287740	225050	0	0	0	0	0	0	52003	35272	86133	73785	528760	378610	0	0	0	0	0	0	74470	57034	0	0	0	0	0	19662	0		
297	84	298	3228;3229;3230;3231;3232;3233;3234;3235;3236;3237;3238;3239;3240;3241;3242;3243;3244;3245;3246	1706;1707;1708;1709;1710;1711;1712;1713	1708		LINLTDILK	0	0	1	1	0	0	0	0	0	2	3	1	0	0	0	0	1	0	0	0	0	9	0	1041.6434	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	4.1493E-05	135.83	1	0	19	1	0	19					1	1	1	1						1	1	1	1	2	1	1							1	1				1	1	1	2					1	1	1	1						1	1	1	1	2	1	1							1	1				1	1	1	2	17454000	0	0	0	0	186010	244000	363000	359850	0	0	0	0	0	35945	70397	67318	3031600	2960400	3022400	2199400	0	0	0	0	0	0	148610	123230	0	0	0	509940	548540	1863700	1719500		
298	122	299	3247;3248;3249;3250;3251	1714;1715;1716	1716		LINSSQLLYQEYSDVVLNK	0	0	2	1	0	2	1	0	0	1	4	1	0	0	0	3	0	0	2	2	0	19	0	2225.158	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2,3	2.6687E-24	202.03	1	0	5	1	0	5															2	2															1																			2	2															1					2514700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1317900	979920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	216840	0	0	0	0		
299	186	300	3252;3253;3254;3255;3256;3257;3258;3259;3260;3261;3262	1717	1717		LIPLGHASK	1	0	0	0	0	0	0	1	1	1	2	1	0	0	1	1	0	0	0	0	0	9	0	934.56	Q9UJM3	Q9UJM3	ERRFI1;MIG6	ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein	yes	yes	2	0.0096498	97.798	1	0	11	1	0	11	1	1	1	1									1	1		1					1		1							1	1					1	1	1	1									1	1		1					1		1							1	1					1406300	81355	62996	115080	110830	0	0	0	0	0	0	0	0	152760	195890	0	334510	0	0	0	0	42685	0	70873	0	0	0	0	0	0	95787	143490	0	0	0	0		
300	27	301	3263	1718	1718		LKETVYNLR	0	1	1	0	0	0	1	0	0	0	2	1	0	0	0	0	1	0	1	1	0	9	1	1134.6397	O00461	O00461	GIMPC;GOLIM4;GOLPH4;GPP130	Golgi integral membrane protein 4;Golgi integral membrane protein, cis;Golgi phosphoprotein 4;Golgi-localized phosphoprotein of 130 kDa	yes	yes	2	0.036292	67.563	1	0	1	1	0	1																1																																			1																				0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
301	16	302	3264;3265;3266;3267;3268;3269	1719;1720;1721	1721		LKYENEVALR	1	1	1	0	0	0	2	0	0	0	2	1	0	0	0	0	0	0	1	1	0	10	1	1233.6717	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	0.03234	82.417	1	0	6	1	0	6			1		1													1			1	1									1							1		1													1			1	1									1					387900	0	0	31072	0	49739	0	0	0	0	0	0	0	0	0	0	0	0	97025	0	0	54832	55085	0	0	0	0	0	0	0	0	100150	0	0	0	0		+
302	116	303	3270;3271;3272	1722;1723	1722		LLAEALNQVTQR	2	1	1	0	0	2	1	0	0	0	3	0	0	0	0	0	1	0	0	1	0	12	0	1354.7569	Q05655	Q05655	PRKCD	nPKC-delta;Protein kinase C delta type	yes	yes	2	8.5873E-07	166.14	1	0	3	1	0	3													1	1																1																		1	1																1						280230	0	0	0	0	0	0	0	0	0	0	0	0	125650	126140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28443	0	0	0	0	0		
303	91	304	3273;3274;3275;3276;3277;3278;3279;3280;3281;3282;3283;3284;3285;3286;3287;3288;3289;3290;3291;3292;3293;3294;3295	1724;1725;1726;1727;1728;1729;1730;1731	1724		LLDAVDTYIPVPAR	2	1	0	2	0	0	0	0	0	1	2	0	0	0	2	0	1	0	1	2	0	14	0	1541.8453	P49411	P49411	TUFM	Elongation factor Tu, mitochondrial;P43	yes	yes	2	0.011442	94.122	1	0	23	1	0	23	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1		1	1					1	2			1			1	1	1	1	1	1	1	1	1	1					1	1	1	1	1	1	1		1	1					1	2			1			1	1	5060100	749110	817090	615870	569620	69932	76962	158830	185690	0	0	0	0	57051	86264	136080	136030	43212	39148	46455	0	451130	375010	0	0	0	0	107160	196200	0	0	70856	0	0	44909	27500		
304	0	305;306;307	3296;3297;3298;3299;3300;3301;3302;3303;3304;3305;3306;3307;3308;3309;3310;3311;3312;3313;3314;3315;3316;3317;3318;3319;3320;3321;3322	1732;1733;1734	1734		LLEEMEKISVQATWMAYDMVVMR	2	1	0	1	0	1	3	0	0	1	2	1	4	0	0	1	1	1	1	3	0	23	1	2772.3359	A1L190	A1L190	C22orf41;THEG2	Testis highly expressed gene 2 protein;Uncharacterized protein C22orf41	yes	yes	3,4	0.049695	14.548	1	0	27	1	0	27	2	2	1	1		1	1	1					1	1	1		1			1	1	1					1	2			2	1	1	2	2	2	2	1	1		1	1	1					1	1	1		1			1	1	1					1	2			2	1	1	2	2	23416000	1630500	1453900	1676700	1602900	0	56134	263580	252890	0	0	0	0	280270	137880	1832000	0	3007800	0	0	60488	2011800	2007400	0	0	0	0	678760	416690	0	0	3494800	185800	253880	1133900	978100		
305	63	308	3323;3324;3325;3326	1735;1736	1735		LLELQEVDSLLR	0	1	0	1	0	1	2	0	0	0	5	0	0	0	0	1	0	0	0	1	0	12	0	1426.8031	P16144	P16144	ITGB4	GP150;Integrin beta-4	yes	yes	2	0.0023103	116.01	1	0	4	1	0	4	1	1													1						1															1	1													1						1															266940	106990	94008	0	0	0	0	0	0	0	0	0	0	0	0	21479	0	0	0	0	0	44461	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
306	163	309	3327;3328;3329;3330	1737	1737		LLEPFEVR	0	1	0	0	0	0	2	0	0	0	2	0	0	1	1	0	0	0	0	1	0	8	0	1001.5546	Q8WUY1	Q8WUY1	C8orf55;PSEC0098	Mesenchymal stem cell protein DSCD75;UPF0670 protein C8orf55	yes	yes	2	0.11451	80.18	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																210750	49180	49668	54381	57520	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
307	100	310	3331	1738	1738		LLEPVLLLGK	0	0	0	0	0	0	1	1	0	0	5	1	0	0	1	0	0	0	0	1	0	10	0	1093.7111	P62249	P62249	RPS16	40S ribosomal protein S16	yes	yes	2	4.5264E-07	90.629	1	0	1	1	0	1																1																																			1																				0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
308	36	311	3332;3333;3334;3335;3336;3337;3338;3339;3340;3341	1739;1740;1741;1742	1739		LLESLDQLELR	0	1	0	1	0	1	2	0	0	0	5	0	0	0	0	1	0	0	0	0	0	11	0	1327.7347	O95816	O95816	BAG2	BAG family molecular chaperone regulator 2;Bcl-2-associated athanogene 2	yes	yes	2	1.1683E-06	125.74	1	0	10	1	0	10	1	2	1	1				1													1	1					1	1								1	2	1	1				1													1	1					1	1								1585900	216990	552080	146860	124300	0	0	0	25387	0	0	0	0	0	0	0	0	0	0	0	0	250380	200720	0	0	0	0	30385	38784	0	0	0	0	0	0	0		
309	82	312	3342;3343;3344;3345	1743;1744;1745;1746	1743		LLGPGVNYSGCQITWAK	1	0	1	0	1	1	0	3	0	1	2	1	0	0	1	1	1	1	1	1	0	17	0	1862.9349	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	2	0.00079952	115.82	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																666080	241800	199330	119450	105500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
310	83	313	3346;3347;3348;3349;3350;3351	1747;1748;1749	1747		LLGPNASPDGLIPWTR	1	1	1	1	0	0	0	2	0	1	3	0	0	0	3	1	1	1	0	0	0	16	0	1705.9152	P42224	P42224	STAT1	Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84	yes	yes	2	8.2113E-08	167.89	1	0	6	1	0	6	1	1	1	1											1	1																				1	1	1	1											1	1																				655260	209060	230900	80522	54976	0	0	0	0	0	0	0	0	0	0	47048	32747	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
311	131	314	3352;3353;3354;3355;3356;3357;3358;3359;3360;3361;3362;3363;3364	1750;1751;1752;1753;1754;1755;1756;1757;1758;1759;1760	1756		LLIGTLYHR	0	1	0	0	0	0	0	1	1	1	3	0	0	0	0	0	1	0	1	0	0	9	0	1084.6393	Q15165	Q15165	PON2	Aromatic esterase 2;Serum aryldialkylphosphatase 2;Serum paraoxonase/arylesterase 2	yes	yes	2	2.0484E-05	141.39	1	0	13	1	0	13	1	1	1	1	1	1	1	1								1					1	1					1	1								1	1	1	1	1	1	1	1								1					1	1					1	1								3179500	552370	526750	624810	637940	84011	108420	105940	139960	0	0	0	0	0	0	0	0	0	0	0	0	151030	156730	0	0	0	0	47874	43707	0	0	0	0	0	0	0		
312	99	315	3365;3366;3367;3368;3369;3370	1761;1762	1761		LLIHQSLAGGIIGVK	1	0	0	0	0	1	0	3	1	3	3	1	0	0	0	1	0	0	0	1	0	15	0	1517.9293	P61978	P61978	HNRNPK;HNRPK	Heterogeneous nuclear ribonucleoprotein K;Transformation up-regulated nuclear protein	yes	yes	3	0.0089735	101.32	1	0	6	1	0	6		1													1	1			1	1											1						1													1	1			1	1											1					395650	0	27353	0	0	0	0	0	0	0	0	0	0	0	0	114320	109150	0	0	53753	38404	0	0	0	0	0	0	0	0	0	0	52671	0	0	0	0		
313	20	316	3371;3372;3373;3374	1763	1763		LLIWQISNR	0	1	1	0	0	1	0	0	0	2	2	0	0	0	0	1	0	1	0	0	0	9	0	1141.6608	CON__Q05B55	CON__Q05B55			yes	yes	2	0.081588	75.38	1	0	4	1	0	4		1				1	1															1															1				1	1															1														232530	0	112050	0	0	0	28613	58140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33726	0	0	0	0	0	0	0	0	0	0	0	0	0		+
314	175	317	3375;3376;3377;3378;3379;3380	1764;1765;1766;1767;1768	1764		LLLGAGAVAYGVR	3	1	0	0	0	0	0	3	0	0	3	0	0	0	0	0	0	0	1	2	0	13	0	1258.7398	Q99623	Q99623	BAP;PHB2;REA	B-cell receptor-associated protein BAP37;D-prohibitin;Prohibitin-2;Repressor of estrogen receptor activity	yes	yes	2	0.0044979	128.01	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														413550	99174	105330	73438	83809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24762	27032	0	0	0	0	0	0	0	0	0	0	0	0	0		
315	4	318	3381;3382;3383;3384	1769	1769		LLLLGAGESGK	1	0	0	0	0	0	1	3	0	0	4	1	0	0	0	1	0	0	0	0	0	11	0	1056.6179	Q5JWF2;P63092;P38405;P04899;A8MTJ3;P08754;P09471;P19087;P63096;P11488	Q5JWF2	GNAS;GNAS1;GNAS;GNAS1;GSP;GNAL;GNAI2;GNAI2B;GNAT3;GNAI3;GNAO1;GNAT2;GNATC;GNAI1;GNAT1;GNATR	Adenylate cyclase-stimulating G alpha protein;Extra large alphas protein;Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas;Guanine nucleotide-binding protein G(s) subunit alpha isoforms short;Adenylate cyclase-stimulating G alpha protein, olfactory type;Guanine nucleotide-binding protein G(olf) subunit alpha;Adenylate cyclase-inhibiting G alpha protein;Guanine nucleotide-binding protein G(i) subunit alpha-2;Guanine nucleotide-binding protein G(t) subunit alpha-3;Gustducin alpha-3 chain;G(i) alpha-3;Guanine nucleotide-binding protein G(k) subunit alpha;Guanine nucleotide-binding protein G(o) subunit alpha;Guanine nucleotide-binding protein G(t) subunit alpha-2;Transducin alpha-2 chain;Guanine nucleotide-binding protein G(i) subunit alpha-1;Guanine nucleotide-binding protein G(t) subunit alpha-1;Transducin alpha-1 chain	yes	no	2	0.0061243	98.048	1	0	4	1	0	4		1	1	1																	1																1	1	1																	1															186280	0	56368	48370	56002	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25541	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
316	122	319	3385;3386;3387;3388;3389	1770;1771;1772	1772		LLLQNILK	0	0	1	0	0	1	0	0	0	1	4	1	0	0	0	0	0	0	0	0	0	8	0	953.62735	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	1.655E-167	150.84	1	0	5	1	0	5													1	1	1	1															1																	1	1	1	1															1					503380	0	0	0	0	0	0	0	0	0	0	0	0	104820	102620	0	222940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73012	0	0	0	0		
317	43;58	320	3390;3391;3392;3393;3394;3395;3396;3397;3398;3399;3400	1773;1774;1775;1776;1777;1778;1779	1776		LLLQVQHASK	1	0	0	0	0	2	0	0	1	0	3	1	0	0	0	1	0	0	0	1	0	10	0	1135.6713	P05141;P12235;P12236	P05141	ANT2;SLC25A5;ANT1;SLC25A4;ANT3;CDABP0051;SLC25A6	Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6	no	no	2	0.0029597	107.15	1	0	11	NaN	NaN		1	1	1	1		1								1	1						1	1	1	1																																															918630	147720	112760	136470	185180	0	34480	0	0	0	0	0	0	0	32789	45321	0	0	0	0	0	52171	49458	52570	69702	0	0	0	0	0	0	0	0	0	0	0		
318	55;64	321	3401;3402;3403;3404;3405;3406;3407;3408;3409	1780;1781;1782;1783;1784	1784		LLQDFFNGK	0	0	1	1	0	1	0	1	0	0	2	1	0	2	0	0	0	0	0	0	0	9	0	1080.5604	P11142;P54652;P17066	P11142	HSC70;HSP73;HSPA10;HSPA8;HSPA2;HSP70B;HSPA6	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B	no	no	2	0.0010074	124.23	1	0	9	NaN	NaN		1	1	1	1	1	1															1	1													1																																				790470	168610	183680	91723	103330	59051	50352	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59517	60046	0	0	0	0	0	0	0	0	0	0	0	0	14157		
319	26	322	3410;3411;3412;3413;3414;3415;3416;3417;3418;3419;3420;3421;3422;3423;3424;3425;3426;3427;3428;3429;3430;3431;3432;3433;3434;3435;3436;3437;3438;3439;3440;3441;3442;3443	1785;1786;1787;1788;1789;1790;1791;1792;1793;1794;1795;1796;1797;1798	1787		LLQEHLEEQEVAPPALPPKPPK	2	0	0	0	0	2	4	0	1	0	4	2	0	0	6	0	0	0	0	1	0	22	1	2459.3424	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3,4	2.2378E-07	127.59	1	0	34	1	0	34																	6	5	5	5												2	2	4	5																	6	5	5	5												2	2	4	5	6763700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1049200	1064700	1213700	1266900	0	0	0	0	0	0	0	0	0	0	0	268430	310180	786260	804240		
320	82	323	3444;3445;3446;3447;3448	1799;1800;1801;1802	1799		LLQTAATAAQQGGQANHPTAAVVTEK	7	0	1	0	0	4	1	2	1	0	2	1	0	0	1	0	4	0	0	2	0	26	0	2575.3354	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	3	9.9688E-11	121.46	1	0	5	1	0	5	1	1	1	1												1																				1	1	1	1												1																				1705800	611060	552260	228640	242720	0	0	0	0	0	0	0	0	0	0	0	71149	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
321	40	324	3449;3450;3451;3452;3453;3454;3455;3456;3457;3458;3459;3460;3461;3462;3463;3464;3465;3466;3467;3468;3469;3470;3471;3472;3473;3474;3475;3476;3477;3478;3479;3480;3481;3482;3483;3484;3485;3486;3487;3488;3489	1803;1804;1805;1806;1807;1808;1809;1810;1811;1812;1813;1814;1815	1813		LLRDYQELMNTK	0	1	1	1	0	1	1	0	0	0	3	1	1	0	0	0	1	0	1	0	0	12	1	1522.7814	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	no	no	2,3	0.0038813	106.67	1	0	41	NaN	NaN			1	2	1	2	2	1	1	2	2	1	2	2	2	2	2	2	2			2	2									2	1	1	2	2																																				3410200	0	26097	92033	54561	123450	109210	29672	41040	101190	117510	49413	108740	114250	150010	160390	140340	135960	149070	0	0	189040	267810	0	0	0	0	0	0	0	0	443860	44522	37807	339410	384810		+
322	40	325	3490;3491;3492;3493;3494;3495;3496;3497;3498;3499;3500	1816;1817;1818;1819	1818		LNDLEDALQQAKEDLAR	3	1	1	3	0	2	2	0	0	0	4	1	0	0	0	0	0	0	0	0	0	17	1	1940.9803	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	3	0.00088448	111.12	1	0	11	1	0	11		1							1	1					1	1		1	1	1	1	1									1						1							1	1					1	1		1	1	1	1	1									1					1553100	0	36633	0	0	0	0	0	0	65661	82857	0	0	0	0	149270	190960	0	33446	85826	56832	264660	254290	0	0	0	0	0	0	0	0	332670	0	0	0	0		+
323	87	326	3501;3502;3503;3504;3505;3506	1820	1820		LNLVEAFVEDAELR	2	1	1	1	0	0	3	0	0	0	3	0	0	1	0	0	0	0	0	2	0	14	0	1616.841	P43246	P43246	MSH2	DNA mismatch repair protein Msh2;MutS protein homolog 2	yes	yes	3	0.0067867	131.17	1	0	6	1	0	6	1	1											1				1		1			1														1	1											1				1		1			1														328440	76663	90966	0	0	0	0	0	0	0	0	0	0	30521	0	0	0	39555	0	28347	0	0	62391	0	0	0	0	0	0	0	0	0	0	0	0	0		
324	122	327	3507;3508	1821	1821		LNTRPVHLHLFNDCLLLSR	0	2	2	1	1	0	0	0	2	0	6	0	0	1	1	1	1	0	0	1	0	19	1	2317.2477	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	4	0.040173	69.729	1	0	2	1	0	2															1	1																																		1	1																				269220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	138670	130540	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
325	167	328	3509;3510;3511	1822;1823	1822		LNVWLGIK	0	0	1	0	0	0	0	1	0	1	2	1	0	0	0	0	0	1	0	1	0	8	0	941.56984	Q92569	Q92569	PIK3R3	p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma	yes	yes	2	0.040156	71.342	1	0	3	1	0	3					1	1		1																																1	1		1																												146280	0	0	0	0	74906	71375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
326	158	329	3512;3513;3514	1824;1825	1825		LPADTCLLEFAR	2	1	0	1	1	0	1	0	0	0	3	0	0	1	1	0	1	0	0	0	0	12	0	1404.7071	Q8NF37	Q8NF37	AYTL2;LPCAT1;PFAAP3	1-acylglycerophosphocholine O-acyltransferase;1-alkylglycerophosphocholine O-acetyltransferase;Acetyl-CoA:lyso-platelet-activating factor acetyltransferase;Acyltransferase-like 2;Lysophosphatidylcholine acyltransferase 1;Phosphonoformate immuno-associated protein 3	yes	yes	2	0.0020349	124.1	1	0	3	1	0	3			1	1				1																														1	1				1																												404110	0	0	183300	189890	0	0	0	30924	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
327	38;41	330	3515	1826	1826		LPQPPICTIDVYMIMVK	0	0	0	1	1	1	0	0	0	3	1	1	2	0	3	0	1	0	1	2	0	17	0	2017.045	P00533;P04626	P00533	EGFR;ERBB1;ERBB2;HER2;MLN19;NEU;NGL	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1;Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2	no	no	3	0.00045462	65.092	1	0	1	NaN	NaN			1																																																																					0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
328	86	331	3516;3517;3518;3519;3520	1827;1828	1827		LQDAINILK	1	0	1	1	0	1	0	0	0	2	2	1	0	0	0	0	0	0	0	0	0	9	0	1026.6073	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2	0.0018321	119.75	1	0	5	1	0	5	1	1	1	1																	1															1	1	1	1																	1															372220	118020	119650	59437	45095	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30026	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
329	86	332	3521;3522;3523;3524	1829;1830	1830		LQWFCDR	0	1	0	1	1	1	0	0	0	0	1	0	0	1	0	0	0	1	0	0	0	7	0	1023.4596	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2	0.091719	80.18	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																264520	68824	56994	66018	72684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
330	26	333	3525;3526;3527;3528;3529;3530;3531;3532;3533;3534;3535;3536;3537;3538;3539;3540;3541	1831;1832;1833;1834;1835;1836;1837;1838;1839;1840	1839		LRDTPDGTFLVR	0	2	0	2	0	0	0	1	0	0	2	0	0	1	1	0	2	0	0	1	0	12	1	1388.7412	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	0.0073306	94.465	1	0	17	1	0	17								1									2	2	2	2												2	2	2	2								1									2	2	2	2												2	2	2	2	6837400	0	0	0	0	0	0	0	15682	0	0	0	0	0	0	0	0	869940	786580	1460300	1470900	0	0	0	0	0	0	0	0	0	0	0	408330	387230	743560	694850		
331	149	334	3542;3543	1841	1841		LSGWGNVSK	0	0	1	0	0	0	0	2	0	0	1	1	0	0	0	2	0	1	0	1	0	9	0	946.48723	Q6Y7W6	Q6Y7W6	GIGYF2;KIAA0642;PERQ2;TNRC15	GRB10-interacting GYF protein 2;PERQ amino acid-rich with GYF domain-containing protein 2;Trinucleotide repeat-containing gene 15 protein	yes	yes	2	0.054113	80.438	1	0	2	1	0	2			1	1																																		1	1																																177300	0	0	85359	91942	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
332	92	335	3544;3545;3546;3547	1842	1842		LSHAVGCAFAACLER	4	1	0	0	2	0	1	1	1	0	2	0	0	1	0	1	0	0	0	1	0	15	0	1660.7814	P49757;Q9Y6R0	P49757	NUMB;NUMBL	Protein numb homolog;Protein S171;Numb-like protein;Numb-related protein	yes	no	3	0.0089691	100.38	1	0	4	1	0	4	1													1	1	1																				1													1	1	1																				203940	39219	0	0	0	0	0	0	0	0	0	0	0	0	31970	64810	67937	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
333	80	336	3548;3549;3550;3551	1843;1844;1845	1843		LSLEEFIR	0	1	0	0	0	0	2	0	0	1	2	0	0	1	0	1	0	0	0	0	0	8	0	1005.5495	P37235;P61601;P84074	P37235	BDR1;HPCAL1;NCALD;BDR2;HPCA	Calcium-binding protein BDR-1;Hippocalcin-like protein 1;HLP2;Visinin-like protein 3;Neurocalcin-delta;Calcium-binding protein BDR-2;Neuron-specific calcium-binding protein hippocalcin	yes	no	2	0.020557	109.86	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																173320	44810	52013	36886	39606	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
334	139	337	3552;3553;3554;3555;3556;3557;3558	1846;1847	1846		LSLFPASPR	1	1	0	0	0	0	0	0	0	0	2	0	0	1	2	2	0	0	0	0	0	9	0	986.55492	Q53GA4	Q53GA4	BWR1C;HLDA2;IPL;PHLDA2;TSSC3	Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein;Imprinted in placenta and liver protein;p17-Beckwith-Wiedemann region 1 C;Pleckstrin homology-like domain family A member 2;Tumor-suppressing STF cDNA 3 protein;Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein	yes	yes	2	0.011637	94.302	1	0	7	1	0	7		1	1	1	1	1	1	1																													1	1	1	1	1	1	1																												493530	0	48849	56537	49486	96737	75300	73938	92679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
335	94	338	3559;3560	1848;1849	1849		LSLHSIAQNK	1	0	1	0	0	1	0	0	1	1	2	1	0	0	0	2	0	0	0	0	0	10	0	1109.6193	P52735	P52735	VAV2	Guanine nucleotide exchange factor VAV2	yes	yes	2	7.6681E-07	89.08	1	0	2	1	0	2			1	1																																		1	1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
336	142	339	3561;3562;3563;3564;3565	1850	1850		LSSLPR	0	1	0	0	0	0	0	0	0	0	2	0	0	0	1	2	0	0	0	0	0	6	0	671.39662	Q63ZY3	Q63ZY3	ANKRD25;KANK2;KIAA1518;MXRA3;SIP	Ankyrin repeat domain-containing protein 25;KN motif and ankyrin repeat domain-containing protein 2;Matrix-remodeling-associated protein 3;SRC-1-interacting protein	yes	yes	1	0.047624	74.417	1	0	5	1	0	5														1				1				1			1				1																				1				1				1			1				1							918800	0	0	0	0	0	0	0	0	0	0	0	0	0	208320	0	0	0	101970	0	0	0	305430	0	0	142360	0	0	0	160720	0	0	0	0	0	0		
337	7	340	3566;3567;3568;3569;3570;3571;3572;3573;3574;3575;3576;3577;3578;3579;3580;3581;3582;3583;3584;3585;3586;3587;3588;3589;3590;3591;3592;3593;3594;3595;3596;3597	1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861;1862;1863;1864;1865;1866;1867;1868;1869;1870;1871	1868		LSSPATLNSR	1	1	1	0	0	0	0	0	0	0	2	0	0	0	1	3	1	0	0	0	0	10	0	1044.5564	CON__P00761	CON__P00761			yes	yes	2	0.00013351	127.4	1	0	32	1	0	32	2	2	1	1	1	1	2	1		1			1	1	1	1	1	1	1	2	2		1				1			1	1	1		2	2	2	2	1	1	1	1	2	1		1			1	1	1	1	1	1	1	2	2		1				1			1	1	1		2	2	45480000	2517200	2450100	1352600	1474200	1725400	1459200	3140700	1655100	0	1266200	0	0	1186000	1245300	807540	811640	1472600	1578400	1950500	3466700	2805200	0	1049000	0	0	0	1596400	0	0	1150700	1451400	1261900	0	3294000	3312300		+
338	66	341	3598;3599;3600;3601;3602;3603;3604;3605;3606;3607;3608;3609;3610;3611;3612;3613;3614;3615;3616;3617;3618;3619	1872;1873;1874;1875;1876;1877;1878;1879;1880;1881;1882;1883;1884	1875		LTFQLEPNPHTK	0	0	1	0	0	1	1	0	1	0	2	1	0	1	2	0	2	0	0	0	0	12	0	1423.746	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2,3	0.002392	113.61	1	0	22	1	0	22					2	2	2	2									2	2	2	2						1	2	1					1	1						2	2	2	2									2	2	2	2						1	2	1					1	1		3936000	0	0	0	0	556590	495390	743520	754500	0	0	0	0	0	0	0	0	112560	138800	206460	191770	0	0	0	0	0	83178	443000	109490	0	0	0	0	40616	60084	0		
339	49	342	3620;3621;3622	1885	1885		LTICGWDFGFR	0	1	0	1	1	0	0	2	0	1	1	0	0	2	0	0	1	1	0	0	0	11	0	1370.6441	P08581	P08581	MET	Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met	yes	yes	2	0.027542	82.261	1	0	3	1	0	3																					1	1									1																									1	1									1					187970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	78971	55730	0	0	0	0	0	0	0	0	53272	0	0	0	0		
340	146	343	3623	1886	1886		LTKPQPFKDFLCISLR	0	1	0	1	1	1	0	0	0	1	3	2	0	2	2	1	1	0	0	0	0	16	2	1962.0761	Q6PIJ6	Q6PIJ6	FBXO38;SP329	F-box only protein 38;Modulator of KLF7 activity homolog	yes	yes	3	0.02686	51.546	1	0	1	1	0	1		1																																			1																																		37538	0	37538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
341	38	344	3624;3625;3626;3627;3628;3629;3630;3631;3632;3633;3634;3635;3636;3637;3638;3639;3640;3641;3642;3643;3644;3645;3646;3647;3648;3649;3650;3651;3652;3653;3654;3655;3656;3657;3658;3659;3660;3661;3662;3663;3664;3665;3666;3667;3668;3669;3670;3671;3672;3673;3674;3675;3676;3677;3678;3679;3680;3681;3682;3683;3684;3685;3686;3687;3688;3689;3690;3691;3692;3693;3694;3695;3696;3697;3698;3699;3700;3701;3702;3703;3704;3705;3706;3707;3708;3709;3710;3711;3712;3713;3714;3715;3716;3717;3718;3719;3720	1887;1888;1889;1890;1891;1892;1893;1894;1895;1896;1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914;1915;1916;1917;1918;1919;1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930;1931;1932;1933;1934;1935;1936;1937;1938;1939;1940	1892		LTQLGTFEDHFLSLQR	0	1	0	1	0	2	1	1	1	0	4	0	0	2	0	1	2	0	0	0	0	16	0	1903.9792	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	9.0897E-41	248.23	1	0	97	1	0	97	11	9	10	11			1	2					2	3	8	9	2	3	2	1	10	7					1	1		1	3					11	9	10	11			1	2					2	3	8	9	2	3	2	1	10	7					1	1		1	3					333120000	88423000	8952400	23575000	23813000	0	0	386020	410130	0	0	0	0	557670	634790	37202000	36058000	802490	741430	316570	148400	52806000	49515000	0	0	0	0	319810	322320	0	61071	8077700	0	0	0	0		
342	10	345	3721;3722	1941;1942	1942		LVAASQAALGL	4	0	0	0	0	1	0	1	0	0	3	0	0	0	0	1	0	0	0	1	0	11	0	1012.5917	CON__P02768-1;P02768	CON__P02768-1	ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341;ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341	Serum albumin	yes	no	2	0.026326	83	1	0	2	1	0	2											1	1																																		1	1																								160000	0	0	0	0	0	0	0	0	0	0	83858	76138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
343	132	346	3723;3724;3725;3726;3727;3728;3729;3730;3731;3732;3733	1943	1943		LVALLNTLDR	1	1	1	1	0	0	0	0	0	0	4	0	0	0	0	0	1	0	0	1	0	10	0	1126.671	Q15257	Q15257	PPP2R4;PTPA	Phosphotyrosyl phosphatase activator;PP2A, subunit B, PR53 isoform;Serine/threonine-protein phosphatase 2A activator;Serine/threonine-protein phosphatase 2A regulatory subunit 4;Serine/threonine-protein phosphatase 2A regulatory subunit B	yes	yes	2	0.0099291	93.649	1	0	11	1	0	11	1	1	1	1										1	1	1					1	1	1	1												1	1	1	1										1	1	1					1	1	1	1												2143700	515440	476250	262630	286250	0	0	0	0	0	0	0	0	0	44232	111230	101900	0	0	0	0	155280	138780	27675	24069	0	0	0	0	0	0	0	0	0	0	0		
344	169	347	3734;3735;3736;3737;3738;3739	1944;1945;1946;1947;1948	1944		LVDYLEGIR	0	1	0	1	0	0	1	1	0	1	2	0	0	0	0	0	0	0	1	1	0	9	0	1076.5866	Q96BR5	Q96BR5	C1orf163	Hcp beta-lactamase-like protein C1orf163	yes	yes	2	4.7669E-12	147.51	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														388230	102730	98443	66559	72841	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47664	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
345	35	348	3740;3741;3742;3743;3744;3745;3746;3747;3748;3749;3750	1949;1950;1951;1952	1951		LVECLETVLNK	0	0	1	0	1	0	2	0	0	0	3	1	0	0	0	0	1	0	0	2	0	11	0	1316.701	O95782	O95782	ADTAA;AP2A1;CLAPA1	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit	yes	yes	2	6.0904E-05	155.11	1	0	11	1	0	11	1	1	1	2									1	1	1	1						1									1					1	1	1	2									1	1	1	1						1									1					989000	117620	171790	73290	123660	0	0	0	0	0	0	0	0	105320	113790	110870	93691	0	0	0	0	0	38993	0	0	0	0	0	0	0	0	39970	0	0	0	0		
346	11	349	3751;3752;3753;3754;3755;3756	1953	1953		LVNELTEFAK	1	0	1	0	0	0	2	0	0	0	2	1	0	1	0	0	1	0	0	1	0	10	0	1162.6234	CON__P02769	CON__P02769			yes	yes	2	0.044667	76.943	1	0	6	1	0	6											1						1	1				1												1	1											1						1	1				1												1	1	285340	0	0	0	0	0	0	0	0	0	0	32103	0	0	0	0	0	38513	36646	0	0	0	26563	0	0	0	0	0	0	0	0	0	0	0	88146	63365		+
347	52	350	3757;3758;3759;3760;3761;3762	1954;1955	1954		LVNHFVEEFK	0	0	1	0	0	0	2	0	1	0	1	1	0	2	0	0	0	0	0	2	0	10	0	1260.6503	P0DMV8;P0DMV9	P0DMV8			yes	no	2	0.00094982	112.36	1	0	6	1	0	6	1	1	1	1																	1	1														1	1	1	1																	1	1														518310	137190	118020	98628	68421	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43066	52985	0	0	0	0	0	0	0	0	0	0	0	0	0		
348	52	351	3763;3764;3765;3766;3767;3768;3769;3770	1956;1957	1957		LVNHFVEEFKR	0	1	1	0	0	0	2	0	1	0	1	1	0	2	0	0	0	0	0	2	0	11	1	1416.7514	P0DMV8;P0DMV9	P0DMV8			yes	no	3	0.021992	94.297	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														703840	207790	204140	66259	89989	0	0	0	0	0	0	0	0	0	0	15207	23734	0	0	0	0	48978	47745	0	0	0	0	0	0	0	0	0	0	0	0	0		
349	118	352	3771;3772;3773;3774;3775;3776;3777;3778;3779	1958;1959;1960;1961;1962;1963;1964	1959		LVQAFQFTDK	1	0	0	1	0	2	0	0	0	0	1	1	0	2	0	0	1	0	0	1	0	10	0	1195.6237	Q06830	Q06830	PAGA;PAGB;PRDX1;TDPX2	Natural killer cell-enhancing factor A;Peroxiredoxin-1;Proliferation-associated gene protein;Thioredoxin peroxidase 2;Thioredoxin-dependent peroxide reductase 2	yes	yes	2	2.1021E-05	136.63	1	0	9	1	0	9	1	1	1	1	1								1	1	1	1																				1	1	1	1	1								1	1	1	1																				930540	184660	196230	117330	107620	36904	0	0	0	0	0	0	0	39337	55947	71561	120960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
350	61	353	3780;3781;3782;3783;3784;3785	1965	1965		LVQNCLWTLR	0	1	1	0	1	1	0	0	0	0	3	0	0	0	0	0	1	1	0	1	0	10	0	1301.6914	P14923;P35222	P14923	CTNNG;DP3;JUP;CTNNB;CTNNB1;OK/SW-cl.35;PRO2286	Catenin gamma;Desmoplakin III;Desmoplakin-3;Junction plakoglobin;Beta-catenin;Catenin beta-1	yes	no	2	0.13925	65.347	1	0	6	1	0	6	1	1															1	1			1													1		1	1															1	1			1													1		213080	59306	56139	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22607	19907	0	0	31915	0	0	0	0	0	0	0	0	0	0	0	0	23210	0		
351	200	354	3786;3787;3788;3789;3790;3791;3792;3793;3794;3795;3796;3797;3798;3799;3800;3801;3802;3803;3804;3805;3806;3807;3808;3809;3810;3811;3812;3813;3814;3815;3816;3817;3818;3819;3820;3821	1966;1967;1968;1969;1970;1971;1972;1973;1974	1966		LWDNGTISNPELLR	0	1	2	1	0	0	1	1	0	1	3	0	0	0	1	1	1	1	0	0	0	14	0	1626.8366	REV__Q8IV45	REV__Q8IV45			yes	yes	3	0.0078122	127.17	1	0	36	1	0	36	3	3	2	3				1					2	2	2	3	1	1	2	2	3	3						1			2					3	3	2	3				1					2	2	2	3	1	1	2	2	3	3						1			2					50007000	11779000	11040000	2630400	2839000	0	0	0	59273	0	0	0	0	68256	343490	3634000	2842000	123890	111850	492690	332900	7065200	6112300	0	0	0	0	0	56714	0	0	475200	0	0	0	0	+	
352	152	355	3822	1975	1975		LWQYLLSR	0	1	0	0	0	1	0	0	0	0	3	0	0	0	0	1	0	1	1	0	0	8	0	1077.5971	Q86VU5	Q86VU5	COMTD1;UNQ766/PRO1558	Catechol O-methyltransferase domain-containing protein 1	yes	yes	2	7.591E-06	94.302	1	0	1	1	0	1		1																																			1																																		0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
353	179	356;357	3823;3824;3825;3826;3827;3828;3829;3830;3831;3832;3833;3834;3835;3836;3837;3838;3839;3840;3841;3842;3843;3844;3845;3846;3847;3848;3849;3850;3851;3852;3853;3854;3855;3856;3857;3858;3859;3860;3861;3862;3863;3864;3865;3866;3867	1976;1977;1978;1979	1978		MAATLLMAGSQAPVTFEDMAMYLTR	5	1	0	1	0	1	1	1	0	0	3	0	4	1	1	1	3	0	1	1	0	25	0	2718.2889	Q9C0F3	Q9C0F3	KIAA1710;ZNF436	Zinc finger protein 436	yes	yes	4	0.049374	14.944	1	0	45	1	0	45	3	1	3	2			4	4	1	1			1	1	1	1	1		2	3	1	2					4	4						3	2	3	1	3	2			4	4	1	1			1	1	1	1	1		2	3	1	2					4	4						3	2	13253000	346430	224520	1276500	1686800	0	0	907320	962550	101080	50301	0	0	154820	304320	168560	99873	145850	0	355100	522060	98492	396310	0	0	0	0	1751300	1178900	0	0	0	0	0	1278800	1243100		
354	143	358	3868;3869;3870;3871;3872	1980	1980		MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMR	7	2	0	1	0	1	2	4	1	0	1	0	2	1	7	1	2	0	1	1	0	34	1	3446.65	Q69YG0	Q69YG0	TMEM42	Transmembrane protein 42	yes	yes	4	0.090116	13.39	1	0	5	1	0	5									1	1									1	1											1													1	1									1	1											1					1814100	0	0	0	0	0	0	0	0	385000	302170	0	0	0	0	0	0	0	0	542760	410360	0	0	0	0	0	0	0	0	0	0	173840	0	0	0	0		
355	34	359	3873	1981	1981		MCGIFAYMNYRVPR	1	2	1	0	1	0	0	1	0	1	0	0	2	1	1	0	0	0	2	1	0	14	1	1776.8262	O94808	O94808	GFPT2	D-fructose-6-phosphate amidotransferase 2;Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2;Glutamine:fructose 6 phosphate amidotransferase 2;Hexosephosphate aminotransferase 2	yes	yes	2	0.059488	26.627	1	0	1	1	0	1		1																																			1																																		3287700	0	3287700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
356	115	360	3874	1982	1982		MDQMMPGK	0	0	0	1	0	1	0	1	0	0	0	1	3	0	1	0	0	0	0	0	0	8	0	936.38673	Q03989	Q03989	ARID5A;MRF1	AT-rich interactive domain-containing protein 5A;Modulator recognition factor 1	yes	yes	2	0.089489	9.2141	1	0	1	1	0	1																							1																																			1													0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
357	160	361	3875	1983	1983		MEAAAVTVTR	3	1	0	0	0	0	1	0	0	0	0	0	1	0	0	0	2	0	0	2	0	10	0	1047.5383	Q8NFI3	Q8NFI3	ENGASE	Cytosolic endo-beta-N-acetylglucosaminidase	yes	yes	2	0.054741	45.161	1	0	1	1	0	1				1																																			1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
358	72	362	3876;3877	1984;1985	1985	8;9	MGCKVLLNIGQQMLRR	0	2	1	0	1	2	0	2	0	1	3	1	2	0	0	0	0	0	0	1	0	16	2	1916.027	P30825	P30825	ATRC1;ERR;REC1L;SLC7A1	Ecotropic retroviral leukemia receptor homolog;Ecotropic retrovirus receptor homolog;High affinity cationic amino acid transporter 1;Solute carrier family 7 member 1;System Y+ basic amino acid transporter	yes	yes	3	0.031137	23.831	1	0	2	1	0	2				1																		1																	1																		1														605950	0	0	0	527120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	78830	0	0	0	0	0	0	0	0	0	0	0	0	0		
359	185	363	3878	1986	1986		MGCTPTMR	0	1	0	0	1	0	0	1	0	0	0	0	2	0	1	0	2	0	0	0	0	8	0	952.39288	Q9NU02	Q9NU02	ANKRD5	Ankyrin repeat domain-containing protein 5	yes	yes	2	0.082907	13.053	1	0	1	1	0	1																											1																																			1									0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
360	38	364;365	3879;3880;3881;3882;3883;3884;3885;3886;3887	1987;1988	1987	6	MHLPSPTDSNFYR	0	1	1	1	0	0	0	0	1	0	1	0	1	1	2	2	1	0	1	0	0	13	0	1563.714	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.015289	83.397	1	0	9	1	0	9	1	1	1	2									1			1					1	1														1	1	1	2									1			1					1	1														1031800	195150	182120	208140	202850	0	0	0	0	0	0	0	0	36220	0	0	30100	0	0	0	0	80204	97019	0	0	0	0	0	0	0	0	0	0	0	0	0		
361	207	366	3888;3889;3890;3891;3892;3893;3894	1989	1989		MIGNTLYQFGDYKLTTIRSMSGDVMQEVLLQLQEETMSMHR	0	2	1	2	0	4	3	3	1	2	5	1	5	1	0	3	4	0	2	2	0	41	2	4793.2995	REV__Q9UBF8	REV__Q9UBF8			yes	yes	4	0.088848	2.3391	1	0	7	1	0	7	1	1													1	1					1	1									1					1	1													1	1					1	1									1					5515500	806590	658330	0	0	0	0	0	0	0	0	0	0	0	0	914260	901820	0	0	0	0	699620	756570	0	0	0	0	0	0	0	0	778310	0	0	0	0	+	
362	176	367	3895	1990	1990	13;14;15;16	MPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQR	3	2	0	0	0	4	1	6	1	0	3	0	4	0	10	4	0	0	0	0	0	38	1	3845.8586	Q9BWG4	Q9BWG4	SSBP4	Single-stranded DNA-binding protein 4	yes	yes	4	0.037921	12.073	1	0	1	1	0	1		1																																			1																																		90373	0	90373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
363	189	368	3896;3897;3898;3899;3900;3901;3902;3903;3904;3905;3906;3907;3908;3909;3910;3911;3912;3913;3914;3915;3916;3917;3918;3919;3920;3921;3922;3923;3924;3925;3926;3927;3928;3929;3930	1991;1992;1993;1994;1995	1993		MSKATEVMMQYVENLK	1	0	1	0	0	1	2	0	0	0	1	2	3	0	0	1	1	0	1	2	0	16	1	1900.9097	Q9Y6F6	Q9Y6F6	IRAG;JAW1L;MRVI1	Inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate;JAW1-related protein MRVI1;Protein MRVI1	yes	yes	2	0.099464	46.926	1	0	35	1	0	35	2	2	2	2			1	1	2	2			2	2	2	2	1		1	2	2	2							1		1	1	2			2	2	2	2			1	1	2	2			2	2	2	2	1		1	2	2	2							1		1	1	2			3488000	185360	108480	551280	598320	0	0	39390	47284	106750	60682	0	0	113000	140270	272810	332000	46807	0	60740	91764	111250	112640	0	0	0	0	0	0	21337	0	40736	169670	277370	0	0		
364	55	369	3931;3932;3933	1996	1996		MVNHFIAEFK	1	0	1	0	0	0	1	0	1	1	0	1	1	2	0	0	0	0	0	1	0	10	0	1234.6169	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	2	0.019379	89.047	1	0	3	1	0	3	1	1		1																																1	1		1																																165720	66585	57237	0	41893	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
365	54	370	3934;3935;3936;3937;3938;3939	1997;1998;1999;2000	1998		NELESYAYSLK	1	0	1	0	0	0	2	0	0	0	2	1	0	0	0	2	0	0	2	0	0	11	0	1315.6296	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	1.8135E-06	164.04	1	0	6	1	0	6	1	1	1	1		1															1															1	1	1	1		1															1															597720	127390	89492	129680	124920	0	36429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	89812	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
366	166	371	3940;3941;3942	2001	2001		NFGASLLLPGLK	1	0	1	0	0	0	0	2	0	0	4	1	0	1	1	1	0	0	0	0	0	12	0	1228.718	Q92552	Q92552	KIAA0264;MRPS27	28S ribosomal protein S27, mitochondrial	yes	yes	2	0.039714	77.062	1	0	3	1	0	3						1																					1	1													1																					1	1								513740	0	0	0	0	0	150660	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	179680	183410	0	0	0	0	0	0	0		
367	205	372	3943;3944;3945	2002	2002		NGGGPHIMAAILQVDVITTFDGKPDLSYMGEMEMMR	2	1	1	3	0	1	2	5	1	3	2	1	5	1	2	1	2	0	1	2	0	36	1	3923.8388	REV__Q96JB1	REV__Q96JB1			yes	yes	3	0.040557	1.288	1	0	3	1	0	3	1	1																			1															1	1																			1															1907100	737120	472460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	697550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
368	38	373	3946;3947;3948;3949;3950;3951;3952	2003;2004;2005	2004		NGLQSCPIKEDSFLQR	0	1	1	1	1	2	1	1	0	1	2	1	0	1	1	2	0	0	0	0	0	16	1	1890.9258	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.013816	84.892	1	0	7	1	0	7	1	1	1										1	1							1	1														1	1	1										1	1							1	1														1400400	315770	334760	293360	0	0	0	0	0	0	0	0	0	88724	108660	0	0	0	0	0	0	130750	128330	0	0	0	0	0	0	0	0	0	0	0	0	0		
369	44	374	3953;3954;3955;3956;3957	2006	2006		NIETIINTFHQYSVK	0	0	2	0	0	1	1	0	1	3	0	1	0	1	0	1	2	0	1	1	0	15	0	1805.9312	P06702	P06702	CAGB;CFAG;MRP14;S100A9	Calgranulin-B;Calprotectin L1H subunit;Leukocyte L1 complex heavy chain;Migration inhibitory factor-related protein 14;Protein S100-A9;S100 calcium-binding protein A9	yes	yes	2	0.0090072	112.02	1	0	5	1	0	5				1													1				1	1									1								1													1				1	1									1					330980	0	0	0	21741	0	0	0	0	0	0	0	0	0	0	0	0	53658	0	0	0	54223	63844	0	0	0	0	0	0	0	0	137510	0	0	0	0		
370	117	375	3958;3959;3960;3961;3962;3963;3964;3965	2007	2007		NILPFDHTR	0	1	1	1	0	0	0	0	1	1	1	0	0	1	1	0	1	0	0	0	0	9	0	1111.5774	Q06124	Q06124	PTP2C;PTPN11;SHPTP2	Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11	yes	yes	2	0.096645	73.931	1	0	8	1	0	8															1	1	1	1	1	1														1	1															1	1	1	1	1	1														1	1	599400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34512	40140	74089	85887	135260	127040	0	0	0	0	0	0	0	0	0	0	0	0	0	52917	49562		
371	76	376	3966;3967	2008	2008		NITYLPAGQSVLLQLPQ	1	0	1	0	0	3	0	1	0	1	4	0	0	0	2	1	1	0	1	1	0	17	0	1854.0251	P35232	P35232	PHB	Prohibitin	yes	yes	2	0.00090684	99.055	1	0	2	1	0	2	1	1																																		1	1																																		342770	158040	184730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
372	84	377	3968;3969;3970;3971;3972;3973;3974	2009;2010;2011;2012	2012		NKGEIYDAAIDLFTR	2	1	1	2	0	0	1	1	0	2	1	1	0	1	0	0	1	0	1	0	0	15	1	1724.8733	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	3	0.0035518	138.02	1	0	7	1	0	7								1									1	1	1	1														1	1								1									1	1	1	1														1	1	1998900	0	0	0	0	0	0	0	18594	0	0	0	0	0	0	0	0	388190	372870	586750	538130	0	0	0	0	0	0	0	0	0	0	0	0	0	48855	45551		
373	40	378	3975;3976;3977;3978;3979;3980;3981;3982;3983;3984;3985;3986;3987;3988;3989	2013;2014	2013		NKLNDLEDALQQAK	2	0	2	2	0	2	1	0	0	0	3	2	0	0	0	0	0	0	0	0	0	14	1	1598.8264	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	2.9369E-07	170.56	1	0	15	1	0	15					1	1			1	1			1	1			1	1	1	1	1	1									1			1	1					1	1			1	1			1	1			1	1	1	1	1	1									1			1	1	1087600	0	0	0	0	27181	27697	0	0	34783	27323	0	0	28701	38176	0	0	266790	219250	61407	44987	67408	55379	0	0	0	0	0	0	0	0	67043	0	0	64026	57406		+
374	40	379	3990;3991;3992;3993;3994;3995;3996;3997	2015;2016;2017;2018;2019;2020	2018		NKLNDLEDALQQAKEDLAR	3	1	2	3	0	2	2	0	0	0	4	2	0	0	0	0	0	0	0	0	0	19	2	2183.1182	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	3	0.00020036	133.86	1	0	8	1	0	8									1	1					1	1				1	1	1									1													1	1					1	1				1	1	1									1					2010000	0	0	0	0	0	0	0	0	108230	91009	0	0	0	0	225960	212210	0	0	0	90439	411360	401960	0	0	0	0	0	0	0	0	468810	0	0	0	0		+
375	79	380	3998;3999;4000;4001	2021;2022	2022		NKLNDLEEALQQAK	2	0	2	1	0	2	2	0	0	0	3	2	0	0	0	0	0	0	0	0	0	14	1	1612.842	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	no	3	0.019095	90.614	1	0	4	1	0	4																	1	1			1													1																		1	1			1													1		221980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68459	90709	0	0	42389	0	0	0	0	0	0	0	0	0	0	0	0	20423	0		+
376	38	381	4002;4003;4004;4005;4006;4007;4008;4009;4010;4011;4012;4013;4014;4015;4016	2023;2024;2025;2026;2027;2028;2029;2030;2031	2024		NLCYANTINWK	1	0	3	0	1	0	0	0	0	1	1	1	0	0	0	0	1	1	1	0	0	11	0	1395.6605	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	9.6528E-61	276.57	1	0	15	1	0	15	2	1	1	1	1								1	1	1	1					1	2							1	1						2	1	1	1	1								1	1	1	1					1	2							1	1						19089000	2857700	2766300	3171100	3143500	42826	0	0	0	0	0	0	0	861370	909020	818410	857130	0	0	0	0	1242800	2257300	0	0	0	0	0	0	79082	82036	0	0	0	0	0		
377	79;39;17	382	4017;4018;4019;4020;4021;4022;4023;4024;4025;4026;4027;4028;4029;4030;4031;4032;4033;4034;4035;4036;4037;4038;4039;4040;4041;4042;4043;4044;4045;4046;4047;4048;4049;4050	2032;2033;2034;2035;2036;2037;2038;2039;2040;2041;2042;2043;2044;2045;2046;2047;2048;2049;2050;2051;2052;2053;2054;2055;2056	2047		NLDLDSIIAEVK	1	0	1	2	0	0	1	0	0	2	2	1	0	0	0	1	0	0	0	1	0	12	0	1328.7187	P35908;CON__P35908;CON__O95678;O95678;CON__Q5XKE5;Q5XKE5;CON__Q8VED5;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P13647;P13647	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;K6HF;KB18;KRT75;K6HF;KB18;KRT75;K6L;KB38;KRT6L;KRT79;K6L;KB38;KRT6L;KRT79;Kb38;Krt79;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;KRT5;KRT5	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-75;Keratin, type II cytoskeletal 75;Keratin-6 hair follicle;Keratin-75;Type II keratin-K6hf;Type-II keratin Kb18;Cytokeratin-79;Keratin, type II cytoskeletal 79;Keratin-6-like;Keratin-79;Type-II keratin Kb38;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5	no	no	2	2.9486E-26	231.17	1	0	34	NaN	NaN		1	2	1	1	1	1	1	1	1	1			1	1	1	1	2	1	1	2	2	1					1	1		1	3	1	1	1	1																																				35214000	606700	670600	1116200	1143300	104660	129010	708890	617160	859980	796610	0	0	189410	202180	2493100	2467400	2655100	2417300	1272400	1291900	3289000	3221000	0	0	0	0	522500	538470	0	32986	7037900	42202	54954	385880	346760		+
378	23;18	383	4051;4052;4053;4054	2057;2058	2058		NLDLDSIIAEVR	1	1	1	2	0	0	1	0	0	2	2	0	0	0	0	1	0	0	0	1	0	12	0	1356.7249	CON__Q6NXH9;CON__Q32MB2;Q86Y46;CON__P19013;P19013	CON__Q6NXH9	Kb36;Krt73;K6IRS3;KB36;KRT6IRS3;KRT73;K6IRS3;KB36;KRT6IRS3;KRT73;CYK4;KRT4;CYK4;KRT4	Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4	no	no	2	0.00037782	146.36	1	0	4	NaN	NaN																		1	1			1	1																																																	245340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	99875	77535	0	0	33177	34753	0	0	0	0	0	0	0	0	0	0	0	0	0		+
379	172	384	4055;4056	2059	2059		NLLEKYK	0	0	1	0	0	0	1	0	0	0	2	2	0	0	0	0	0	0	1	0	0	7	1	906.51747	Q99575	Q99575	KIAA0061;POP1	Ribonucleases P/MRP protein subunit POP1	yes	yes	2	0.081747	83.614	1	0	2	1	0	2																																		1	1																																		1	1	845840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	449640	396200		
380	101;70	385	4057;4058;4059;4060;4061;4062;4063;4064;4065;4066;4067;4068;4069	2060;2061	2061		NLLSVAYK	1	0	1	0	0	0	0	0	0	0	2	1	0	0	0	1	0	0	1	1	0	8	0	906.51747	P62258;P31947;P61981;P31946;Q04917;P63104;P27348	P62258	YWHAE;HME1;SFN;YWHAG;YWHAB;YWHA1;YWHAH;YWHAZ;YWHAQ	14-3-3 protein epsilon;14-3-3 protein sigma;Epithelial cell marker protein 1;Stratifin;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;Protein kinase C inhibitor protein 1;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;Protein 1054;14-3-3 protein eta;Protein AS1;14-3-3 protein zeta/delta;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1	no	no	2	0.17335	73.931	1	0	13	NaN	NaN		1	1											1	1	1		1	1	1	1		1									1	1	1																																						2907500	115440	108160	0	0	0	0	0	0	0	0	0	0	163760	175040	157680	0	442090	435870	401120	476820	0	38596	0	0	0	0	0	0	0	0	69056	158840	164990	0	0		
381	38	386	4070;4071;4072;4073;4074;4075;4076;4077;4078;4079;4080;4081;4082;4083;4084;4085;4086;4087;4088;4089;4090;4091;4092;4093;4094;4095;4096;4097;4098;4099;4100;4101;4102;4103;4104;4105;4106;4107;4108;4109;4110;4111;4112;4113;4114;4115;4116;4117;4118;4119;4120;4121;4122;4123;4124;4125;4126;4127;4128;4129;4130;4131;4132	2062;2063;2064;2065;2066;2067;2068;2069;2070;2071;2072;2073;2074;2075;2076;2077;2078;2079;2080;2081;2082;2083;2084;2085;2086;2087;2088;2089;2090;2091;2092;2093;2094;2095;2096;2097;2098;2099;2100;2101;2102;2103;2104;2105;2106;2107;2108;2109;2110;2111;2112;2113;2114;2115;2116;2117;2118;2119;2120;2121;2122;2123;2124;2125;2126;2127;2128;2129;2130	2069		NLQEILHGAVR	1	1	1	0	0	1	1	1	1	1	2	0	0	0	0	0	0	0	0	1	0	11	0	1248.6939	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	9.6478E-47	231.05	1	0	63	1	0	63	5	5	8	8	1	2	1	1					2	2	3	3	1	1	1	1	3	4	1	1			1	1	1	1	1	1	1	1	1	5	5	8	8	1	2	1	1					2	2	3	3	1	1	1	1	3	4	1	1			1	1	1	1	1	1	1	1	1	207600000	26827000	26338000	33441000	31394000	355090	429180	509470	625350	0	0	0	0	6824400	7648100	13932000	13039000	902080	829660	1271400	1270200	16312000	16634000	176620	197370	0	0	273140	258190	1841000	2168300	3712600	68982	64175	135650	124580		
382	83	387	4133	2131	2131		NLSFFLTPPCAR	1	1	1	0	1	0	0	0	0	0	2	0	0	2	2	1	1	0	0	0	0	12	0	1421.7126	P42224	P42224	STAT1	Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84	yes	yes	2	0.0166	83.182	1	0	1	1	0	1	1																																			1																																			115280	115280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
383	128	388	4134;4135;4136;4137;4138;4139;4140;4141;4142;4143;4144	2132	2132		NPQGFVLSLCHLQK	0	0	1	0	1	2	0	1	1	0	3	1	0	1	1	1	0	0	0	1	0	14	0	1639.8504	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	3	0.18613	62.694	1	0	11	1	0	11					1	1	1	1									1	1	1	1							1							1	1					1	1	1	1									1	1	1	1							1							1	1	1055600	0	0	0	0	66999	103760	146260	174450	0	0	0	0	0	0	0	0	95037	63317	87510	72657	0	0	0	0	0	0	40377	0	0	0	0	0	0	106630	98625		
384	16	389	4145;4146;4147;4148;4149;4150;4151	2133;2134	2134		NQILNLTTDNANILLQIDNAR	2	1	5	2	0	2	0	0	0	3	4	0	0	0	0	0	2	0	0	0	0	21	0	2366.2554	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	3	2.6389E-67	258.92	1	0	7	1	0	7		1													1	1			1		1	1									1						1													1	1			1		1	1									1					1137300	0	30175	0	0	0	0	0	0	0	0	0	0	0	0	86838	74380	0	0	93964	0	227950	161610	0	0	0	0	0	0	0	0	462350	0	0	0	0		+
385	54	390	4152;4153;4154;4155;4156;4157;4158;4159	2135;2136;2137	2137		NQLTSNPENTVFDAK	1	0	3	1	0	1	1	0	0	0	1	1	0	1	1	1	2	0	0	1	0	15	0	1676.8006	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.0089911	109.83	1	0	8	1	0	8	1	1	1	1	1	1	1														1															1	1	1	1	1	1	1														1															761820	152600	161830	103290	143230	38271	50997	50358	0	0	0	0	0	0	0	0	0	0	0	0	0	61246	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
386	181	391	4160	2138	2138		NQPCNSMEPRVMDDDMLK	0	1	2	3	1	1	1	0	0	0	1	1	3	0	2	1	0	0	0	1	0	18	1	2178.9166	Q9H069	Q9H069	LRRC48	Leucine-rich repeat-containing protein 48	yes	yes	4	0.083286	1.5716	1	0	1	1	0	1																																		1																																			1		46997	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46997	0		
387	106	392	4161;4162;4163;4164;4165;4166;4167;4168;4169;4170;4171;4172;4173;4174;4175;4176;4177;4178;4179;4180;4181	2139;2140;2141;2142;2143;2144;2145;2146;2147;2148;2149;2150;2151;2152;2153;2154	2153		NQQIFLR	0	1	1	0	0	2	0	0	0	1	1	0	0	1	0	0	0	0	0	0	0	7	0	917.5083	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	0.0018818	131.04	1	0	21	1	0	21	1	1	1	1									1	1	1	1	1	1	1	1	1	1	1	1					1	1	1		1	1		1	1	1	1									1	1	1	1	1	1	1	1	1	1	1	1					1	1	1		1	1		16150000	251340	226670	256910	288380	0	0	0	0	0	0	0	0	2063600	2268400	3226500	2780900	76431	71517	97013	108640	76005	82048	71875	62592	0	0	0	0	1283600	1381400	1384200	0	40646	51082	0		
388	67	393	4182;4183;4184;4185	2155;2156;2157	2156		NSPPYILDLLPDTYQHLR	0	1	1	2	0	1	0	0	1	1	4	0	0	0	3	1	1	0	2	0	0	18	0	2154.111	P22681	P22681	CBL;CBL2;RNF55	Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL	yes	yes	3	0.084555	60.209	1	0	4	1	0	4															1	1		1	1																															1	1		1	1																	1404500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	355040	321050	0	50936	677470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
389	186	394	4186;4187;4188;4189;4190;4191;4192;4193;4194;4195;4196;4197;4198;4199;4200;4201;4202	2158;2159;2160;2161;2162;2163;2164;2165;2166;2167;2168;2169;2170	2159		NSPSLFPCAPLCER	1	1	1	0	2	0	1	0	0	0	2	0	0	1	3	2	0	0	0	0	0	14	0	1646.7545	Q9UJM3	Q9UJM3	ERRFI1;MIG6	ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein	yes	yes	2	0.0002897	153.81	1	0	17	1	0	17	1	1	1	1									1	1	1	1	1	1	1	1	1	1							1	1	1					1	1	1	1									1	1	1	1	1	1	1	1	1	1							1	1	1					7831900	282790	324580	451250	469450	0	0	0	0	0	0	0	0	1087300	1144600	1130500	1162200	47019	67909	73309	60962	273350	218950	0	0	0	0	0	0	339140	328770	369720	0	0	0	0		
390	46;125	395	4203;4204;4205;4206;4207;4208;4209;4210	2171;2172	2171		NSSYFVEWIPNNVK	0	0	3	0	0	0	1	0	0	1	0	1	0	1	1	2	0	1	1	2	0	14	0	1695.8257	P07437;P68371;P04350;Q13885;Q9BVA1;Q13509	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB3;TUBB4	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-III	no	no	2	0.010332	101.62	1	0	8	NaN	NaN				1	1			1	1								1	1	1			1																																																		1014700	0	0	266680	270580	0	0	71724	62082	0	0	0	0	0	0	0	137490	48649	53821	0	0	103650	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
391	97	396	4211;4212;4213	2173;2174	2174		NVFDEAILAALEPPEPK	3	0	1	1	0	0	3	0	0	1	2	1	0	1	3	0	0	0	0	1	0	17	0	1851.9618	P60953	P60953	CDC42	Cell division control protein 42 homolog;G25K GTP-binding protein	yes	yes	3	0.019274	73.834	1	0	3	1	0	3	1	1													1																					1	1													1																					254740	105690	103560	0	0	0	0	0	0	0	0	0	0	0	0	45487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
392	114	397	4214;4215;4216;4217;4218	2175	2175		NVFNALIR	1	1	2	0	0	0	0	0	0	1	1	0	0	1	0	0	0	0	0	1	0	8	0	945.5396	Q02978	Q02978	SLC20A4;SLC25A11	Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11	yes	yes	2	0.065911	88.942	1	0	5	1	0	5	1		1	1																	1	1														1		1	1																	1	1														345850	73339	0	72008	75507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53842	71151	0	0	0	0	0	0	0	0	0	0	0	0	0		
393	193	398	4219;4220;4221;4222;4223;4224;4225;4226;4227;4228;4229;4230;4231;4232;4233;4234;4235;4236;4237;4238;4239;4240;4241;4242;4243;4244;4245;4246;4247;4248;4249;4250;4251;4252;4253;4254;4255;4256;4257;4258;4259;4260;4261;4262;4263;4264;4265	2176;2177;2178;2179;2180;2181;2182;2183	2176		NVLFEDLAMWGGGRVVMVTR	1	2	1	1	0	0	1	3	0	0	2	0	2	1	0	0	1	1	0	4	0	20	1	2249.1449	REV__Q03001;REV__Q9UPN3	REV__Q03001			yes	no	3	0.088848	46.121	1	0	47	1	0	47	2	2	2	2	2	2	2	2		1		1	1	2	2	2	2	2	2	1	1	2				1	1	2		1	2	1	1	2	1	2	2	2	2	2	2	2	2		1		1	1	2	2	2	2	2	2	1	1	2				1	1	2		1	2	1	1	2	1	116540000	5187000	4659600	8249400	7126200	273870	530730	10029000	7295700	0	1260700	0	181520	1884900	2227500	6886200	874020	7450200	7206600	112220	10815000	1533400	5626500	0	0	0	30432	4179600	9117700	0	42319	6017800	1481100	2119100	4114100	29346	+	
394	16	399	4266;4267;4268;4269;4270;4271;4272	2184;2185;2186;2187	2186		NVQALEIELQSQLALK	2	0	1	0	0	3	2	0	0	1	4	1	0	0	0	1	0	0	0	1	0	16	0	1796.0044	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2,3	5.2654E-05	159	1	0	7	1	0	7															1						2	2									2																			1						2	2									2					931620	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43809	0	0	0	0	0	223970	156730	0	0	0	0	0	0	0	0	507110	0	0	0	0		+
395	86	400	4273;4274;4275;4276;4277;4278;4279;4280;4281;4282;4283;4284;4285	2188;2189;2190;2191;2192;2193;2194	2189		NVQGIIEILK	0	0	1	0	0	1	1	1	0	3	1	1	0	0	0	0	0	0	0	1	0	10	0	1125.6758	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2	8.9475E-05	119.68	1	0	13	1	0	13	1	1	1	1		1	1	1						1	1	1					1	1					1									1	1	1	1		1	1	1						1	1	1					1	1					1									1944100	404860	418940	316310	267270	0	36596	46358	49902	0	0	0	0	0	0	59075	53901	0	0	0	0	151410	139470	0	0	0	0	0	0	0	0	0	0	0	0	0		
396	16	401;402	4286;4287;4288;4289;4290;4291;4292;4293;4294;4295;4296;4297;4298;4299;4300;4301;4302;4303;4304;4305;4306;4307;4308	2195;2196;2197;2198;2199;2200;2201;2202;2203;2204;2205;2206;2207	2203	1	NVSTGDVNVEMNAAPGVDLTQLLNNMR	2	1	5	2	0	1	1	2	0	0	3	0	2	0	1	1	2	0	0	4	0	27	0	2871.3855	CON__P13645;P13645;CON__P02535-1	CON__P13645	KPP;KRT10;KPP;KRT10;Krt10;Krt1-10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa	yes	no	3	2.2462E-27	168.64	1	0	23	1	0	23	1	1	1	1			1		1	1			1		1	2	1	1	1	1	2	2					1	1			2					1	1	1	1			1		1	1			1		1	2	1	1	1	1	2	2					1	1			2					9467200	132220	192920	105030	112790	0	0	119710	0	325670	384220	0	0	61087	0	412000	1137600	339420	290510	462620	400240	1789500	1703600	0	0	0	0	106170	117940	0	0	1274100	0	0	0	0		+
397	38	403	4309;4310;4311;4312;4313;4314;4315;4316;4317;4318;4319;4320;4321;4322;4323;4324;4325;4326;4327;4328;4329;4330;4331	2208;2209;2210;2211;2212;2213;2214;2215;2216;2217	2210		NYDLSFLK	0	0	1	1	0	0	0	0	0	0	2	1	0	1	0	1	0	0	1	0	0	8	0	998.5073	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.01596	114.5	1	0	23	1	0	23	1	1	1	2	1		1	1					1	1	1	1	1	1	1	1	1	1	1	1					1	1	1					1	1	1	2	1		1	1					1	1	1	1	1	1	1	1	1	1	1	1					1	1	1					23386000	3241800	2953400	3420000	3737800	52231	0	65612	58079	0	0	0	0	896060	808040	1570700	1513700	129740	153770	106970	85443	2113300	1811500	36434	53308	0	0	0	0	192380	130850	254710	0	0	0	0		
398	19	404	4332;4333;4334	2218	2218		NYSPYYNTIDDLKDQIVDLTVGNNK	0	0	4	4	0	1	0	1	0	2	2	2	0	0	1	1	2	0	3	2	0	25	1	2901.4032	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	0.015048	73.448	1	0	3	1	0	3																					1	1									1																									1	1									1					477480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104650	101860	0	0	0	0	0	0	0	0	270960	0	0	0	0		+
399	38	405	4335;4336;4337;4338;4339;4340;4341;4342;4343;4344;4345;4346;4347;4348;4349;4350;4351;4352;4353;4354;4355;4356;4357;4358;4359;4360;4361;4362;4363	2219;2220;2221;2222;2223;2224;2225;2226;2227;2228;2229;2230;2231;2232;2233;2234;2235	2224		NYVVTDHGSCVR	0	1	1	1	1	0	0	1	1	0	0	0	0	0	0	1	1	0	1	3	0	12	0	1405.6408	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	1.4821E-35	244	1	0	29	1	0	29	2	2	2	2									2	2	2	2					2	2	2	2					1	2	2					2	2	2	2									2	2	2	2					2	2	2	2					1	2	2					10922000	2097100	1901000	1672100	1708500	0	0	0	0	0	0	0	0	229780	234920	364890	385360	0	0	0	0	527100	509300	528550	572280	0	0	0	0	35393	71681	84365	0	0	0	0		
400	106	406	4364;4365;4366;4367;4368;4369;4370;4371;4372;4373;4374;4375	2236	2236		PHPWFFGK	0	0	0	0	0	0	0	1	1	0	0	1	0	2	2	0	0	1	0	0	0	8	0	1014.5076	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	0.070977	88.029	1	0	12	1	0	12	1	1	1	1									1	1	1	1	1												1	1	1					1	1	1	1									1	1	1	1	1												1	1	1					5264900	65178	61041	72508	53563	0	0	0	0	0	0	0	0	711720	842380	949440	1012700	42494	0	0	0	0	0	0	0	0	0	0	0	379450	377460	697000	0	0	0	0		
401	196	407	4376;4377;4378	2237;2238	2237		PLEENIIK	0	0	1	0	0	0	2	0	0	2	1	1	0	0	1	0	0	0	0	0	0	8	0	954.5386	REV__Q5VZP5	REV__Q5VZP5			yes	yes	2	0.024218	106.04	1	0	3	1	0	3				1												1					1																		1												1					1															1162900	0	0	0	710370	0	0	0	0	0	0	0	0	0	0	0	185300	0	0	0	0	267190	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
402	190	408	4379;4380;4381;4382;4383;4384;4385;4386;4387	2239	2239		PLGDGGIVVLR	0	1	0	1	0	0	0	3	0	1	2	0	0	0	1	0	0	0	0	2	0	11	0	1094.6448	REV__A6NCF5	REV__A6NCF5			yes	yes	2	0.088848	69.275	1	0	9	1	0	9	1	1	1	1										1	1	1					1	1														1	1	1	1										1	1	1					1	1														1122200	197550	397870	99573	66966	0	0	0	0	0	0	0	0	0	33440	46944	43966	0	0	0	0	141250	94692	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
403	38	409	4388;4389;4390;4391;4392;4393	2240;2241	2241		PYDGIPASEISSILEK	1	0	0	1	0	0	2	1	0	3	1	1	0	0	2	3	0	0	1	0	0	16	0	1717.8774	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.070958	69.258	1	0	6	1	0	6	1	1	1	1											1						1															1	1	1	1											1						1															1530700	503070	50242	405030	362540	0	0	0	0	0	0	0	0	0	0	57874	0	0	0	0	0	151990	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
404	3	410	4394	2242	2242		QDLGKAIENIR	1	1	1	1	0	1	1	1	0	2	1	1	0	0	0	0	0	0	0	0	0	11	1	1255.6884	A6NMZ7	A6NMZ7	COL6A6	Collagen alpha-6(VI) chain	yes	yes	2	0.0050451	58.676	1	0	1	1	0	1	1																																			1																																			951220	951220	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
405	40	411	4395;4396;4397;4398;4399;4400;4401;4402;4403;4404;4405;4406;4407;4408;4409;4410	2243;2244	2243		QISNLQQSISDAEQR	1	1	1	1	0	4	1	0	0	2	1	0	0	0	0	3	0	0	0	0	0	15	0	1715.8438	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	0.020912	88.075	1	0	16	1	0	16			1	1	1	1			1	1	1	1	1	1	1	1	1	1			1										1							1	1	1	1			1	1	1	1	1	1	1	1	1	1			1										1					840400	0	0	31348	30893	39878	33979	0	0	43257	62434	39301	51735	39387	37553	33925	47379	116760	95159	0	0	53452	0	0	0	0	0	0	0	0	0	83970	0	0	0	0		+
406	5;150;109	412	4411;4412;4413;4414;4415;4416;4417	2245	2245		QLFHPEQLITGK	0	0	0	0	0	2	1	1	1	1	2	1	0	1	1	0	1	0	0	0	0	12	0	1409.7667	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65;P68366	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	no	no	3	0.13395	62.466	1	0	7	NaN	NaN		1	1	1	1		1							1		1																																																								824980	199570	194070	153260	155720	0	69704	0	0	0	0	0	0	30689	0	21967	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
407	19	413	4418;4419;4420;4421;4422;4423;4424;4425;4426;4427;4428;4429;4430;4431;4432;4433;4434;4435;4436;4437;4438	2246;2247;2248;2249;2250;2251;2252;2253	2252	2	QVLDNLTMEK	0	0	1	1	0	1	1	0	0	0	2	1	1	0	0	0	1	0	0	1	0	10	0	1189.6013	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	2	0.0099291	93.649	1	0	21	1	0	21			1		1	1			1	1	1	1	1	1		1	1	1			1	1			1	1			1	1	1			1	1			1		1	1			1	1	1	1	1	1		1	1	1			1	1			1	1			1	1	1			1	1	1400700	0	0	32034	0	45984	53079	0	0	64073	45117	70636	72506	94637	75866	0	0	80011	82425	0	0	121820	92322	0	0	84754	81998	0	0	38555	50091	72307	0	0	65928	76561		+
408	77	414	4439	2254	2254		QWWNLR	0	1	1	0	0	1	0	0	0	0	1	0	0	0	0	0	0	2	0	0	0	6	0	901.45587	P35498	P35498	NAC1;SCN1;SCN1A	Sodium channel protein brain I subunit alpha;Sodium channel protein type 1 subunit alpha;Sodium channel protein type I subunit alpha;Voltage-gated sodium channel subunit alpha Nav1.1	yes	yes	2	3.7286E-18	106.75	1	0	1	1	0	1															1																																			1																					0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
409	26	415	4440;4441;4442;4443;4444;4445;4446;4447	2255	2255		RDGTFLIR	0	2	0	1	0	0	0	1	0	1	1	0	0	1	0	0	1	0	0	0	0	8	1	976.54541	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.16009	90.657	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	951410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	124640	126880	202930	225830	0	0	0	0	0	0	0	0	0	0	0	74015	64794	57850	74465		
410	177	416	4448	2256	2256		RHTVGGGEMAR	1	2	0	0	0	0	1	3	1	0	0	0	1	0	0	0	1	0	0	1	0	11	1	1169.5724	Q9BWN1	Q9BWN1	PRR14	Proline-rich protein 14	yes	yes	2	0.059219	47.559	1	0	1	1	0	1	1																																			1																																			113500	113500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
411	154	417	4449	2257	2257		RIAHGADAVAAR	5	2	0	1	0	0	0	1	1	1	0	0	0	0	0	0	0	0	0	1	0	12	1	1206.6582	Q8IWK6	Q8IWK6	GPR125;UNQ556/PRO1113	Probable G-protein coupled receptor 125	yes	yes	2	0.062524	51.998	1	0	1	1	0	1															1																																			1																					0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
412	38	418	4450;4451;4452;4453;4454;4455;4456;4457;4458;4459;4460;4461;4462;4463;4464;4465	2258;2259;2260;2261;2262;2263;2264	2261		RPAGSVQNPVYHNQPLNPAPSR	2	2	3	0	0	2	0	1	1	0	1	0	0	0	5	2	0	0	1	2	0	22	1	2398.2254	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3,4	2.03E-10	161.19	1	0	16	1	0	16	2	2	2	2									1	1	1	1					2	2														2	2	2	2									1	1	1	1					2	2														4686600	881900	843800	817590	928810	0	0	0	0	0	0	0	0	64578	70598	88452	112740	0	0	0	0	438040	440140	0	0	0	0	0	0	0	0	0	0	0	0	0		
413	26;167	419	4466;4467;4468;4469;4470;4471;4472;4473;4474;4475;4476;4477;4478;4479;4480;4481;4482;4483;4484;4485	2265;2266;2267;2268;2269;2270;2271;2272;2273;2274;2275;2276;2277;2278	2270		RTAIEAFNETIK	2	1	1	0	0	0	2	0	0	2	0	1	0	1	0	0	2	0	0	0	0	12	1	1391.7409	O00459;P27986;Q92569	O00459	PIK3R2;GRB1;PIK3R1;PIK3R3	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta;Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;Phosphatidylinositol 3-kinase regulatory subunit alpha;p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma	no	no	2,3	0.0023733	141.08	1	0	20	NaN	NaN						1		1	2									2	2	2	2												2	2	2	2																																				4325200	0	0	0	0	33862	0	28148	78940	0	0	0	0	0	0	0	0	617890	579200	740190	953110	0	0	0	0	0	0	0	0	0	0	0	235560	229550	425900	402840		
414	16	420	4486;4487;4488;4489;4490;4491;4492;4493;4494;4495;4496;4497;4498;4499;4500;4501;4502;4503;4504;4505;4506;4507;4508;4509;4510;4511;4512;4513;4514;4515;4516	2279;2280;2281;2282;2283;2284;2285;2286;2287;2288;2289;2290;2291;2292;2293;2294;2295	2289		RVLDELTLTK	0	1	0	1	0	0	1	0	0	0	3	1	0	0	0	0	2	0	0	1	0	10	1	1186.6921	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	4.374E-05	142.83	1	0	31	1	0	31		1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1			1	1	1		1	1	1	1	1	1	1		1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1			1	1	1		1	1	1	1	1	1	1	4558500	0	34727	119130	171510	189330	170230	114500	102070	86878	105180	125610	126620	114230	140030	133110	102900	399450	453800	89146	109010	247530	263090	0	0	90940	127430	32838	0	89885	75557	308060	47250	42268	175390	170800		+
415	144	421	4517	2296	2296		RVTAPYKYPR	1	2	0	0	0	0	0	0	0	0	0	1	0	0	2	0	1	0	2	1	0	10	2	1249.6931	Q6NUN0	Q6NUN0	ACSM5;MACS3	Acyl-coenzyme A synthetase ACSM5, mitochondrial	yes	yes	2	0.086627	34.721	1	0	1	1	0	1	1																																			1																																			75817	75817	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
416	110	422	4518	2297	2297		SAVTALWGK	2	0	0	0	0	0	0	1	0	0	1	1	0	0	0	1	1	1	0	1	0	9	0	931.51272	P68871	P68871	HBB	Beta-globin;Hemoglobin beta chain;Hemoglobin subunit beta;LVV-hemorphin-7	yes	yes	2	0.049347	58.981	1	0	1	1	0	1												1																																			1																								0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
417	7	423	4519;4520;4521;4522;4523;4524;4525;4526;4527;4528;4529;4530	2298;2299	2299		SCAAAGTECLISGWGNTK	3	0	1	0	2	0	1	3	0	1	1	1	0	0	0	2	2	1	0	0	0	18	0	1881.8349	CON__P00761	CON__P00761			yes	yes	2	0.00019702	134.25	1	0	12	1	0	12		1	1	1										1	1	1			1	1		1					1					1	1				1	1	1										1	1	1			1	1		1					1					1	1			792220	0	34425	88843	154640	0	0	0	0	0	0	0	0	0	35937	71140	58314	0	0	81280	61577	0	40253	0	0	0	0	38008	0	0	0	0	52202	75602	0	0		+
418	84	424	4531;4532;4533;4534	2300;2301;2302	2301		SCAGYCVATFILGIGDR	2	1	0	1	2	0	0	3	0	2	1	0	0	1	0	1	1	0	1	1	0	17	0	1858.8706	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2,3	0.0002726	136.17	1	0	4	1	0	4																			2	2																																		2	2																2328500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1225700	1102800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
419	164	425	4535;4536;4537;4538;4539	2303;2304;2305	2304		SDGLLQLWK	0	0	0	1	0	1	0	1	0	0	3	1	0	0	0	1	0	1	0	0	0	9	0	1058.576	Q8WV24	Q8WV24	PHLDA1;PHRIP;TDAG51	Apoptosis-associated nuclear protein;Pleckstrin homology-like domain family A member 1;Proline- and glutamine-rich protein;Proline- and histidine-rich protein;T-cell death-associated gene 51 protein	yes	yes	2	0.015082	93.178	1	0	5	1	0	5	1	1		1			1	1																												1	1		1			1	1																												186340	57972	50385	0	37860	0	0	40128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
420	19	426	4540;4541;4542;4543;4544;4545;4546;4547;4548;4549;4550;4551	2306;2307;2308	2307	3;4	SDLEMQYETLQEELMALKK	1	0	0	1	0	2	4	0	0	0	4	2	2	0	0	1	1	0	1	0	0	19	1	2298.1123	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	0.0010654	87.566	1	0	12	1	0	12	1	1							1	1					1	1	1		1	1	1	1									1					1	1							1	1					1	1	1		1	1	1	1									1					3316100	142100	161990	0	0	0	0	0	0	226970	182410	0	0	0	0	200800	225730	54778	0	126740	162480	707770	545730	0	0	0	0	0	0	0	0	578590	0	0	0	0		+
421	139	427	4552;4553;4554;4555;4556;4557;4558	2309;2310;2311;2312;2313;2314	2309		SDSLFQLWK	0	0	0	1	0	1	0	0	0	0	2	1	0	1	0	2	0	1	0	0	0	9	0	1122.571	Q53GA4	Q53GA4	BWR1C;HLDA2;IPL;PHLDA2;TSSC3	Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein;Imprinted in placenta and liver protein;p17-Beckwith-Wiedemann region 1 C;Pleckstrin homology-like domain family A member 2;Tumor-suppressing STF cDNA 3 protein;Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein	yes	yes	2	3.6562E-05	137.14	1	0	7	1	0	7	1	1	1	1			1	1														1														1	1	1	1			1	1														1														344870	94396	76280	35860	0	0	0	60364	77970	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
422	121	428	4559;4560	2315	2315		SFCKPQELLSLLIER	0	1	0	0	1	1	2	0	0	1	4	1	0	1	1	2	0	0	0	0	0	15	1	1831.9866	Q07890	Q07890	SOS2	Son of sevenless homolog 2	yes	yes	3	0.025129	85.554	1	0	2	1	0	2															1	1																																		1	1																				144550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	80923	63631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
423	49	429	4561;4562;4563;4564	2316;2317	2317		SFISGGSTITGVGK	0	0	0	0	0	0	0	4	0	2	0	1	0	1	0	3	2	0	0	1	0	14	0	1309.6878	P08581	P08581	MET	Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met	yes	yes	2	0.0080296	125.54	1	0	4	1	0	4																					1	1							1	1																										1	1							1	1						257140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	58238	60642	0	0	0	0	0	0	63525	74737	0	0	0	0	0		
424	122	430	4565;4566;4567;4568;4569	2318;2319;2320;2321;2322	2321		SFLILPFQR	0	1	0	0	0	1	0	0	0	1	2	0	0	2	1	1	0	0	0	0	0	9	0	1119.6441	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	4.1643E-05	135.79	1	0	5	1	0	5													1	1	1	1															1																	1	1	1	1															1					1169900	0	0	0	0	0	0	0	0	0	0	0	0	99670	98730	460840	444230	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66392	0	0	0	0		
425	26	431	4570;4571;4572;4573;4574;4575;4576;4577;4578;4579;4580;4581;4582;4583;4584;4585;4586;4587;4588;4589;4590;4591;4592;4593;4594	2323;2324;2325;2326;2327;2328;2329;2330;2331;2332;2333;2334;2335;2336;2337;2338;2339;2340;2341;2342	2328		SFLLALPAPLVTPEASAEAR	5	1	0	0	0	0	2	0	0	0	4	0	0	1	3	2	1	0	0	1	0	20	0	2052.1255	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	1.2377E-09	147.24	1	0	25	1	0	25							2	2							2	2	3	2	4	3							1	1			1			1	1							2	2							2	2	3	2	4	3							1	1			1			1	1	83029000	0	0	0	0	0	0	254290	259790	0	0	0	0	0	0	239160	247460	4401000	4104800	36778000	36197000	0	0	0	0	0	0	93688	96898	0	0	57786	0	0	159870	139260		
426	182	432	4595	2343	2343		SFWELIGEAAK	2	0	0	0	0	0	2	1	0	1	1	1	0	1	0	1	0	1	0	0	0	11	0	1249.6343	Q9HCY8	Q9HCY8	S100A14;S100A15	Protein S100-A14;S100 calcium-binding protein A14	yes	yes	2	0.045413	55.353	1	0	1	1	0	1	1																																			1																																			0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
427	122	433	4596;4597;4598;4599;4600;4601	2344;2345;2346	2344		SGELTALEFSASPGLR	2	1	0	0	0	0	2	2	0	0	3	0	0	1	1	3	1	0	0	0	0	16	0	1633.8312	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2	0.0045824	103.85	1	0	6	1	0	6									1				1	1	1	1				1																								1				1	1	1	1				1																953240	0	0	0	0	0	0	0	0	29365	0	0	0	135900	156350	288360	299340	0	0	0	43930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
428	19	434	4602;4603;4604;4605;4606;4607;4608;4609;4610;4611;4612;4613;4614;4615;4616	2347;2348;2349;2350;2351;2352;2353;2354;2355	2353		SGGGGGGGLGSGGSIR	0	1	0	0	0	0	0	10	0	1	1	0	0	0	0	3	0	0	0	0	0	16	0	1231.5905	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	2	0.0045799	107.46	1	0	15	1	0	15			1	1							1	1	1	1			1	1			1	1			1	1					1			1	1			1	1							1	1	1	1			1	1			1	1			1	1					1			1	1	819000	0	0	63524	54130	0	0	0	0	0	0	64679	60264	62274	67441	0	0	37355	42949	0	0	56138	44535	0	0	55939	63484	0	0	0	0	53973	0	0	51413	40898		+
429	86	435	4617;4618;4619;4620;4621;4622;4623;4624;4625;4626;4627;4628;4629;4630;4631;4632;4633	2356;2357;2358;2359;2360;2361	2359		SGGLGGSHALLLLR	1	1	0	0	0	0	0	4	1	0	5	0	0	0	0	2	0	0	0	0	0	14	0	1349.7779	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2,3	0.006134	132.79	1	0	17	1	0	17	2	2	2	2										1	2	2					1	2								1						2	2	2	2										1	2	2					1	2								1						1816700	340690	377050	311240	322060	0	0	0	0	0	0	0	0	0	43429	85909	91554	0	0	0	0	83444	146340	0	0	0	0	0	0	0	14988	0	0	0	0	0		
430	189	436	4634;4635;4636;4637;4638;4639	2362	2362		SGLDVMPNISDVLLRK	0	1	1	2	0	0	0	1	0	1	3	1	1	0	1	2	0	0	0	2	0	16	1	1755.9553	Q9Y6F6	Q9Y6F6	IRAG;JAW1L;MRVI1	Inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate;JAW1-related protein MRVI1;Protein MRVI1	yes	yes	3	0.13623	72.891	1	0	6	1	0	6		1						1									1			1							1	1									1						1									1			1							1	1								946130	0	618430	0	0	0	0	0	114580	0	0	0	0	0	0	0	0	49761	0	0	49954	0	0	0	0	0	0	81235	32167	0	0	0	0	0	0	0		
431	46	437	4640;4641;4642;4643;4644;4645;4646	2363;2364;2365	2363		SGPFGQIFRPDNFVFGQSGAGNNWAK	2	1	3	1	0	2	0	5	0	1	0	1	0	4	2	2	0	1	0	1	0	26	1	2797.3361	P07437;P68371;P04350;Q13885;Q9BVA1	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain	yes	no	3	3.4229E-15	149.44	1	0	7	1	0	7	1	1													1	1			1		1	1														1	1													1	1			1		1	1														2270900	805230	837070	0	0	0	0	0	0	0	0	0	0	0	0	145270	150770	0	0	74879	0	161400	96310	0	0	0	0	0	0	0	0	0	0	0	0	0		
432	186	438	4647;4648;4649;4650;4651;4652;4653;4654;4655;4656;4657;4658;4659;4660;4661	2366;2367;2368;2369;2370;2371;2372;2373	2372		SIAGVAAQEIR	3	1	0	0	0	1	1	1	0	2	0	0	0	0	0	1	0	0	0	1	0	11	0	1113.6142	Q9UJM3	Q9UJM3	ERRFI1;MIG6	ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein	yes	yes	2	9.5049E-05	149.96	1	0	15	1	0	15	1	1	1	1									1	1	1	1			1	1	1	1							1	1	1					1	1	1	1									1	1	1	1			1	1	1	1							1	1	1					2588100	66125	69113	113410	125640	0	0	0	0	0	0	0	0	275890	391530	500120	417240	0	0	54161	46053	65414	63496	0	0	0	0	0	0	119640	138950	141280	0	0	0	0		
433	70	439	4662;4663;4664;4665;4666;4667;4668;4669	2374;2375;2376	2374		SICTTVLELLDK	0	0	0	1	1	0	1	0	0	1	3	1	0	0	0	1	2	0	0	1	0	12	0	1390.7378	P27348	P27348	YWHAQ	14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1	yes	yes	2	0.0028082	110.66	1	0	8	1	0	8	1	1													1	1	1	1	1	1																1	1													1	1	1	1	1	1																926340	49989	68355	0	0	0	0	0	0	0	0	0	0	0	0	155910	143540	44298	29027	231470	203760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
434	14	440	4670;4671;4672;4673;4674;4675;4676;4677;4678;4679;4680;4681;4682;4683;4684;4685	2377	2377		SIHFSSPVFTSR	0	1	0	0	0	0	0	0	1	1	0	0	0	2	1	4	1	0	0	1	0	12	0	1363.6884	CON__P08729;CON__Q3KNV1;P08729	CON__P08729	KRT7;SCL;KRT7;KRT7;SCL	Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Sarcolectin;Type-II keratin Kb7;KRT7 protein;Putative uncharacterized protein	yes	no	2	0.034903	79.659	1	0	16	1	0	16	1	1	1	1					1	1			1	1	1	1			1		1	1							1	1	1					1	1	1	1					1	1			1	1	1	1			1		1	1							1	1	1					1504500	181660	209180	150460	180780	0	0	0	0	31744	33951	0	0	50249	50518	74011	109210	0	0	49822	0	139020	83148	0	0	0	0	0	0	45438	54248	61041	0	0	0	0		+
435	55	441	4686;4687;4688;4689	2378;2379;2380	2379		SINPDEAVAYGAAVQAAILSGDK	6	0	1	2	0	1	1	2	0	2	1	1	0	0	1	2	0	0	1	2	0	23	0	2259.1383	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	3	1.0112E-06	107.02	1	0	4	1	0	4	1	1																			1	1														1	1																			1	1														1099900	353390	343700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	219400	183370	0	0	0	0	0	0	0	0	0	0	0	0	0		
436	180	442	4690;4691;4692;4693;4694	2381;2382;2383	2381		SINQPVAFVR	1	1	1	0	0	1	0	0	0	1	0	0	0	1	1	1	0	0	0	2	0	10	0	1129.6244	Q9GZT3	Q9GZT3	C14orf156;DC23;DC50;PD04872;SLIRP	SRA stem-loop-interacting RNA-binding protein, mitochondrial	yes	yes	2	0.0024097	108.47	1	0	5	1	0	5	1	1	1	1																		1														1	1	1	1																		1														303850	87832	73366	57480	63650	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21519	0	0	0	0	0	0	0	0	0	0	0	0	0		
437	5;109	443	4695;4696;4697;4698;4699;4700;4701;4702;4703;4704;4705;4706;4707;4708;4709;4710;4711;4712	2384;2385;2386;2387;2388;2389;2390;2391;2392;2393	2384		SIQFVDWCPTGFK	0	0	0	1	1	1	0	1	0	1	0	1	0	2	1	1	1	1	0	1	0	13	0	1583.7442	CON__ENSEMBL:ENSBTAP00000016242;P68363;P68366	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1;TUBA4A	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	no	no	2	3.4515E-07	174.73	1	0	18	NaN	NaN		1	1	2	1			1	1							1	1	1	1	1	1	1	1					1	1			1																																								3751600	825040	740330	486290	408140	0	0	109370	98103	0	0	0	0	0	0	164350	166210	55131	62642	90479	41424	212080	192530	0	0	0	0	37905	34100	0	0	27502	0	0	0	0		+
438	147	444	4713;4714;4715;4716;4717;4718;4719;4720;4721;4722;4723;4724;4725;4726;4727;4728;4729;4730;4731;4732;4733;4734;4735;4736;4737;4738;4739;4740;4741;4742;4743	2394;2395;2396;2397;2398;2399;2400	2400		SISLPR	0	1	0	0	0	0	0	0	0	1	1	0	0	0	1	2	0	0	0	0	0	6	0	671.39662	Q6PKX4	Q6PKX4	DOK5L;DOK6	Docking protein 6;Downstream of tyrosine kinase 6	yes	yes	1	0.032677	96.337	1	0	31	1	0	31	1	2	2	2	1	1	1		1	1	2	2	1	1	1		1	1	1	1	1		1	1			1			1	1		1	1		1	2	2	2	1	1	1		1	1	2	2	1	1	1		1	1	1	1	1		1	1			1			1	1		1	1		5609000	576270	807400	265530	284730	153830	165000	143930	0	143460	158360	213230	219650	276520	117420	143310	0	150930	149800	125110	136590	449290	0	122060	122580	0	0	124010	0	0	157050	161890	0	157730	83347	0		
439	48	445	4744;4745;4746	2401;2402	2402		SIYYITGESK	0	0	0	0	0	0	1	1	0	2	0	1	0	0	0	2	1	0	2	0	0	10	0	1159.5761	P08238;Q58FF8	P08238	HSP90AB1;HSP90B;HSPC2;HSPCB;HSP90AB2P;HSP90BB	Heat shock 84 kDa;Heat shock protein HSP 90-beta;Heat shock protein 90-beta b;Putative heat shock protein HSP 90-beta 2	yes	no	2	0.0059431	100.02	1	0	3	1	0	3	1	1	1																																	1	1	1																																	154020	54339	56247	43430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
440	16	446	4747;4748;4749;4750;4751;4752;4753;4754;4755;4756;4757;4758;4759	2403	2403		SKELTTEIDNNIEQISSYK	0	0	2	1	0	1	3	0	0	3	1	2	0	0	0	3	2	0	1	0	0	19	1	2211.0907	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	3	0.15744	55.546	1	0	13	1	0	13			1				1	1	1	1					1	1	1	1	1		1	1									1							1				1	1	1	1					1	1	1	1	1		1	1									1					2380700	0	0	152510	0	0	0	112120	32612	103930	67915	0	0	0	0	162740	206710	273310	339530	78310	0	260410	213690	0	0	0	0	0	0	0	0	376900	0	0	0	0		+
441	192	447	4760;4761;4762;4763;4764;4765;4766;4767;4768;4769;4770;4771;4772;4773;4774;4775;4776;4777;4778;4779;4780;4781;4782;4783;4784;4785;4786;4787;4788;4789;4790;4791;4792;4793;4794;4795;4796;4797;4798;4799;4800;4801;4802;4803;4804;4805;4806;4807	2404;2405;2406;2407;2408;2409;2410;2411	2411		SLDALGIDSR	1	1	0	2	0	0	0	1	0	1	2	0	0	0	0	2	0	0	0	0	0	10	0	1045.5404	REV__O15440	REV__O15440			yes	yes	2	0.010896	93.178	1	0	48	1	0	48	1	1	1	2	1	1	2	1	1	1	1	1	2	2	1	2	1	1	1	2	1	1	1	1	1	2	1	1	2	2	2	2	1	2	2	1	1	1	2	1	1	2	1	1	1	1	1	2	2	1	2	1	1	1	2	1	1	1	1	1	2	1	1	2	2	2	2	1	2	2	11301000	144210	120430	122090	613670	354920	310220	529560	419580	386370	93278	112870	353690	415030	405200	270440	360010	284460	280620	444090	631810	127610	116780	81906	85260	397080	439210	112980	347110	417000	456940	437080	471550	369900	393000	395420	+	
442	14	448	4808;4809;4810;4811;4812;4813;4814;4815;4816	2412;2413	2412		SLDLDGIIAEVK	1	0	0	2	0	0	1	1	0	2	2	1	0	0	0	1	0	0	0	1	0	12	0	1271.6973	CON__P08729;CON__Q3KNV1;P08729	CON__P08729	KRT7;SCL;KRT7;KRT7;SCL	Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Sarcolectin;Type-II keratin Kb7;KRT7 protein;Putative uncharacterized protein	yes	no	2	1.3688E-08	73.632	1	0	9	1	0	9	1	1	1	1											1				1		1	1									1					1	1	1	1											1				1		1	1									1					632760	136330	139110	77894	69324	0	0	0	0	0	0	0	0	0	0	38025	0	0	0	32471	0	70439	69175	0	0	0	0	0	0	0	0	0	0	0	0	0		+
443	40	449	4817;4818;4819;4820;4821;4822;4823;4824;4825;4826;4827;4828;4829;4830;4831;4832;4833;4834;4835;4836;4837;4838;4839;4840;4841;4842;4843;4844;4845;4846;4847;4848;4849;4850;4851;4852;4853;4854;4855;4856;4857;4858;4859;4860;4861;4862;4863;4864;4865;4866	2414;2415;2416;2417;2418;2419;2420;2421;2422;2423;2424;2425;2426;2427;2428;2429;2430;2431;2432;2433;2434;2435;2436;2437;2438;2439;2440;2441;2442;2443;2444;2445;2446;2447;2448;2449;2450;2451;2452;2453;2454	2431		SLDLDSIIAEVK	1	0	0	2	0	0	1	0	0	2	2	1	0	0	0	2	0	0	0	1	0	12	0	1301.7078	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	no	no	2	7.235E-18	208.46	1	0	50	NaN	NaN		1	3	1	1	1	1	1	1	1	1	1	1	1	2	3	3	3	3	2	1	2	3					1	1	1	1	5	1	1	1	1																																				109090000	2376100	2399400	2975300	2526700	265190	412080	2952200	2502200	4009900	3822700	71563	86710	925560	949720	7289100	6862700	8359000	7524900	3749800	3977600	10200000	10211000	0	0	0	0	1484900	1376900	121720	150450	17519000	218410	252050	1759500	1756800		+
444	38	450	4867;4868;4869;4870;4871;4872;4873;4874;4875;4876;4877;4878;4879;4880;4881;4882;4883;4884	2455;2456;2457;2458;2459;2460;2461;2462;2463;2464	2462		SLKEISDGDVIISGNK	0	0	1	2	0	0	1	2	0	3	1	2	0	0	0	3	0	0	0	1	0	16	1	1673.8836	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	0.00011717	152.34	1	0	18	1	0	18	2	2	2	2									1	2	2	1					2	2														2	2	2	2									1	2	2	1					2	2														2385500	493280	493060	346400	381510	0	0	0	0	0	0	0	0	61965	138600	95049	48328	0	0	0	0	183610	143740	0	0	0	0	0	0	0	0	0	0	0	0	0		
445	16	451	4885;4886;4887;4888;4889;4890;4891;4892;4893	2465;2466;2467;2468;2469;2470;2471	2468		SLLEGEGSSGGGGR	0	1	0	0	0	0	2	6	0	0	2	0	0	0	0	3	0	0	0	0	0	14	0	1261.5899	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	2.8417E-124	158.42	1	0	9	1	0	9				1	1	1							1				1	1				1				1									1				1	1	1							1				1	1				1				1									1	368800	0	0	0	0	38375	49205	0	0	0	0	0	0	0	0	0	0	96288	82517	0	0	0	0	0	0	0	59107	0	0	0	0	0	0	0	0	43310		+
446	40	452	4894;4895;4896;4897;4898;4899;4900;4901;4902;4903;4904;4905;4906;4907;4908;4909;4910;4911;4912;4913;4914;4915;4916;4917;4918;4919;4920;4921;4922;4923;4924;4925;4926;4927;4928	2472;2473;2474;2475;2476;2477;2478;2479;2480;2481;2482;2483;2484;2485;2486;2487;2488;2489;2490;2491;2492;2493;2494;2495;2496;2497;2498;2499;2500;2501;2502;2503	2486		SLNNQFASFIDK	1	0	2	1	0	1	0	0	0	1	1	1	0	2	0	2	0	0	0	0	0	12	0	1382.683	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	no	no	2	2.1723E-26	231.92	1	0	35	NaN	NaN				1	1	1	1	1	1	1	1	1	1	2	2	2	1	1	2	1	1	1	2				1	1	1	1	1	1	1	1	1	1																																				60450000	0	0	1542500	1818400	1617800	1969900	1431500	1514900	1522400	1469800	1427100	1598500	2699300	3053400	1796300	1596200	5919000	5392400	1261300	836140	3034500	2800100	0	0	0	61351	652310	606480	460330	497340	5671500	502790	638950	3444000	3613300		+
447	40	453	4929;4930;4931;4932;4933;4934;4935;4936;4937;4938;4939;4940;4941;4942;4943;4944;4945;4946;4947;4948;4949;4950;4951;4952;4953;4954;4955;4956;4957;4958;4959;4960;4961;4962;4963;4964;4965;4966;4967;4968;4969;4970;4971;4972;4973;4974	2504;2505;2506;2507;2508;2509;2510;2511;2512;2513	2510		SLNNQFASFIDKVR	1	1	2	1	0	1	0	0	0	1	1	1	0	2	0	2	0	0	0	1	0	14	1	1637.8526	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	no	no	2,3	0.00034126	151.7	1	0	46	NaN	NaN		2	2	3	2		1	2	2	2	2			1	1	2	2	2	2	1	1	2	2					1	2			4			2	3																																				13460000	385660	420800	458800	505710	0	17145	706000	748250	266860	251400	0	0	61201	63679	306260	324140	1433200	1531500	178800	123290	758800	664680	0	0	0	0	243550	264240	0	0	3239900	0	0	219630	286140		+
448	84	454	4975;4976;4977;4978;4979;4980;4981;4982;4983;4984;4985;4986;4987	2514;2515;2516;2517;2518;2519;2520;2521;2522;2523;2524	2519		SLWVINSALR	1	1	1	0	0	0	0	0	0	1	2	0	0	0	0	2	0	1	0	1	0	10	0	1157.6557	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	3.2548E-18	215.06	1	0	13	1	0	13					1	1	1	1									1	1	1	1								1				1	1	1	1					1	1	1	1									1	1	1	1								1				1	1	1	1	4572600	0	0	0	0	33972	28723	72363	67249	0	0	0	0	0	0	0	0	1270700	1156500	680740	531580	0	0	0	0	0	0	0	0	0	0	0	136610	127600	235150	231380		
449	45	455	4988;4989;4990;4991	2525;2526;2527;2528	2526		SLYYYIQQDTK	0	0	0	1	0	2	0	0	0	1	1	1	0	0	0	1	1	0	3	0	0	11	0	1420.6874	P07355;A6NMY6	P07355	ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B	Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein	yes	no	2	7.4309E-25	137.89	1	0	4	1	0	4													1	1	1	1																																1	1	1	1																				277170	0	0	0	0	0	0	0	0	0	0	0	0	59155	69164	73639	75214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
450	33	456	4992	2529	2529		SMMCPPGMHK	0	0	0	0	1	0	0	1	1	0	0	1	3	0	2	1	0	0	0	0	0	10	0	1174.4756	O75592	O75592	KIAA0916;MYCBP2;PAM	Myc-binding protein 2;Pam/highwire/rpm-1 protein;Probable E3 ubiquitin-protein ligase MYCBP2;Protein associated with Myc	yes	yes	2	0.10335	6.8882	1	0	1	1	0	1																																		1																																			1		0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
451	33	457	4993;4994;4995;4996;4997;4998;4999;5000	2530	2530		SMMCPPGMHKWK	0	0	0	0	1	0	0	1	1	0	0	2	3	0	2	1	0	1	0	0	0	12	1	1488.6498	O75592	O75592	KIAA0916;MYCBP2;PAM	Myc-binding protein 2;Pam/highwire/rpm-1 protein;Probable E3 ubiquitin-protein ligase MYCBP2;Protein associated with Myc	yes	yes	2	0.10301	5.1538	1	0	8	1	0	8									1	1				1					1		1	1							1		1													1	1				1					1		1	1							1		1					2660400	0	0	0	0	0	0	0	0	262840	267940	0	0	0	239570	0	0	0	0	419470	0	568490	576860	0	0	0	0	0	0	63383	0	261850	0	0	0	0		
452	86	458	5001;5002;5003;5004;5005;5006;5007;5008;5009;5010;5011;5012;5013;5014;5015	2531;2532	2532		SNTLPISLQSIR	0	1	1	0	0	1	0	0	0	2	2	0	0	0	1	3	1	0	0	0	0	12	0	1327.746	P42704	P42704	LRP130;LRPPRC	130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial	yes	yes	2	0.0009181	140.14	1	0	15	1	0	15	1	1	1	1		1	1	1					1	1	1	1					1	1					1	1								1	1	1	1		1	1	1					1	1	1	1					1	1					1	1								1620300	245660	211790	248050	274980	0	30930	45669	43364	0	0	0	0	40174	39192	53607	60411	0	0	0	0	127160	138700	0	0	0	0	27996	32628	0	0	0	0	0	0	0		
453	38	459	5016;5017;5018;5019	2533	2533		SPSDCCHNQCAAGCTGPR	2	1	1	1	4	1	0	2	1	0	0	0	0	0	2	2	1	0	0	0	0	18	0	2033.756	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.063956	64.52	1	0	4	1	0	4	1	1																			1			1												1	1																			1			1												501020	217330	206560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46896	0	0	30232	0	0	0	0	0	0	0	0	0	0	0		
454	66	460	5020;5021;5022;5023;5024;5025;5026;5027;5028;5029;5030	2534;2535;2536;2537;2538;2539;2540	2540		SPSQVQVADFGVADLLPPDDK	2	0	0	4	0	2	0	1	0	0	2	1	0	1	3	2	0	0	0	3	0	21	0	2197.0903	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	1.2984E-10	161.51	1	0	11	1	0	11					1		1	1									1	1	1	1							1	1						1	1					1		1	1									1	1	1	1							1	1						1	1	7931100	0	0	0	0	33643	0	1594700	1623800	0	0	0	0	0	0	0	0	401070	347210	910970	680910	0	0	0	0	0	0	1077200	1129400	0	0	0	0	0	65506	66677		
455	54	461	5031;5032;5033;5034;5035;5036;5037;5038;5039;5040;5041;5042;5043;5044;5045;5046;5047;5048	2541;2542;2543;2544;2545;2546;2547;2548;2549	2548		SQIFSTASDNQPTVTIK	1	0	1	1	0	2	0	0	0	2	0	1	0	1	1	3	3	0	0	1	0	17	0	1835.9265	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2,3	9.7877E-16	184	1	0	18	1	0	18	2	2	2	1	1	1	1	2													2	2					1	1								2	2	2	1	1	1	1	2													2	2					1	1								2331100	341870	334370	295020	270900	94914	98262	101310	151070	0	0	0	0	0	0	0	0	0	0	0	0	264300	253290	0	0	0	0	54515	71294	0	0	0	0	0	0	0		
456	55	462	5049;5050;5051;5052;5053;5054;5055;5056;5057;5058;5059;5060;5061;5062;5063;5064;5065;5066;5067;5068;5069;5070;5071;5072;5073;5074;5075;5076;5077;5078;5079;5080;5081;5082;5083;5084;5085;5086;5087;5088;5089;5090;5091;5092;5093;5094;5095;5096;5097;5098;5099	2550;2551;2552;2553;2554;2555;2556;2557;2558;2559;2560;2561;2562;2563;2564;2565;2566;2567;2568	2554		SQIHDIVLVGGSTR	0	1	0	1	0	1	0	2	1	2	1	0	0	0	0	2	1	0	0	2	0	14	0	1480.7998	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	2,3	7.3291E-06	163.99	1	0	51	1	0	51	2	2	3	2	2	2	2	2	2	2	2	2	1	2	2	2		1		1	2	2	2	2		1	2	2			1			1	2	2	2	3	2	2	2	2	2	2	2	2	2	1	2	2	2		1		1	2	2	2	2		1	2	2			1			1	2	9060300	1083400	913790	1221000	1204700	210870	245460	317460	298310	97385	86108	103050	79663	50074	100670	128800	122010	0	25670	0	42822	976360	888280	138260	178450	0	28850	168700	179990	0	0	24446	0	0	61640	83971		
457	7	463	5100;5101;5102;5103;5104;5105;5106;5107;5108;5109;5110;5111;5112;5113;5114;5115;5116;5117;5118;5119;5120;5121;5122;5123;5124;5125;5126;5127;5128;5129;5130;5131;5132;5133	2569;2570;2571;2572;2573;2574;2575;2576;2577;2578;2579;2580;2581;2582;2583;2584;2585;2586;2587;2588;2589;2590;2591	2580		SSGSSYPSLLQCLK	0	0	0	0	1	1	0	1	0	0	3	1	0	0	1	5	0	0	1	0	0	14	0	1525.7446	CON__P00761	CON__P00761			yes	yes	2	0.0079928	125.82	1	0	34	1	0	34	1	1	1	1	1	1	1	1	1	1	1	1	1	2	1	1	1	1	1	1	1	1				1	1	1	1	1	1	1	2	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	2	1	1	1	1	1	1	1	1				1	1	1	1	1	1	1	2	1	1	21440000	728970	748750	953980	958660	313510	401210	693130	728730	633960	563480	455850	519530	726560	733220	588220	588840	833950	880170	1066700	895910	563120	526960	0	0	0	32010	815180	848610	364310	364020	654430	730110	795900	889470	842520		+
458	186	464	5134;5135;5136;5137;5138;5139;5140;5141;5142;5143;5144;5145	2592;2593;2594;2595;2596	2594		SSLPPLLIPPSENLGPHEEDQVVCGFK	0	0	1	1	1	1	3	2	1	1	4	1	0	1	5	3	0	0	0	2	0	27	0	2958.4797	Q9UJM3	Q9UJM3	ERRFI1;MIG6	ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein	yes	yes	3	3.5486E-08	100.59	1	0	12	1	0	12	1	1	1	1											1	1	1		1	1	1	1									1					1	1	1	1											1	1	1		1	1	1	1									1					14260000	1132700	987460	207420	219760	0	0	0	0	0	0	0	0	0	0	3722300	3698600	65244	0	385660	298090	1008600	918400	0	0	0	0	0	0	0	0	1615600	0	0	0	0		
459	98	465	5146;5147;5148	2597;2598	2598		STDYGIFQINSR	0	1	1	1	0	1	0	1	0	2	0	0	0	1	0	2	1	0	1	0	0	12	0	1399.6732	P61626	P61626	LYZ;LZM	1,4-beta-N-acetylmuramidase C;Lysozyme C	yes	yes	2	2.1279E-11	186.46	1	0	3	1	0	3											1	1										1																								1	1										1														358690	0	0	0	0	0	0	0	0	0	0	145780	125550	0	0	0	0	0	0	0	0	0	87369	0	0	0	0	0	0	0	0	0	0	0	0	0		
460	56	466	5149;5150;5151;5152;5153;5154;5155;5156	2599;2600;2601;2602;2603;2604;2605	2600		STLVLHDLLK	0	0	0	1	0	0	0	0	1	0	4	1	0	0	0	1	1	0	0	1	0	10	0	1137.6758	P11274;Q12979	P11274	BCR;BCR1;D22S11;ABR	Breakpoint cluster region protein;Renal carcinoma antigen NY-REN-26;Active breakpoint cluster region-related protein	yes	no	2	2.5211E-05	132.01	1	0	8	1	0	8													1	1	1	1													1	1	2																	1	1	1	1													1	1	2					465810	0	0	0	0	0	0	0	0	0	0	0	0	68340	56861	66810	73946	0	0	0	0	0	0	0	0	0	0	0	0	58361	50503	90990	0	0	0	0		
461	79	467	5157	2606	2606		STSSFSCLSR	0	1	0	0	1	0	0	0	0	0	1	0	0	1	0	5	1	0	0	0	0	10	0	1130.5026	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	no	2	0.096517	46.819	1	0	1	1	0	1																									1																																			1											0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
462	45	468	5158;5159;5160;5161;5162;5163;5164;5165;5166;5167;5168;5169	2607;2608;2609;2610;2611;2612;2613;2614	2609		STVHEILCK	0	0	0	0	1	0	1	0	1	1	1	1	0	0	0	1	1	0	0	1	0	9	0	1085.5539	P07355;A6NMY6	P07355	ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B	Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein	yes	no	2	0.0032667	111.95	1	0	12	1	0	12	1	1	1	1	1								1	1	1	1					1	1	1													1	1	1	1	1								1	1	1	1					1	1	1													999870	114920	145350	116110	128740	21470	0	0	0	0	0	0	0	72878	87264	83896	75987	0	0	0	0	65769	48548	38946	0	0	0	0	0	0	0	0	0	0	0	0		
463	171	469	5170;5171	2615	2615		SVAAFTADPLSLLR	3	1	0	1	0	0	0	0	0	0	3	0	0	1	1	2	1	0	0	1	0	14	0	1459.8035	Q96P48	Q96P48	ARAP1;CENTD2;KIAA0782	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;Centaurin-delta-2	yes	yes	2	0.12078	69.602	1	0	2	1	0	2															1	1																																		1	1																				125040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67723	57319	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
464	201	470	5172	2616	2616		SVQNWLR	0	1	1	0	0	1	0	0	0	0	1	0	0	0	0	1	0	1	0	1	0	7	0	901.477	REV__Q8IW35	REV__Q8IW35			yes	yes	2	0.063346	91.906	1	0	1	1	0	1																					1																																			1															100710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	100710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
465	78	471	5173;5174;5175;5176;5177;5178;5179;5180	2617;2618;2619;2620;2621;2622;2623;2624	2618		SVSAPQQIINPIR	1	1	1	0	0	2	0	0	0	3	0	0	0	0	2	2	0	0	0	1	0	13	0	1421.7991	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	2	4.7499E-07	172.11	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	2898000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	270900	289590	416820	401570	0	0	0	0	0	0	0	0	0	0	0	317620	305320	452850	443370		
466	22	472	5181;5182;5183;5184;5185;5186;5187;5188;5189;5190;5191;5192;5193;5194;5195;5196;5197;5198	2625;2626;2627;2628;2629	2625		SVVTVIDVFYK	0	0	0	1	0	0	0	0	0	1	0	1	0	1	0	1	1	0	1	4	0	11	0	1268.7016	CON__Q5D862;Q5D862	CON__Q5D862	FLG2;IFPS;FLG2;IFPS	Filaggrin-2;Intermediate filament-associated and psoriasis-susceptibility protein	yes	no	2	0.00035771	134.57	1	0	18	1	0	18							1	1	1	1					1	1	1	1	1	1	2	2					1				1			1	1							1	1	1	1					1	1	1	1	1	1	2	2					1				1			1	1	1749000	0	0	0	0	0	0	26921	32660	74017	73392	0	0	0	0	91707	78677	184980	187670	50320	37833	307620	261430	0	0	0	0	16076	0	0	0	246420	0	0	44944	34320		+
467	79	473	5199	2630	2630		TAAENDFVTLK	2	0	1	1	0	0	1	0	0	0	1	1	0	1	0	0	2	0	0	1	0	11	0	1207.6085	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	no	2	2.8774E-27	106.4	1	0	1	1	0	1																	1																																			1																			0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
468	26;167	474	5200;5201;5202;5203;5204;5205;5206;5207;5208;5209;5210;5211;5212;5213;5214	2631;2632;2633;2634;2635;2636;2637;2638;2639;2640;2641;2642;2643;2644;2645	2631		TAIEAFNETIK	2	0	1	0	0	0	2	0	0	2	0	1	0	1	0	0	2	0	0	0	0	11	0	1235.6398	O00459;P27986;Q92569	O00459	PIK3R2;GRB1;PIK3R1;PIK3R3	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta;Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;Phosphatidylinositol 3-kinase regulatory subunit alpha;p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma	no	no	2	1.8174E-07	175.15	1	0	15	NaN	NaN						1	1	1	1						1			1	1	1	1							1	1				1	1	1	1																																				18029000	0	0	0	0	199550	197470	295800	322800	0	0	0	0	0	17150	0	0	2513600	2383000	3771900	3649200	0	0	0	0	0	0	62933	54856	0	0	0	965800	826600	1360700	1407800		
469	89	475	5215;5216;5217;5218	2646;2647;2648;2649	2646		TALALEVGDIVK	2	0	0	1	0	0	1	1	0	1	2	1	0	0	0	0	1	0	0	2	0	12	0	1227.7075	P46109	P46109	CRKL	Crk-like protein	yes	yes	2	4.0348E-59	156.58	1	0	4	1	0	4																	1	1		1												1																				1	1		1												1				864150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	257870	247210	0	307230	0	0	0	0	0	0	0	0	0	0	0	51843	0	0	0		
470	26	476	5219;5220;5221;5222;5223;5224;5225;5226;5227;5228;5229;5230;5231;5232;5233;5234	2650;2651;2652;2653;2654;2655;2656;2657	2654		TATGFGFAEPYNLYGSLK	2	0	1	0	0	0	1	3	0	0	2	1	0	2	1	1	2	0	2	0	0	18	0	1934.9414	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	2.9203E-10	169.92	1	0	16	1	0	16							1	1							1	1	2	1	3	3								1						1	1							1	1							1	1	2	1	3	3								1						1	1	29634000	0	0	0	0	0	0	55449	80786	0	0	0	0	0	0	34463	37418	3448500	3390500	11999000	10118000	0	0	0	0	0	0	0	30967	0	0	0	0	0	219530	219830		
471	90	477	5235;5236;5237;5238	2658;2659	2658		TAVETAVLLLR	2	1	0	0	0	0	1	0	0	0	3	0	0	0	0	0	2	0	0	2	0	11	0	1184.7129	P49368	P49368	CCT3;CCTG;TRIC5	CCT-gamma;hTRiC5;T-complex protein 1 subunit gamma	yes	yes	2	0.034969	77.744	1	0	4	1	0	4	1	1	1	1																																1	1	1	1																																242550	70623	78266	46217	47448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
472	128	478	5239;5240;5241;5242;5243;5244;5245;5246;5247;5248;5249;5250;5251	2660;2661;2662;2663;2664;2665;2666;2667;2668;2669	2669		TCWLAAFR	2	1	0	0	1	0	0	0	0	0	1	0	0	1	0	0	1	1	0	0	0	8	0	1023.496	Q14451	Q14451	GRB7	B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7	yes	yes	2	0.00068554	132.57	1	0	13	1	0	13					1	1	1	1									1	1	1	1							1					1	1	1	1					1	1	1	1									1	1	1	1							1					1	1	1	1	1241600	0	0	0	0	84833	113880	154040	165970	0	0	0	0	0	0	0	0	76252	93122	121170	84606	0	0	0	0	0	0	57079	0	0	0	0	49501	59911	92742	88532		
473	38	479	5252;5253;5254;5255;5256;5257;5258;5259;5260;5261;5262;5263;5264;5265;5266;5267;5268;5269;5270;5271;5272;5273;5274;5275;5276;5277;5278;5279;5280;5281;5282;5283;5284;5285;5286;5287;5288;5289;5290;5291;5292;5293;5294;5295;5296;5297;5298;5299;5300;5301;5302;5303;5304;5305;5306;5307;5308;5309;5310;5311;5312;5313;5314;5315;5316;5317;5318;5319;5320;5321;5322;5323;5324;5325;5326;5327;5328;5329;5330;5331	2670;2671;2672;2673;2674;2675;2676;2677;2678;2679;2680;2681;2682;2683;2684;2685;2686;2687;2688;2689;2690;2691;2692;2693;2694;2695;2696;2697;2698;2699;2700;2701;2702;2703;2704;2705;2706;2707;2708;2709;2710;2711;2712;2713;2714;2715;2716;2717;2718;2719;2720;2721;2722	2670		TDLHAFENLEIIR	1	1	1	1	0	0	2	0	1	2	2	0	0	1	0	0	1	0	0	0	0	13	0	1569.8151	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	2.0609E-81	178.71	1	0	80	1	0	80	10	6	4	7	1		2	2					2	2	5	6	2	2	2	2	5	8					2	1	2	2	2	1		1	1	10	6	4	7	1		2	2					2	2	5	6	2	2	2	2	5	8					2	1	2	2	2	1		1	1	174640000	39614000	28011000	8123400	8463700	26090	0	361290	381990	0	0	0	0	884710	943390	16583000	16063000	515680	546520	2290400	1796100	22828000	22353000	0	0	0	0	258040	183880	129270	177800	3962200	26026	0	46212	68593		
474	26	480	5332;5333;5334;5335	2723;2724;2725;2726	2723		TDWSLSDVDQWDTAALADGIK	3	0	0	5	0	1	0	1	0	1	2	1	0	0	0	2	2	2	0	1	0	21	0	2306.0703	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2,3	1.9277E-22	198.42	1	0	4	1	0	4																			2	2																																		2	2																4994200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2443200	2551000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
475	54	481	5336;5337;5338;5339;5340;5341;5342;5343;5344;5345;5346	2727;2728;2729;2730;2731;2732;2733;2734	2732		TFAPEEISAMVLTK	2	0	0	0	0	0	2	0	0	1	1	1	1	1	1	1	2	0	0	1	0	14	0	1535.7905	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2,3	0.0007759	146.07	1	0	11	1	0	11	2	2	1	1			1	1													2	1														2	2	1	1			1	1													2	1														2056100	525330	441040	205580	180170	0	0	89266	59046	0	0	0	0	0	0	0	0	0	0	0	0	332200	223460	0	0	0	0	0	0	0	0	0	0	0	0	0		
476	140	482	5347;5348;5349;5350	2735	2735		TFVDFFSQCLHEEYR	0	1	0	1	1	1	2	0	1	0	1	0	0	3	0	1	1	0	1	1	0	15	0	1976.8727	Q53GQ0	Q53GQ0	HSD17B12	17-beta-hydroxysteroid dehydrogenase 12;3-ketoacyl-CoA reductase;Estradiol 17-beta-dehydrogenase 12	yes	yes	3	0.064142	74.46	1	0	4	1	0	4	1	1																			1	1														1	1																			1	1														447120	144320	132610	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	103610	66588	0	0	0	0	0	0	0	0	0	0	0	0	0		
477	69	483	5351;5352;5353;5354;5355;5356;5357;5358;5359	2736;2737	2736		TGAIVDVPVGEELLGR	1	1	0	1	0	0	2	3	0	1	2	0	0	0	1	0	1	0	0	3	0	16	0	1623.8832	P25705	P25705	ATP5A;ATP5A1;ATP5AL2;ATPM	ATP synthase subunit alpha, mitochondrial	yes	yes	2	0.036702	74.678	1	0	9	1	0	9	1	1	1	1			1	1													1	1					1									1	1	1	1			1	1													1	1					1									667440	97747	82630	100090	119750	0	0	50357	48430	0	0	0	0	0	0	0	0	0	0	0	0	80791	62721	0	0	0	0	24924	0	0	0	0	0	0	0	0		
478	130	484	5360;5361;5362;5363;5364;5365;5366;5367	2738;2739;2740;2741	2740		TGEAIVDAALSALR	4	1	0	1	0	0	1	1	0	1	2	0	0	0	0	1	1	0	0	1	0	14	0	1385.7514	Q15084	Q15084	PDIA6;TXNDC7	Protein disulfide isomerase P5;Protein disulfide-isomerase A6;Thioredoxin domain-containing protein 7	yes	yes	2,3	0.010459	98.942	1	0	8	1	0	8	2	2																			3	1														2	2																			3	1														702110	241150	220420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	189340	51199	0	0	0	0	0	0	0	0	0	0	0	0	0		
479	78	485	5368;5369;5370;5371;5372;5373;5374	2742;2743;2744;2745	2743		TGIAAEEVSLPR	2	1	0	0	0	0	2	1	0	1	1	0	0	0	1	1	1	0	0	1	0	12	0	1241.6616	P35568	P35568	IRS1	Insulin receptor substrate 1	yes	yes	2	0.005675	100.72	1	0	7	1	0	7																	2		1	1												1		1	1																	2		1	1												1		1	1	311060	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61026	0	48568	66652	0	0	0	0	0	0	0	0	0	0	0	35964	0	46474	52376		
480	26	486	5375;5376;5377;5378;5379;5380;5381	2746;2747;2748;2749;2750	2747		TGLDSESHYRPELPAPR	1	2	0	1	0	0	2	1	1	0	2	0	0	0	3	2	1	0	1	0	0	17	1	1923.9439	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	0.00088797	101.32	1	0	7	1	0	7																	1	1	1	1													1	1	1																	1	1	1	1													1	1	1	1963900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	280390	256760	529200	464340	0	0	0	0	0	0	0	0	0	0	0	0	112340	156470	164390		
481	25	487	5382;5383;5384;5385	2751;2752;2753;2754	2751		TGLIEVVLR	0	1	0	0	0	0	1	1	0	1	2	0	0	0	0	0	1	0	0	2	0	9	0	998.61243	O00329	O00329	PIK3CD	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform	yes	yes	2	0.00088014	124.92	1	0	4	1	0	4																	1	1	1	1																																1	1	1	1																217460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61736	55318	50814	49595	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
482	85	488	5386;5387	2755	2755		TGQLFHIDFGHILGNFK	0	0	1	1	0	1	0	3	2	2	2	1	0	3	0	0	1	0	0	0	0	17	0	1943.0054	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	3	0.0037571	83.692	1	0	2	1	0	2																			1	1																																		1	1																215270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	101130	114140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
483	65	489	5388;5389;5390;5391;5392;5393;5394	2756;2757;2758;2759;2760;2761	2756		TGTFCALSTVLER	1	1	0	0	1	0	1	1	0	0	2	0	0	1	0	1	3	0	0	1	0	13	0	1453.7235	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	2	0.0015108	142.08	1	0	7	1	0	7													1	1	1	1													1	1	1																	1	1	1	1													1	1	1					2585900	0	0	0	0	0	0	0	0	0	0	0	0	313330	387020	619600	608150	0	0	0	0	0	0	0	0	0	0	0	0	154960	140810	362080	0	0	0	0		
484	35	490	5395;5396;5397;5398;5399;5400;5401;5402	2762;2763;2764	2764		THIDTVINALK	1	0	1	1	0	0	0	0	1	2	1	1	0	0	0	0	2	0	0	1	0	11	0	1223.6874	O95782	O95782	ADTAA;AP2A1;CLAPA1	100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit	yes	yes	2	0.0068122	96.229	1	0	8	1	0	8	1	1	1										1	1	1	1													1							1	1	1										1	1	1	1													1							475630	53394	61261	41137	0	0	0	0	0	0	0	0	0	66476	69589	80573	74788	0	0	0	0	0	0	0	0	0	0	0	0	28410	0	0	0	0	0	0		
485	40	491	5403;5404;5405;5406;5407;5408;5409;5410;5411;5412;5413;5414;5415	2765;2766;2767;2768;2769;2770;2771;2772;2773;2774;2775;2776	2775		THNLEPYFESFINNLR	0	1	3	0	0	0	2	0	1	1	2	0	0	2	1	1	1	0	1	0	0	16	0	1992.9694	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2,3	2.1038E-08	178.15	1	0	13	1	0	13	1	1							1	1					1	1	1		1	1	1	1									2					1	1							1	1					1	1	1		1	1	1	1									2					13029000	398250	412090	0	0	0	0	0	0	511580	444570	0	0	0	0	1096600	1054300	39389	0	514350	383320	1989500	1830800	0	0	0	0	0	0	0	0	4354300	0	0	0	0		+
486	40	492	5416;5417;5418;5419;5420;5421;5422;5423;5424;5425;5426	2777;2778	2777		THNLEPYFESFINNLRR	0	2	3	0	0	0	2	0	1	1	2	0	0	2	1	1	1	0	1	0	0	17	1	2149.0705	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	3	0.0098668	84.753	1	0	11	1	0	11	1	1							1	1					1	1			1	1	1	1									1					1	1							1	1					1	1			1	1	1	1									1					2582100	129350	115330	0	0	0	0	0	0	158190	115850	0	0	0	0	315980	297830	0	0	109590	106250	355630	299850	0	0	0	0	0	0	0	0	578260	0	0	0	0		+
487	5;150	493	5427;5428	2779	2779		TIGGGDDSFNTFFSETGAGK	1	0	1	2	0	0	1	5	0	1	0	1	0	3	0	2	3	0	0	0	0	20	0	2006.8858	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain	no	no	2	2.116E-07	138.66	1	0	2	NaN	NaN				1	1																																																																			804240	0	0	411350	392890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
488	38	494	5429;5430;5431;5432;5433;5434;5435	2780;2781;2782	2781		TIQEVAGYVLIALNTVER	2	1	1	0	0	1	2	1	0	2	2	0	0	0	0	0	2	0	1	3	0	18	0	1988.0942	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	3	0.00039181	121.99	1	0	7	1	0	7	1	1													1	1					1	1									1					1	1													1	1					1	1									1					1114400	154130	120010	0	0	0	0	0	0	0	0	0	0	0	0	207900	170930	0	0	0	0	231240	197520	0	0	0	0	0	0	0	0	32658	0	0	0	0		
489	150	495	5436;5437;5438;5439;5440;5441;5442;5443;5444;5445	2783;2784;2785	2783		TIQFVDWCPTGFK	0	0	0	1	1	1	0	1	0	1	0	1	0	2	1	0	2	1	0	1	0	13	0	1597.7599	Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65	Q71U36	TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2	Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain	yes	no	2	0.00017078	157.56	1	0	10	1	0	10	1	1	1	1			1	1							1	1					1	1														1	1	1	1			1	1							1	1					1	1														1617500	385040	375110	228310	167730	0	0	39249	50252	0	0	0	0	0	0	79381	84470	0	0	0	0	121200	86784	0	0	0	0	0	0	0	0	0	0	0	0	0		
490	51	496	5446	2786	2786		TITLEVEPSDTIENVK	0	0	1	1	0	0	3	0	0	2	1	1	0	0	1	1	3	0	0	2	0	16	0	1786.92	P0CG48;P0CG47;P62979;P62987	P0CG48	RPS27A;UBA80;UBCEP1;UBA52;UBCEP2	40S ribosomal protein S27a;60S ribosomal protein L40;CEP52	yes	no	2	0.077503	50.843	1	0	1	1	0	1																				1																																			1																67380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
491	26	497	5447;5448;5449;5450;5451;5452;5453	2787;2788;2789;2790;2791	2787		TKLEQQLR	0	1	0	0	0	2	1	0	0	0	2	1	0	0	0	0	1	0	0	0	0	8	1	1014.5822	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	2	0.00032688	139.88	1	0	7	1	0	7																	1	1	1	1													1	1	1																	1	1	1	1													1	1	1	812070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	125250	127580	184830	185130	0	0	0	0	0	0	0	0	0	0	0	0	43729	72190	73354		
492	54	498	5454;5455;5456;5457;5458;5459;5460;5461;5462	2792;2793	2793		TKPYIQVDIGGGQTK	0	0	0	1	0	2	0	3	0	2	0	2	0	0	1	0	2	0	1	1	0	15	1	1603.857	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	3	0.0087674	95.273	1	0	9	1	0	9	1	1	1	1	1	1	1														1	1														1	1	1	1	1	1	1														1	1														479190	62468	91005	69266	54821	47101	28550	38348	0	0	0	0	0	0	0	0	0	0	0	0	0	53427	34202	0	0	0	0	0	0	0	0	0	0	0	0	0		
493	158	499	5463;5464;5465;5466;5467	2794;2795;2796	2796		TLDTIQLAFK	1	0	0	1	0	1	0	0	0	1	2	1	0	1	0	0	2	0	0	0	0	10	0	1148.6441	Q8NF37	Q8NF37	AYTL2;LPCAT1;PFAAP3	1-acylglycerophosphocholine O-acyltransferase;1-alkylglycerophosphocholine O-acetyltransferase;Acetyl-CoA:lyso-platelet-activating factor acetyltransferase;Acyltransferase-like 2;Lysophosphatidylcholine acyltransferase 1;Phosphonoformate immuno-associated protein 3	yes	yes	2	0.043728	77.192	1	0	5	1	0	5	1	1	1	1																		1														1	1	1	1																		1														317160	77938	80560	47089	69757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41811	0	0	0	0	0	0	0	0	0	0	0	0	0		
494	19	500	5468;5469;5470;5471;5472;5473;5474;5475;5476;5477;5478;5479;5480;5481;5482;5483;5484;5485;5486;5487;5488;5489;5490;5491;5492;5493;5494;5495;5496;5497;5498;5499;5500;5501	2797;2798;2799;2800;2801;2802;2803;2804;2805;2806;2807;2808;2809;2810;2811;2812;2813;2814;2815;2816;2817;2818;2819;2820;2821;2822	2815		TLLDIDNTR	0	1	1	2	0	0	0	0	0	1	2	0	0	0	0	0	2	0	0	0	0	9	0	1059.556	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	2	3.8711E-05	136.57	1	0	34	1	0	34	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	2	1	1	1			1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	2	1	1	1			1	1	1	1	1	1	1	1	1	1	1	8775400	66800	60062	202890	166840	205490	174600	144310	149490	252390	261630	330440	285640	393380	472230	92715	79075	591990	515090	227870	209800	370420	387120	0	0	422640	368640	107820	92723	196350	208340	493250	149900	148000	476770	470700		+
495	40	501	5502;5503;5504;5505;5506;5507;5508;5509;5510;5511;5512;5513;5514;5515;5516;5517;5518;5519;5520;5521;5522;5523;5524;5525;5526;5527;5528	2823;2824;2825;2826;2827;2828;2829;2830	2829		TLLEGEESR	0	1	0	0	0	0	3	1	0	0	2	0	0	0	0	1	1	0	0	0	0	9	0	1032.5088	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	no	no	2	5.3569E-08	147.19	1	0	27	NaN	NaN				1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1			1	1		1	1	1	1				1																																				3235200	0	0	93293	105160	135240	142800	62684	50936	85583	77304	97631	121320	100940	111730	80209	101700	253590	229140	71406	68199	229480	199160	0	0	137460	135550	0	34273	95082	97929	202900	0	0	0	114490		+
496	191	502	5529;5530;5531;5532;5533;5534;5535;5536	2831	2831		TLNDDASPPLPYLR	1	1	1	2	0	0	0	0	0	0	3	0	0	0	3	1	1	0	1	0	0	14	0	1570.7991	REV__E9PKD4	REV__E9PKD4			yes	yes	3	0.057161	76.326	1	0	8	1	0	8	1	1	1	1											1	1					1	1														1	1	1	1											1	1					1	1														925580	163070	144160	169280	163600	0	0	0	0	0	0	0	0	0	0	52859	74395	0	0	0	0	58578	99638	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
497	19	503	5537;5538;5539;5540;5541;5542;5543;5544;5545;5546;5547;5548;5549	2832;2833	2833	5	TLNDMRQEYEQLIAK	1	1	1	1	0	2	2	0	0	1	2	1	1	0	0	0	1	0	1	0	0	15	1	1850.9196	CON__P35527;P35527	CON__P35527	KRT9;KRT9	Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9	yes	no	3	0.032706	81.431	1	0	13	1	0	13			1	1				1					1	1			1	1				1							1	1	1			1	1			1	1				1					1	1			1	1				1							1	1	1			1	1	755190	0	0	35815	41120	0	0	0	22252	0	0	0	0	92253	80568	0	0	73246	63034	0	0	0	45348	0	0	0	0	0	0	48720	38962	27141	0	0	95884	90844		+
498	40	504	5550;5551;5552;5553;5554;5555;5556;5557;5558;5559;5560;5561;5562;5563;5564;5565;5566;5567;5568;5569;5570	2834;2835;2836;2837;2838;2839;2840;2841;2842;2843;2844;2845;2846;2847;2848;2849;2850	2843		TNAENEFVTIK	1	0	2	0	0	0	2	0	0	1	0	1	0	1	0	0	2	0	0	1	0	11	0	1264.6299	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	4.842E-08	156.58	1	0	21	1	0	21					1	1			1	1	1	1	1	1	1		1	1	1		1	1			1	1			1	1	1			1	1					1	1			1	1	1	1	1	1	1		1	1	1		1	1			1	1			1	1	1			1	1	1429100	0	0	0	0	66376	55820	0	0	47920	0	82565	79817	59321	63903	34703	0	145850	137880	31745	0	101310	89320	0	0	47019	51943	0	0	28683	28720	124490	0	0	70505	81206		+
499	40	505	5571	2851	2851		TNAENEFVTIKK	1	0	2	0	0	0	2	0	0	1	0	2	0	1	0	0	2	0	0	1	0	12	1	1392.7249	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	0.00013366	67.385	1	0	1	1	0	1																	1																																			1																			0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
500	38	506	5572;5573;5574;5575;5576;5577;5578;5579;5580;5581;5582;5583;5584;5585;5586;5587;5588;5589;5590;5591;5592;5593;5594;5595;5596;5597;5598;5599;5600;5601;5602;5603;5604;5605;5606;5607;5608;5609;5610;5611;5612	2852;2853;2854;2855;2856;2857;2858;2859;2860;2861;2862;2863;2864;2865;2866;2867;2868;2869;2870;2871	2862		TPLLSSLSATSNNSTVACIDR	2	1	2	1	1	0	0	0	0	1	3	0	0	0	1	5	3	0	0	1	0	21	0	2206.09	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2,3	2.1008E-67	260.96	1	0	41	1	0	41	4	4	3	2			2	2					2	2	2	2	2	2	1	2	2	3						2			2					4	4	3	2			2	2					2	2	2	2	2	2	1	2	2	3						2			2					160830000	34030000	63481000	6208200	4292100	0	0	208070	221990	0	0	0	0	413860	345410	7986100	8199800	227530	205500	400850	684700	18066000	13812000	0	0	0	0	0	164920	0	0	1881900	0	0	0	0		
501	82	507	5613;5614	2872	2872		TQIQSVEPYTK	0	0	0	0	0	2	1	0	0	1	0	1	0	0	1	1	2	0	1	1	0	11	0	1292.6612	P40763	P40763	APRF;STAT3	Acute-phase response factor;Signal transducer and activator of transcription 3	yes	yes	2	0.14904	60.434	1	0	2	1	0	2																																		1	1																																		1	1	372600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	202930	169670		
502	122	508	5615;5616;5617;5618;5619;5620;5621	2873;2874;2875	2875		TRPACQDWTVPLPASAGR	3	2	0	1	1	1	0	1	0	0	1	0	0	0	3	1	2	1	0	1	0	18	1	1981.9792	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	3	0.026172	72.315	1	0	7	1	0	7													1	1	1	1													1	1	1																	1	1	1	1													1	1	1					1628900	0	0	0	0	0	0	0	0	0	0	0	0	369130	340230	386330	365600	0	0	0	0	0	0	0	0	0	0	0	0	33360	40022	94211	0	0	0	0		
503	55;52;64	509	5622;5623;5624;5625;5626;5627;5628;5629;5630;5631	2876;2877;2878;2879;2880	2876		TTPSYVAFTDTER	1	1	0	1	0	0	1	0	0	0	0	0	0	1	1	1	4	0	1	1	0	13	0	1486.694	P0DMV8;P0DMV9;P11142;P54652;P17066;P48741	P11142	HSC70;HSP73;HSPA10;HSPA8;HSPA2;HSP70B;HSPA6;HSP70B;HSPA7	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7	no	no	2	0.0051653	119.39	1	0	10	NaN	NaN		1	1	1	1		1	1	1													1	1						1																																											1593900	317340	308720	254850	258530	0	35799	61291	45836	0	0	0	0	0	0	0	0	0	0	0	0	147640	132080	0	0	0	0	0	31816	0	0	0	0	0	0	0		
504	55	510	5632;5633;5634;5635;5636;5637;5638;5639;5640;5641;5642;5643;5644;5645;5646;5647;5648;5649;5650;5651;5652;5653;5654;5655;5656;5657;5658;5659;5660;5661;5662;5663;5664;5665;5666	2881;2882;2883;2884;2885;2886;2887;2888;2889;2890;2891;2892;2893;2894;2895;2896;2897;2898;2899	2896		TVTNAVVTVPAYFNDSQR	2	1	2	1	0	1	0	0	0	0	0	0	0	1	1	1	3	0	1	4	0	18	0	1980.9905	P11142	P11142	HSC70;HSP73;HSPA10;HSPA8	Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein	yes	yes	2,3	2.433E-07	162.81	1	0	35	1	0	35	2	2	2	2	2	2	2	2		2			1	1	2	1	1			1	2	2					2	2							2	2	2	2	2	2	2	2	2		2			1	1	2	1	1			1	2	2					2	2							2	10438000	1782400	1785800	1378900	1604400	139930	163700	279400	339290	0	103810	0	0	42301	42462	168050	95735	43207	0	0	26102	972170	922470	0	0	0	0	239570	203500	0	0	0	0	0	0	104620		
505	117	511	5667;5668;5669;5670;5671;5672	2900	2900		TVWQYHFR	0	1	0	0	0	1	0	0	1	0	0	0	0	1	0	0	1	1	1	1	0	8	0	1135.5563	Q06124	Q06124	PTP2C;PTPN11;SHPTP2	Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11	yes	yes	2	0.036183	94.302	1	0	6	1	0	6																	1	1	1	1													1		1																	1	1	1	1													1		1	301020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57852	37105	70334	60924	0	0	0	0	0	0	0	0	0	0	0	0	26183	0	48622		
506	126	512	5673	2901	2901		TWELSKQWSEK	0	0	0	0	0	1	2	0	0	0	1	2	0	0	0	2	1	2	0	0	0	11	1	1420.6987	Q13946	Q13946	PDE7A	HCP1;High affinity cAMP-specific 3,5-cyclic phosphodiesterase 7A;TM22	yes	yes	2	0.081067	56.404	1	0	1	1	0	1																	1																																			1																			0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
507	167	513	5674;5675;5676;5677	2902;2903	2902		TWFVEDINR	0	1	1	1	0	0	1	0	0	1	0	0	0	1	0	0	1	1	0	1	0	9	0	1178.572	Q92569	Q92569	PIK3R3	p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma	yes	yes	2	0.010688	95.502	1	0	4	1	0	4					1	1	1													1																				1	1	1													1																374350	0	0	0	0	70211	62214	187200	0	0	0	0	0	0	0	0	0	0	0	0	54721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
508	54	514	5678;5679;5680;5681;5682;5683;5684	2904;2905;2906	2906		TWNDPSVQQDIK	0	0	1	2	0	2	0	0	0	1	0	1	0	0	1	1	1	1	0	1	0	12	0	1429.6838	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.0021398	121.02	1	0	7	1	0	7	1	1	1	1		1															1	1														1	1	1	1		1															1	1														491040	106670	100390	64345	73920	0	37250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60074	48384	0	0	0	0	0	0	0	0	0	0	0	0	0		
509	68	515	5685;5686;5687	2907;2908	2907		VALLDVFR	1	1	0	1	0	0	0	0	0	0	2	0	0	1	0	0	0	0	0	2	0	8	0	931.5491	P25205	P25205	MCM3	DNA polymerase alpha holoenzyme-associated protein P1;DNA replication licensing factor MCM3;p102;P1-MCM3;RLF subunit beta	yes	yes	2	0.0082011	91.906	1	0	3	1	0	3		1													1	1																					1													1	1																				73961	0	34911	0	0	0	0	0	0	0	0	0	0	0	0	39050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
510	188	516	5688;5689;5690;5691;5692;5693;5694;5695	2909;2910	2910		VALLPAGGALQHSR	3	1	0	0	0	1	0	2	1	0	3	0	0	0	1	1	0	0	0	1	0	14	0	1388.7888	Q9Y4H2	Q9Y4H2	IRS2	Insulin receptor substrate 2	yes	yes	3	0.047612	78.342	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	1266800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	125310	96905	191670	180600	0	0	0	0	0	0	0	0	0	0	0	125640	125230	191760	229720		
511	102	517	5696;5697;5698;5699;5700;5701;5702	2911;2912;2913	2911		VANVSLLALYK	2	0	1	0	0	0	0	0	0	0	3	1	0	0	0	1	0	0	1	2	0	11	0	1189.7071	P62266	P62266	RPS23	40S ribosomal protein S23	yes	yes	2	0.00075827	119.27	1	0	7	1	0	7	1	1	1	1											1						1	1														1	1	1	1											1						1	1														350830	48213	61472	52534	46212	0	0	0	0	0	0	0	0	0	0	34052	0	0	0	0	0	47762	60583	0	0	0	0	0	0	0	0	0	0	0	0	0		
512	38	518	5703;5704;5705;5706;5707;5708;5709;5710;5711;5712;5713;5714	2914;2915;2916;2917;2918;2919;2920;2921	2917		VAPQSSEFIGA	2	0	0	0	0	1	1	1	0	1	0	0	0	1	1	2	0	0	0	1	0	11	0	1104.5451	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.019915	86.898	1	0	12	1	0	12	1	1	1	1									1	1	1	1			1										1	1	1					1	1	1	1									1	1	1	1			1										1	1	1					1427500	127260	105900	101480	92234	0	0	0	0	0	0	0	0	157120	183260	255610	219030	0	0	27030	0	0	0	0	0	0	0	0	0	48820	50715	59037	0	0	0	0		
513	7	519	5715;5716;5717;5718;5719;5720;5721;5722;5723;5724;5725;5726;5727;5728;5729;5730;5731;5732;5733	2922	2922		VATVSLPR	1	1	0	0	0	0	0	0	0	0	1	0	0	0	1	1	1	0	0	2	0	8	0	841.50215	CON__P00761	CON__P00761			yes	yes	1	0.091971	84.244	1	0	19	1	0	19	1	1	1	1	1	1			1	1	1			1	1		1			1	1	1		1					1	1	1					1	1	1	1	1	1			1	1	1			1	1		1			1	1	1		1					1	1	1					17396000	1140000	1123800	1381000	1381100	691210	680220	0	0	780580	996240	1091400	0	0	748530	846990	0	564750	0	0	835800	839630	836290	0	673320	0	0	0	0	683080	642860	1459100	0	0	0	0		+
514	66	520	5734;5735;5736;5737;5738;5739	2923	2923		VCDPLCSSGGCWGPGPGQCLSCR	0	1	0	1	5	1	0	5	0	0	2	0	0	0	3	3	0	1	0	1	0	23	0	2566.028	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	3	5.0544E-17	175.51	1	0	6	1	0	6							1	1										1	1								1	1														1	1										1	1								1	1								1204200	0	0	0	0	0	0	297310	352960	0	0	0	0	0	0	0	0	0	63072	100110	0	0	0	0	0	0	0	205510	185270	0	0	0	0	0	0	0		
515	38	521	5740;5741;5742;5743;5744	2924;2925	2925		VCNGIGIGEFK	0	0	1	0	1	0	1	3	0	2	0	1	0	1	0	0	0	0	0	1	0	11	0	1192.591	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.00044575	134.57	1	0	5	1	0	5	1	1	1	1																	1															1	1	1	1																	1															507440	142420	136800	90926	99729	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37556	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
516	7	522	5745;5746;5747;5748;5749;5750;5751;5752;5753;5754;5755	2926;2927;2928;2929;2930;2931;2932;2933;2934;2935;2936	2934		VCNYVNWIQQTIAAN	2	0	3	0	1	2	0	0	0	2	0	0	0	0	0	0	1	1	1	2	0	15	0	1792.8567	CON__P00761	CON__P00761			yes	yes	2	1.7513E-40	248.64	1	0	11	1	0	11	1	1							1	1					1	1			1	1	1	1									1					1	1							1	1					1	1			1	1	1	1									1					20143000	2031800	1689800	0	0	0	0	0	0	304000	303940	0	0	0	0	3100200	3091300	0	0	1881200	1728100	2511900	2226800	0	0	0	0	0	0	0	0	1274100	0	0	0	0		+
517	79	523	5756;5757;5758;5759;5760;5761;5762;5763;5764;5765;5766;5767;5768;5769;5770;5771;5772;5773;5774;5775;5776;5777;5778;5779;5780;5781;5782;5783	2937;2938;2939;2940;2941;2942;2943;2944;2945;2946;2947;2948;2949;2950;2951;2952;2953;2954;2955;2956;2957;2958	2953		VDLLNQEIEFLK	0	0	1	1	0	1	2	0	0	1	3	1	0	1	0	0	0	0	0	1	0	12	0	1459.7922	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	no	2	2.7689E-35	237.53	1	0	28	1	0	28	1	1	1	1	1	1	1	1	1	1			1	1	1	1	3	1	1	1	1	1					1	1			2			1	1	1	1	1	1	1	1	1	1	1	1			1	1	1	1	3	1	1	1	1	1					1	1			2			1	1	22339000	375230	352960	733640	717040	47442	112230	359270	329880	530590	548920	0	0	148650	146670	1209400	1064800	2314000	1986400	824210	821240	2200100	1967600	0	0	0	0	347690	297620	0	0	4205500	0	0	336260	361880		+
518	198	524	5784;5785	2959	2959		VDQLSGMEEKR	0	1	0	1	0	1	2	1	0	0	1	1	1	0	0	1	0	0	0	1	0	11	1	1290.6238	REV__Q6ZU80	REV__Q6ZU80			yes	yes	2	0.088848	79.974	1	0	2	1	0	2			1	1																																		1	1																																1025200	0	0	446400	578790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	+	
519	119	525	5786;5787;5788;5789	2960;2961;2962	2961		VEEQEPELTSTPNFVVEVIK	0	0	1	0	0	1	5	0	0	1	1	1	0	1	2	1	2	0	0	4	0	20	0	2286.1631	Q07021	Q07021	C1QBP;GC1QBP;HABP1;SF2P32	Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33	yes	yes	2,3	3.7208E-06	109.04	1	0	4	1	0	4									2	2																																		2	2																										8298800	0	0	0	0	0	0	0	0	4150000	4148700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
520	64	526	5790;5791;5792;5793;5794;5795;5796;5797;5798	2963;2964;2965;2966;2967	2963		VEILANDQGNR	1	1	2	1	0	1	1	1	0	1	1	0	0	0	0	0	0	0	0	1	0	11	0	1227.6208	P17066;P48741	P17066	HSP70B;HSPA6;HSP70B;HSPA7	Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7	yes	no	2	0.00013774	145.99	1	0	9	1	0	9	1	1	1	1	1																1	1	1	1												1	1	1	1	1																1	1	1	1												817460	125750	108350	101550	122220	30258	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	62951	77743	110560	78075	0	0	0	0	0	0	0	0	0	0	0		
521	168	527	5799;5800;5801;5802	2968	2968		VETQPEVQLPGPAPNLR	1	1	1	0	0	2	2	1	0	0	2	0	0	0	4	0	1	0	0	2	0	17	0	1843.9792	Q92859	Q92859	IGDCC2;NEO1;NGN	Immunoglobulin superfamily DCC subclass member 2;Neogenin	yes	yes	3	0.055442	65.472	1	0	4	1	0	4															1	1			1												1																			1	1			1												1					492810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	169600	195980	0	0	54551	0	0	0	0	0	0	0	0	0	0	0	72677	0	0	0	0		
522	85	528	5803;5804	2969;2970	2970		VEYVFGDHPLIQFQYIR	0	1	0	1	0	2	1	1	1	2	1	0	0	2	1	0	0	0	2	2	0	17	0	2123.084	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	3	0.00090246	111.12	1	0	2	1	0	2																			1	1																																		1	1																657850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	356920	300920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
523	85	529	5805;5806;5807;5808;5809;5810;5811;5812;5813;5814;5815;5816;5817	2971;2972;2973;2974;2975;2976;2977;2978;2979;2980;2981;2982	2977		VFGEDSVGVIFK	0	0	0	1	0	0	1	2	0	1	0	1	0	2	0	1	0	0	0	3	0	12	0	1295.6762	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2	1.8235E-11	188.28	1	0	13	1	0	13					1	1	1	1									1	1	1	1							1					1	1	1	1					1	1	1	1									1	1	1	1							1					1	1	1	1	3538500	0	0	0	0	0	49157	83959	94229	0	0	0	0	0	0	0	0	506940	408620	583100	444210	0	0	0	0	0	0	49611	0	0	0	0	163390	155050	467180	533030		
524	104	530	5818;5819;5820;5821;5822;5823;5824;5825;5826	2983	2983		VFLENVIR	0	1	1	0	0	0	1	0	0	1	1	0	0	1	0	0	0	0	0	2	0	8	0	988.57057	P62805	P62805	H4/A;H4/B;H4/C;H4/D;H4/E;H4/G;H4/H;H4/I;H4/J;H4/K;H4/M;H4/N;H4/O;H4F2;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4FO;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4	Histone H4	yes	yes	2	0.065911	88.942	1	0	9	1	0	9	1											1	1	1			1				1								1	1	1					1											1	1	1			1				1								1	1	1					472350	26310	0	0	0	0	0	0	0	0	0	0	26437	77177	105550	0	0	41589	0	0	0	36270	0	0	0	0	0	0	0	52692	63848	42483	0	0	0	0		
525	59	531	5827	2984	2984		VFSGLVSTGLK	0	0	0	0	0	0	0	2	0	0	2	1	0	1	0	2	1	0	0	2	0	11	0	1106.6336	P13639	P13639	EEF2;EF2	Elongation factor 2	yes	yes	2	6.7146E-06	68.893	1	0	1	1	0	1	1																																			1																																			0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
526	5;150;109	532	5828;5829;5830;5831;5832;5833;5834	2985;2986;2987	2986		VGINYQPPTVVPGGDLAK	1	0	1	1	0	1	0	3	0	1	1	1	0	0	3	0	1	0	1	3	0	18	0	1823.9781	CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65;P68366	CON__ENSEMBL:ENSBTAP00000016242	TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A	Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha	no	no	2	0.0012176	91.355	1	0	7	NaN	NaN		1	1	1	1			1						1			1																																																							837370	129870	121010	228800	231240	0	0	34710	0	0	0	0	0	44660	0	0	47084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
527	88	533	5835;5836;5837;5838;5839	2988	2988		VIFFLPWQK	0	0	0	0	0	1	0	0	0	1	1	1	0	2	1	0	0	1	0	1	0	9	0	1176.6696	P43304	P43304	GPD2	Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD	yes	yes	2	0.034641	86.794	1	0	5	1	0	5	1	1													1	1															1					1	1													1	1															1					375620	142120	131110	0	0	0	0	0	0	0	0	0	0	0	0	38905	43579	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19896	0	0	0	0		
528	47;48	534	5840;5841;5842	2989	2989		VILHLKEDQTEYLEER	0	1	0	1	0	1	4	0	1	1	3	1	0	0	0	0	1	0	1	1	0	16	1	2014.0371	P07900;Q58FF7;Q58FF6;P08238	P07900	HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AB3P;HSP90BC;HSP90AB4P;HSP90AB1;HSP90B;HSPC2;HSPCB	Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-beta c;Putative heat shock protein HSP 90-beta-3;Putative heat shock protein HSP 90-beta 4;Heat shock 84 kDa;Heat shock protein HSP 90-beta	no	no	3	0.026164	76.262	1	0	3	NaN	NaN		1	1																									1																																												227870	105560	98810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23492	0	0	0	0	0	0	0	0		
529	65	535	5843;5844;5845	2990	2990		VKAEGILDVFQTVK	1	0	0	1	0	1	1	1	0	1	1	2	0	1	0	0	1	0	0	3	0	14	1	1545.8766	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	3	0.0163	91.858	1	0	3	1	0	3															1	1															1																			1	1															1					189200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54231	66189	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68781	0	0	0	0		
530	204	536	5846;5847;5848;5849;5850;5851;5852;5853;5854;5855;5856	2991;2992;2993;2994;2995;2996;2997	2995		VKTEAPVR	1	1	0	0	0	0	1	0	0	0	0	1	0	0	1	0	1	0	0	2	0	8	1	898.52362	REV__Q8WXI4	REV__Q8WXI4			yes	yes	2	0.084877	85.212	1	0	11	1	0	11			1			1								1			1			1	1		1							2	1	1						1			1								1			1			1	1		1							2	1	1				111250000	0	0	17570000	0	0	11691000	0	0	0	0	0	0	0	15158000	0	0	11988000	0	0	13067000	17342000	0	12670000	0	0	0	0	0	0	11606000	80891	77825	0	0	0	+	
531	8;15;13	537	5857;5858;5859;5860;5861;5862;5863;5864;5865;5866;5867;5868;5869;5870;5871;5872;5873;5874;5875;5876;5877;5878;5879;5880;5881;5882;5883;5884;5885	2998;2999;3000;3001;3002;3003;3004;3005;3006;3007;3008;3009;3010;3011;3012	3001		VLDELTLAR	1	1	0	1	0	0	1	0	0	0	3	0	0	0	0	0	1	0	0	1	0	9	0	1028.5866	CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P02533;P02533;CON__A2A4G1;CON__Q6IFX2;CON__P08779;P08779	CON__P02533	Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;KRT14;KRT14;Ka22;Krt42;KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-42;Keratin, type I cytoskeletal 42;Keratin-17n;Keratin-42;Type I keratin Ka22;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16	no	no	2	1.4963E-09	168.27	1	0	29	NaN	NaN		1	1	1	1	1	1	1		1	1	1	1	1	1	1	1	1	1	1		1	1			1	1	1		1	1	1	1		1	1																																				4287000	91710	79807	270190	302470	134430	146330	36203	0	139470	126740	276630	272710	158430	148050	110320	116510	172580	150710	39064	0	184570	222270	0	0	100530	97572	44463	0	110570	104920	320100	30033	0	175000	124670		+
532	16	538	5886;5887;5888;5889;5890;5891;5892;5893;5894;5895;5896;5897;5898;5899;5900;5901;5902;5903;5904;5905;5906;5907;5908;5909;5910;5911;5912;5913;5914;5915;5916;5917;5918;5919	3013;3014;3015;3016;3017;3018;3019;3020;3021;3022;3023;3024;3025;3026;3027;3028;3029;3030;3031;3032;3033;3034;3035;3036;3037;3038;3039;3040;3041;3042;3043;3044	3024		VLDELTLTK	0	0	0	1	0	0	1	0	0	0	3	1	0	0	0	0	2	0	0	1	0	9	0	1030.591	CON__P13645;P13645	CON__P13645	KPP;KRT10;KPP;KRT10	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10	yes	no	2	1.0567E-09	172.21	1	0	34	1	0	34	1	1	1	1	1	1	1	1	1	1		1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1		1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	30523000	263740	304120	1019900	1084500	1594100	1521300	483030	473650	660090	647050	0	1054000	984000	1057700	957570	961030	2285600	2098200	493880	490260	1714100	1818200	226280	224490	20913	872110	240010	320610	580210	508720	2909800	252120	252320	979450	1170300		+
533	75	539	5920;5921;5922	3045	3045		VLEGNEQFINAAK	2	0	2	0	0	1	2	1	0	1	1	1	0	1	0	0	0	0	0	1	0	13	0	1431.7358	P35030	P35030	PRSS3;PRSS4;TRY3;TRY4	Brain trypsinogen;Mesotrypsinogen;Serine protease 3;Serine protease 4;Trypsin III;Trypsin IV;Trypsin-3	yes	yes	2	0.043716	77.593	1	0	3	1	0	3																			1	1							1																											1	1							1									149780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64783	51734	0	0	0	0	0	0	33266	0	0	0	0	0	0	0	0		
534	38;41	540	5923;5924;5925;5926;5927;5928;5929;5930;5931;5932;5933;5934;5935;5936;5937;5938;5939;5940;5941;5942;5943;5944;5945;5946;5947;5948;5949;5950;5951;5952;5953;5954;5955;5956;5957;5958;5959;5960;5961;5962;5963	3046;3047;3048;3049;3050;3051;3052;3053;3054;3055;3056;3057;3058;3059;3060;3061;3062;3063;3064;3065;3066;3067;3068;3069;3070;3071;3072;3073;3074;3075;3076;3077;3078;3079;3080;3081;3082;3083	3056		VLGSGAFGTVYK	1	0	0	0	0	0	0	3	0	0	1	1	0	1	0	1	1	0	1	2	0	12	0	1197.6394	P00533;Q15303;P04626	P00533	EGFR;ERBB1;ERBB4;HER4;ERBB2;HER2;MLN19;NEU;NGL	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1;p180erbB4;Proto-oncogene-like protein c-ErbB-4;Receptor tyrosine-protein kinase erbB-4;Tyrosine kinase-type cell surface receptor HER4;Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2	no	no	2	1.2283E-47	265.01	1	0	41	NaN	NaN		3	4	3	2	1	1	1	1			1	1	1	1	1	1	1	1	1	1	1	2	1	2		1	1	1	1	1	1		1	1	1																																				152460000	26113000	28282000	21419000	20992000	499190	395880	167580	189120	0	0	46623	45317	5459600	5464000	7628900	7059300	268470	269230	299980	309430	9452400	9592700	1195900	1450700	0	38893	167640	173040	1294000	1324400	2565700	0	30327	135680	131520		
535	66	541	5964;5965;5966;5967;5968;5969;5970;5971;5972;5973;5974;5975;5976;5977;5978	3084;3085;3086;3087;3088;3089;3090;3091	3091		VLGSGVFGTVHK	0	0	0	0	0	0	0	3	1	0	1	1	0	1	0	1	1	0	0	3	0	12	0	1199.6663	P21860	P21860	ERBB3;HER3	Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3	yes	yes	2	0.0023913	113.63	1	0	15	1	0	15					1	1	1	1									1	1	1	1					1	1	1					1	1	1	1					1	1	1	1									1	1	1	1					1	1	1					1	1	1	1	12363000	0	0	0	0	2420900	2407800	1706800	1532800	0	0	0	0	0	0	0	0	341580	287870	419890	371010	0	0	0	0	350430	345030	1325800	0	0	0	0	109570	149000	289630	305500		
536	106	542	5979;5980;5981;5982;5983;5984;5985;5986;5987;5988;5989;5990	3092;3093;3094;3095;3096;3097;3098;3099	3096		VLNEECDQNWYK	0	0	2	1	1	1	2	0	0	0	1	1	0	0	0	0	0	1	1	1	0	12	0	1596.6879	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	2	1.6415E-07	178.71	1	0	12	1	0	12	1	1	2	1									1	1	1	1													1	1	1					1	1	2	1									1	1	1	1													1	1	1					1980700	43943	52406	48731	35698	0	0	0	0	0	0	0	0	266830	281590	384100	375690	0	0	0	0	0	0	0	0	0	0	0	0	134940	143980	212770	0	0	0	0		
537	65	543	5991;5992;5993;5994;5995;5996;5997	3100;3101;3102;3103;3104;3105;3106	3101		VLQIIPYEFNR	0	1	1	0	0	1	1	0	0	2	1	0	0	1	1	0	0	0	1	1	0	11	0	1390.7609	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	2	0.00061927	127.42	1	0	7	1	0	7													1	1	1	1													1	1	1																	1	1	1	1													1	1	1					3806300	0	0	0	0	0	0	0	0	0	0	0	0	494380	466560	900060	942530	0	0	0	0	0	0	0	0	0	0	0	0	160090	215330	627380	0	0	0	0		
538	69	544	5998	3107	3107		VLSIGDGIAR	1	1	0	1	0	0	0	2	0	2	1	0	0	0	0	1	0	0	0	1	0	10	0	999.57129	P25705	P25705	ATP5A;ATP5A1;ATP5AL2;ATPM	ATP synthase subunit alpha, mitochondrial	yes	yes	2	0.044601	55.549	1	0	1	1	0	1				1																																			1																																0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
539	54	545	5999;6000;6001;6002;6003;6004;6005	3108;3109	3108		VMEHFIK	0	0	0	0	0	0	1	0	1	1	0	1	1	1	0	0	0	0	0	1	0	7	0	902.46841	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2	0.050055	100.74	1	0	7	1	0	7	1	1	1	1	1																1	1														1	1	1	1	1																1	1														313030	57332	31817	54656	59320	30642	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42003	37258	0	0	0	0	0	0	0	0	0	0	0	0	0		
540	71	546	6006;6007;6008	3110	3110		VMGPGVSYLVR	0	1	0	0	0	0	0	2	0	0	1	0	1	0	1	1	0	0	1	3	0	11	0	1176.6325	P29353	P29353	SHC;SHC1;SHCA	SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1	yes	yes	2	0.020366	86.624	1	0	3	1	0	3													1	1		1																																1	1		1																				119690	0	0	0	0	0	0	0	0	0	0	0	0	45077	34010	0	40601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
541	85	547	6009;6010	3111;3112	3111		VPFILTYDFIHVIQQGK	0	0	0	1	0	2	0	1	1	3	1	1	0	2	1	0	1	0	1	2	0	17	0	2017.1037	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	3	0.00329	85.457	1	0	2	1	0	2																			1	1																																		1	1																297750	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	170870	126880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
542	167	548	6011;6012;6013;6014;6015;6016;6017;6018;6019;6020;6021	3113;3114;3115;3116	3114		VQAEDLLYGKPDGAFLIR	2	1	0	2	0	1	1	2	0	1	3	1	0	1	1	0	0	0	1	1	0	18	1	2004.068	Q92569	Q92569	PIK3R3	p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma	yes	yes	3	0.00054787	98.694	1	0	11	1	0	11						1	1	1									1	1	1	1							1	1						1	1						1	1	1									1	1	1	1							1	1						1	1	2027300	0	0	0	0	0	86909	514270	514270	0	0	0	0	0	0	0	0	138390	121870	159070	153100	0	0	0	0	0	0	119710	133880	0	0	0	0	0	44474	41354		
543	159	549	6022;6023;6024;6025;6026;6027;6028;6029;6030;6031;6032;6033;6034;6035;6036;6037;6038;6039;6040;6041;6042;6043;6044;6045	3117;3118;3119;3120;3121;3122;3123;3124	3119		VQEAILAR	2	1	0	0	0	1	1	0	0	1	1	0	0	0	0	0	0	0	0	1	0	8	0	898.52362	Q8NF91	Q8NF91	C6orf98;KIAA0796;KIAA1262;KIAA1756;MYNE1;SYNE1	Enaptin;Myocyte nuclear envelope protein 1;Nesprin-1;Nuclear envelope spectrin repeat protein 1;Synaptic nuclear envelope protein 1	yes	yes	2	0.027599	102.51	1	0	24	1	0	24		1			1				1	1	1	1	1		1			1	1			1	1	1	1	1	1		1	1	1	2	1	1	1		1			1				1	1	1	1	1		1			1	1			1	1	1	1	1	1		1	1	1	2	1	1	1	272960000	0	124770	0	0	11678000	0	0	0	94220	11523000	15053000	15574000	14905000	0	12795000	0	0	11866000	12611000	0	0	14588000	97237	13040000	16090000	15717000	16667000	0	12502000	83820	14106000	15495000	15792000	16224000	16335000		
544	136	550	6046;6047	3125;3126	3126		VQKSSSPREMQK	0	1	0	0	0	2	1	0	0	0	0	2	1	0	1	3	0	0	0	1	0	12	2	1403.7191	Q3BBV2;Q86T75	Q3BBV2	NBPF8;NBPF11	Neuroblastoma breakpoint family member 8;Neuroblastoma breakpoint family member 11	yes	no	2	0.059985	44.543	1	0	2	1	0	2									1											1																								1											1																9725300	0	0	0	0	0	0	0	0	5414900	0	0	0	0	0	0	0	0	0	0	4310400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
545	81	551	6048;6049;6050;6051;6052;6053;6054;6055;6056;6057;6058;6059;6060;6061	3127;3128	3127		VQQTVQDLFGR	0	1	0	1	0	3	0	1	0	0	1	0	0	1	0	0	1	0	0	2	0	11	0	1289.6728	P38646	P38646	GRP75;HSPA9;HSPA9B	75 kDa glucose-regulated protein;Heat shock 70 kDa protein 9;Mortalin;Peptide-binding protein 74;Stress-70 protein, mitochondrial	yes	yes	2	0.00051032	132.17	1	0	14	1	0	14	1	1	1	1	1	1							1	1	1	1					1	1								1	1					1	1	1	1	1	1							1	1	1	1					1	1								1	1					1177500	219310	265350	107190	122340	42486	37573	0	0	0	0	0	0	38067	41187	62810	50750	0	0	0	0	57225	47848	0	0	0	0	0	0	0	46181	39182	0	0	0	0		
546	61	552	6062	3129	3129		VSVELTNSLFK	0	0	1	0	0	0	1	0	0	0	2	1	0	1	0	2	1	0	0	2	0	11	0	1235.6762	P14923	P14923	CTNNG;DP3;JUP	Catenin gamma;Desmoplakin III;Desmoplakin-3;Junction plakoglobin	yes	yes	2	0.077597	50.284	1	0	1	1	0	1																																			1																																			1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
547	54	553	6063;6064;6065;6066;6067;6068;6069;6070;6071;6072;6073;6074;6075;6076;6077;6078;6079;6080;6081;6082;6083;6084;6085	3130;3131;3132;3133;3134;3135;3136;3137;3138;3139;3140;3141;3142;3143;3144;3145	3133		VTHAVVTVPAYFNDAQR	3	1	1	1	0	1	0	0	1	0	0	0	0	1	1	0	2	0	1	4	0	17	0	1886.9639	P11021	P11021	GRP78;HSPA5	78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein	yes	yes	2,3	6.0974E-10	166.62	1	0	23	1	0	23	2	2	2	2	2	2	1									1					2	2					2	1	1		1					2	2	2	2	2	2	1									1					2	2					2	1	1		1					14269000	2602400	2510100	1848700	2047600	506760	545940	428090	0	0	0	0	0	0	0	0	65664	0	0	0	0	1482000	1412000	0	0	0	0	357840	369220	16752	0	76153	0	0	0	0		
548	57	554	6086;6087;6088;6089;6090	3146;3147	3146		VTLVFEHVDQDLR	0	1	0	2	0	1	1	0	1	0	2	0	0	1	0	0	1	0	0	3	0	13	0	1569.8151	P11802	P11802	CDK4	Cell division protein kinase 4;Cyclin-dependent kinase 4;PSK-J3	yes	yes	3	0.10574	69.01	1	0	5	1	0	5	1	1	1													1						1														1	1	1													1						1														378670	103760	96448	101820	0	0	0	0	0	0	0	0	0	0	0	0	27078	0	0	0	0	0	49558	0	0	0	0	0	0	0	0	0	0	0	0	0		
549	16;8;15	555	6091;6092;6093;6094;6095;6096;6097	3148;3149;3150;3151	3150		VTMQNLNDR	0	1	2	1	0	1	0	0	0	0	1	0	1	0	0	0	1	0	0	1	0	9	0	1089.5237	CON__P13645;P13645;CON__P02535-1;CON__Q7Z3Y7;CON__Q148H6;Q7Z3Y7;CON__Q7Z3Y8;Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Z0;CON__Q3ZAW8;CON__Q9Z2K1;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779	CON__P13645	KPP;KRT10;KPP;KRT10;Krt10;Krt1-10;KRT25D;KRT28;KRT25D;KRT28;KRT25C;KRT27;KRT25C;KRT27;KRT25;KRT25A;KRT25;KRT25A;Krt1-16;Krt16;K16;Krt1-16;Krt16;KRT25B;KRT26;KRT25B;KRT26;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A	Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa;Cytokeratin-28;Keratin, type I cytoskeletal 28;Keratin-25D;Keratin-28;Type I inner root sheath-specific keratin-K25irs4;Cytokeratin-27;Keratin, type I cytoskeletal 27;Keratin-25C;Keratin-27;Type I inner root sheath-specific keratin-K25irs3;Cytokeratin-25;Keratin, type I cytoskeletal 25;Keratin-25;Keratin-25A;Type I inner root sheath-specific keratin-K25irs1;Keratin 16;Putative uncharacterized protein;Keratin intermediate filament 16a;Keratin intermediate filament 16b;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16;Cytokeratin-26;Keratin, type I cytoskeletal 26;Keratin-25B;Keratin-26;Type I inner root sheath-specific keratin-K25irs2;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14	no	no	2	1.4266E-05	143.03	1	0	7	NaN	NaN				1														1	1			1										1			1	1																																				135940	0	0	20907	0	0	0	0	0	0	0	0	0	0	0	0	0	34239	0	0	0	0	0	0	0	0	0	0	0	0	0	53320	0	0	0	27472		+
550	110	556	6098;6099	3152;3153	3152		VVAGVANALAHK	4	0	1	0	0	0	0	1	1	0	1	1	0	0	0	0	0	0	0	3	0	12	0	1148.6666	P68871;P02042	P68871	HBB;HBD	Beta-globin;Hemoglobin beta chain;Hemoglobin subunit beta;LVV-hemorphin-7;Delta-globin;Hemoglobin delta chain;Hemoglobin subunit delta	yes	no	2	0.0051554	102.52	1	0	2	1	0	2											1	1																																		1	1																								87864	0	0	0	0	0	0	0	0	0	0	42543	45320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
551	122	557	6100;6101;6102;6103;6104;6105;6106;6107;6108;6109	3154;3155;3156;3157;3158;3159;3160;3161	3158		VYLPYVTNQTYQER	0	1	1	0	0	2	1	0	0	0	1	0	0	0	1	0	2	0	3	2	0	14	0	1772.8733	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	2,3	5.4155E-08	179.67	1	0	10	1	0	10													2	2	2	2															2																	2	2	2	2															2					2104100	0	0	0	0	0	0	0	0	0	0	0	0	401340	465930	578420	503340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	155060	0	0	0	0		
552	40	558	6110;6111;6112;6113;6114;6115;6116;6117;6118;6119;6120;6121;6122;6123;6124;6125;6126;6127;6128;6129;6130;6131;6132;6133;6134;6135;6136;6137;6138;6139;6140;6141	3162;3163;3164;3165;3166;3167;3168;3169;3170;3171;3172;3173;3174;3175;3176;3177;3178;3179;3180;3181;3182;3183;3184	3173		WELLQQVDTSTR	0	1	0	1	0	2	1	0	0	0	2	0	0	0	0	1	2	1	0	1	0	12	0	1474.7416	P04264;CON__P04264	P04264	KRT1;KRTA;KRT1;KRTA	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1	yes	no	2	2.2625E-26	231.83	1	0	32	1	0	32	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1					1	1	1	1	2	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1					1	1	1	1	2	1	1	1	1	34758000	396280	346050	698040	738920	455970	447530	336650	375860	1699400	1916900	402050	377480	1607100	1548600	1933800	2077200	2455900	2397900	674680	600390	2886300	2202600	0	0	0	0	224560	219550	312880	275600	5864500	192560	214030	409070	469470		+
553	117	559	6142;6143;6144;6145;6146	3185;3186;3187;3188;3189	3187		WFHPNITGVEAENLLLTR	1	1	2	0	0	0	2	1	1	1	3	0	0	1	1	0	2	1	0	1	0	18	0	2109.1007	Q06124	Q06124	PTP2C;PTPN11;SHPTP2	Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11	yes	yes	3	0.00055956	96.993	1	0	5	1	0	5															1	1			1	1											1																			1	1			1	1											1					1225500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	229360	205720	0	0	374560	277440	0	0	0	0	0	0	0	0	0	0	138370	0	0	0	0		
554	38	560;561	6147;6148;6149;6150;6151;6152;6153;6154;6155;6156;6157;6158;6159;6160;6161;6162;6163;6164	3190;3191;3192;3193;3194;3195;3196;3197;3198;3199;3200;3201;3202	3197	7	WMALESILHR	1	1	0	0	0	0	1	0	1	1	2	0	1	0	0	1	0	1	0	0	0	10	0	1254.6543	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	0.0041944	104.2	1	0	18	1	0	18	2	2	2	3											2	2					2	3														2	2	2	3											2	2					2	3														2744000	654020	585020	265800	363610	0	0	0	0	0	0	0	0	0	0	204500	174590	0	0	0	0	213960	282510	0	0	0	0	0	0	0	0	0	0	0	0	0		
555	39;17	562	6165;6166;6167;6168;6169;6170;6171;6172;6173;6174;6175;6176;6177;6178;6179;6180;6181	3203;3204;3205;3206	3203		WTLLQEQGTK	0	0	0	0	0	2	1	1	0	0	2	1	0	0	0	0	2	1	0	0	0	10	0	1202.6295	P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P13647;P13647	P04259	K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;KRT5;KRT5	Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5	no	no	2	0.0074793	96.342	1	0	17	NaN	NaN				1	1	1	1			1		1	1	1	1	1	1	1	1			1	1								1	1																																								1095300	0	0	55579	62402	31796	27636	0	0	42590	0	94233	94843	69237	53943	60672	69077	52500	63832	0	0	45849	48847	0	0	0	0	0	0	0	46989	175290	0	0	0	0		+
556	40;39	563	6182;6183;6184;6185;6186;6187;6188;6189;6190;6191;6192;6193;6194;6195;6196;6197;6198;6199;6200;6201;6202;6203;6204;6205;6206;6207;6208;6209;6210;6211;6212;6213;6214	3207;3208;3209;3210;3211;3212;3213;3214;3215;3216;3217;3218;3219;3220;3221;3222;3223;3224;3225;3226;3227;3228;3229;3230;3231;3232;3233;3234;3235;3236;3237	3210		YEELQITAGR	1	1	0	0	0	1	2	1	0	1	1	0	0	0	0	0	1	0	1	0	0	10	0	1178.5932	P04264;CON__P04264;P04259	P04264	KRT1;KRTA;KRT1;KRTA;K6B;KRT6B;KRTL1	67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10	no	no	2	1.6297E-08	180.07	1	0	33	NaN	NaN		1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1	1		1	1	1	1		1	1	1	1	1	1	1																																				5053800	50297	79186	103370	124970	172590	169670	128050	106320	117060	109790	203120	202270	170750	170810	128460	144870	281950	287540	85860	64748	295010	264600	0	29284	162350	214380	44318	0	111450	114230	371600	57253	56310	190900	240390		+
557	79	564	6215;6216;6217;6218	3238	3238		YEELQVTVGR	0	1	0	0	0	1	2	1	0	0	1	0	0	0	0	0	1	0	1	2	0	10	0	1192.6088	P35908;CON__P35908	P35908	KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E	Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2	yes	no	2	0.014241	91.549	1	0	4	1	0	4					1																1										1				1					1																1										1				1	152160	0	0	0	0	27493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39618	0	0	0	0	0	0	0	0	0	53257	0	0	0	31793		+
558	85	565	6219;6220;6221;6222;6223;6224;6225;6226	3239;3240;3241;3242	3240		YEPFLDCALSR	1	1	0	1	1	0	1	0	0	0	2	0	0	1	1	1	0	0	1	0	0	11	0	1369.6336	P42338	P42338	PIK3C1;PIK3CB	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform	yes	yes	2	0.00087624	112.36	1	0	8	1	0	8																	1	1	1	1												1	1	1	1																	1	1	1	1												1	1	1	1	924730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	98528	99396	183760	167260	0	0	0	0	0	0	0	0	0	0	0	59382	56140	131320	128950		
559	84	566	6227;6228;6229;6230;6231;6232	3243;3244;3245;3246	3244		YEQYLDNLLVR	0	1	1	1	0	1	1	0	0	0	3	0	0	0	0	0	0	0	2	1	0	11	0	1424.73	P42336	P42336	PIK3CA	Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	yes	yes	2	0.0003464	138.25	1	0	6	1	0	6																	1	1	1	1												1	1																			1	1	1	1												1	1			1193100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	292170	259620	269730	228340	0	0	0	0	0	0	0	0	0	0	0	76212	67018	0	0		
560	106	567	6233;6234;6235;6236;6237;6238;6239;6240;6241;6242;6243;6244;6245;6246;6247;6248;6249;6250;6251;6252;6253;6254;6255;6256;6257;6258;6259;6260;6261;6262;6263;6264;6265;6266	3247;3248;3249;3250;3251;3252;3253;3254;3255;3256;3257;3258;3259;3260;3261;3262;3263;3264;3265;3266;3267;3268;3269	3254		YFLWVVK	0	0	0	0	0	0	0	0	0	0	1	1	0	1	0	0	0	1	1	2	0	7	0	953.53747	P62993	P62993	ASH;GRB2	Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2	yes	yes	1,2	0.0019817	121.68	1	0	34	1	0	34	1	2	1	1			1	1					2	2	5	2	1	1	1	1	1	1							2	2	2	1	1	1	1	1	2	1	1			1	1					2	2	5	2	1	1	1	1	1	1							2	2	2	1	1	1	1	65460000	1014700	1026900	637600	550200	0	0	51050	54333	0	0	0	0	7240200	8146700	15151000	14937000	620950	587240	556970	362480	337900	326390	0	0	0	0	0	0	2750600	2499800	8071600	108470	135200	0	293020		
561	43;58	568	6267;6268;6269;6270;6271;6272;6273;6274;6275;6276;6277;6278;6279	3270;3271;3272;3273;3274;3275;3276;3277	3277		YFPTQALNFAFK	2	0	1	0	0	1	0	0	0	0	1	1	0	3	1	0	1	0	1	0	0	12	0	1445.7343	P05141;P12235;Q9H0C2;P12236	P05141	ANT2;SLC25A5;ANT1;SLC25A4;AAC4;ANT4;SFEC;SLC25A31;ANT3;CDABP0051;SLC25A6	Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 4;ADP,ATP carrier protein 4;ADP/ATP translocase 4;Solute carrier family 25 member 31;Sperm flagellar energy carrier protein;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6	no	no	2	0.005675	100.72	1	0	13	NaN	NaN		1	1	1	1			1	1							1	1	1				1	1						1			1																																								1910900	451910	443750	158250	128460	0	0	45307	19560	0	0	0	0	0	0	121700	116380	26865	0	0	0	169740	135040	0	0	0	0	0	26100	0	0	67828	0	0	0	0		
562	62	569	6280;6281;6282;6283;6284;6285;6286;6287	3278;3279;3280;3281	3280		YIELLTR	0	1	0	0	0	0	1	0	0	1	2	0	0	0	0	0	1	0	1	0	0	7	0	906.51747	P15924	P15924	DSP	250/210 kDa paraneoplastic pemphigus antigen;Desmoplakin	yes	yes	2	0.057295	94.407	1	0	8	1	0	8			1	1										1		1		1				1												1	1			1	1										1		1		1				1												1	1	563580	0	0	102300	120160	0	0	0	0	0	0	0	0	0	43033	0	159770	0	0	0	0	0	32618	0	0	0	0	0	0	0	0	0	0	0	44026	61672		
563	94	570	6288;6289;6290;6291;6292;6293;6294	3282;3283	3282		YLFLFDK	0	0	0	1	0	0	0	0	0	0	2	1	0	2	0	0	0	0	1	0	0	7	0	944.50076	P52735	P52735	VAV2	Guanine nucleotide exchange factor VAV2	yes	yes	2	0.093144	69.432	1	0	7	1	0	7	1	1	1										1	1	1	1																				1	1	1										1	1	1	1																				297840	39460	38610	54213	0	0	0	0	0	0	0	0	0	54307	63341	0	47904	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
564	9	571	6295;6296;6297	3284	3284		YLGYLEQLLR	0	1	0	0	0	1	1	1	0	0	4	0	0	0	0	0	0	0	2	0	0	10	0	1266.6972	CON__P02662	CON__P02662			yes	yes	2	7.6447E-06	153.05	1	0	3	1	0	3	1	1																			1															1	1																			1															587290	293010	260250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34029	0	0	0	0	0	0	0	0	0	0	0	0	0	0		+
565	188	572	6298;6299;6300;6301;6302;6303;6304	3285;3286	3286		YLIALYTK	1	0	0	0	0	0	0	0	0	1	2	1	0	0	0	0	1	0	2	0	0	8	0	983.56917	Q9Y4H2	Q9Y4H2	IRS2	Insulin receptor substrate 2	yes	yes	2	0.10832	81.297	1	0	7	1	0	7																	1	1	1	1												1		1	1																	1	1	1	1												1		1	1	585290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76047	68542	74424	58009	0	0	0	0	0	0	0	0	0	0	0	37936	0	149340	120990		
566	46	573	6305;6306;6307;6308;6309;6310;6311;6312;6313;6314;6315;6316;6317;6318;6319;6320;6321;6322;6323;6324;6325;6326;6327;6328	3287;3288;3289;3290;3291;3292;3293;3294;3295;3296;3297;3298;3299;3300	3289		YLTVAAVFR	2	1	0	0	0	0	0	0	0	0	1	0	0	1	0	0	1	0	1	2	0	9	0	1038.5862	P07437;P68371;P04350	P07437	OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5	Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain	yes	no	2	1.9524E-12	182.53	1	0	24	1	0	24	1	1	1	1	1	1	1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1						1	1	1	1	1	1	1	1	1	1	1	1			1	1	1	1	1	1	1	1	1	1					1	1						1	1	10260000	1589800	1622600	1264600	1329700	279900	269770	383040	345530	62537	51054	0	0	250630	273730	418810	414290	95230	119930	151530	114550	379040	363840	0	0	0	0	173500	135360	0	0	0	0	0	80725	89890		
567	125	574	6329;6330;6331;6332;6333;6334;6335	3301	3301		YLTVATVFR	1	1	0	0	0	0	0	0	0	0	1	0	0	1	0	0	2	0	1	2	0	9	0	1068.5968	Q13509	Q13509	TUBB3;TUBB4	Tubulin beta-3 chain;Tubulin beta-4 chain;Tubulin beta-III	no	no	2	0.022807	90.657	1	0	7	NaN	NaN		1	1	1	1											1	1					1																																																		777910	223360	170920	135270	140570	0	0	0	0	0	0	0	0	0	0	42694	38423	0	0	0	0	26674	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
568	38	575	6336;6337;6338;6339;6340;6341;6342;6343;6344;6345;6346;6347;6348;6349;6350;6351;6352;6353;6354;6355;6356;6357;6358;6359	3302;3303;3304;3305;3306;3307;3308;3309;3310;3311;3312;3313;3314;3315;3316;3317;3318;3319;3320;3321;3322;3323;3324;3325	3302		YLVIQGDER	0	1	0	1	0	1	1	1	0	1	1	0	0	0	0	0	0	0	1	1	0	9	0	1091.5611	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	2.0138E-05	141.48	1	0	24	1	0	24	1	1	2	1	1		1	1					1	1	1	1	1	1	1	1	1	1	1	1				1	1	1	1					1	1	2	1	1		1	1					1	1	1	1	1	1	1	1	1	1	1	1				1	1	1	1					32392000	5018100	5695200	4607600	4571800	30063	0	36962	50585	0	0	0	0	818280	821420	1090600	1127900	56584	52371	118980	70117	2184800	1768600	1774200	1787900	0	0	0	0	241390	232830	235430	0	0	0	0		
569	107	576	6360;6361;6362;6363;6364;6365	3326	3326		YLYTLVITDKEK	0	0	0	1	0	0	1	0	0	1	2	2	0	0	0	0	2	0	2	1	0	12	1	1484.8126	P63173	P63173	RPL38	60S ribosomal protein L38	yes	yes	3	0.0613	73.499	1	0	6	1	0	6	1	1	1	1											1							1														1	1	1	1											1							1														390990	115330	86638	69980	39359	0	0	0	0	0	0	0	0	0	0	37910	0	0	0	0	0	0	41774	0	0	0	0	0	0	0	0	0	0	0	0	0		
570	122	577	6366;6367	3327	3327		YNKPLPPTPDLPQPHLPPISAPGSSR	1	1	1	1	0	1	0	1	1	1	3	1	0	0	9	3	1	0	1	0	0	26	1	2775.4708	Q12774	Q12774	ARHGEF5;TIM	Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene	yes	yes	3	0.028867	67.864	1	0	2	1	0	2															1	1																																		1	1																				489100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	258500	230600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0		
571	26	578	6368;6369;6370;6371;6372	3328;3329	3329		YQQDQIVKEDSVEAVGAQLK	2	0	0	2	0	4	2	1	0	1	1	2	0	0	0	1	0	0	1	3	0	20	1	2247.1383	O00459	O00459	PIK3R2	Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta	yes	yes	3	3.3406E-07	133.66	1	0	5	1	0	5																	1	1	1	1															1																	1	1	1	1															1	724070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104200	141790	233370	207900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36823		
572	38	579	6373;6374;6375;6376;6377;6378;6379;6380;6381;6382;6383;6384;6385;6386;6387	3330;3331;3332;3333;3334;3335;3336;3337;3338;3339;3340;3341;3342	3330		YSFGATCVK	1	0	0	0	1	0	0	1	0	0	0	1	0	1	0	1	1	0	1	1	0	9	0	1031.4746	P00533	P00533	EGFR;ERBB1	Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1	yes	yes	2	2.1213E-05	141.2	1	0	15	1	0	15	1	1	1	1									1	1	1	1					1	1	1	1					1	1	1					1	1	1	1									1	1	1	1					1	1	1	1					1	1	1					6491300	1250600	1204500	889280	992760	0	0	0	0	0	0	0	0	171370	192640	209850	227230	0	0	0	0	326160	312160	258120	275490	0	0	0	0	51485	61876	67776	0	0	0	0		
573	65	580	6388;6389;6390;6391;6392;6393	3343;3344	3344		YVNILPYDHSR	0	1	1	1	0	0	0	0	1	1	1	0	0	0	1	1	0	0	2	1	0	11	0	1375.6884	P18433	P18433	PTPA;PTPRA;PTPRL2	Receptor-type tyrosine-protein phosphatase alpha	yes	yes	3	0.013779	90.629	1	0	6	1	0	6													1	1	1	1													1		1																	1	1	1	1													1		1					384240	0	0	0	0	0	0	0	0	0	0	0	0	50857	50062	102220	78680	0	0	0	0	0	0	0	0	0	0	0	0	51008	0	51412	0	0	0	0