Mercurial > repos > bornea > saint_preprocessing
view test_files/peptides.txt @ 33:d223d815e9c5 draft
Uploaded
| author | bornea |
|---|---|
| date | Wed, 27 Apr 2016 10:35:13 -0400 |
| parents | 843ee18d6065 |
| children |
line wrap: on
line source
id Protein Group IDs Mod. Peptide IDs Evidence IDs MS/MS IDs Best MS/MS Oxidation (M) Site IDs Sequence A Count R Count N Count D Count C Count Q Count E Count G Count H Count I Count L Count K Count M Count F Count P Count S Count T Count W Count Y Count V Count U Count Length Missed Cleavages Mass Proteins Leading Razor Protein Gene Names Protein Names Unique (Groups) Unique (Proteins) Charges PEP Score Slice Average Slice Std. Dev. Slice 1 Unique Slice Average Unique Slice Std. Dev. Unique Slice 1 Experiment HCC827_EGFR_TAP_1_run1 Experiment HCC827_EGFR_TAP_1_run2 Experiment HCC827_EGFR_TAP_2_run1 Experiment HCC827_EGFR_TAP_2_run2 Experiment HCC827_ERBB3_TAP_1_run1 Experiment HCC827_ERBB3_TAP_1_run2 Experiment HCC827_ERBB3_TAP_2_run1 Experiment HCC827_ERBB3_TAP_2_run2 Experiment HCC827_GFP_TAP_1_run1 Experiment HCC827_GFP_TAP_1_run2 Experiment HCC827_GFP_TAP_2_run1 Experiment HCC827_GFP_TAP_2_run2 Experiment HCC827_GRB2_TAP_1_run1 Experiment HCC827_GRB2_TAP_1_run2 Experiment HCC827_GRB2_TAP_2_run1 Experiment HCC827_GRB2_TAP_2_run2 Experiment HCC827_P85B_TAP_1_run1 Experiment HCC827_P85B_TAP_1_run2 Experiment HCC827_P85B_TAP_2_run1 Experiment HCC827_P85B_TAP_2_run2 Experiment HCC827ER_EGFR_TAP_1_run1 Experiment HCC827ER_EGFR_TAP_1_run2 Experiment HCC827ER_EGFR_TAP_2_run1 Experiment HCC827ER_EGFR_TAP_2_run2 Experiment HCC827ER_ERBB3_TAP_1_run1 Experiment HCC827ER_ERBB3_TAP_1_run2 Experiment HCC827ER_ERBB3_TAP_2_run1 Experiment HCC827ER_ERBB3_TAP_2_run2 Experiment HCC827ER_GRB2_TAP_1_run1 Experiment HCC827ER_GRB2_TAP_1_run2 Experiment HCC827ER_GRB2_TAP_2_run1 Experiment HCC827ER_P85B_TAP_1_run1 Experiment HCC827ER_P85B_TAP_1_run2 Experiment HCC827ER_P85B_TAP_2_run1 Experiment HCC827ER_P85B_TAP_2_run2 Unique Experiment HCC827_EGFR_TAP_1_run1 Unique Experiment HCC827_EGFR_TAP_1_run2 Unique Experiment HCC827_EGFR_TAP_2_run1 Unique Experiment HCC827_EGFR_TAP_2_run2 Unique Experiment HCC827_ERBB3_TAP_1_run1 Unique Experiment HCC827_ERBB3_TAP_1_run2 Unique Experiment HCC827_ERBB3_TAP_2_run1 Unique Experiment HCC827_ERBB3_TAP_2_run2 Unique Experiment HCC827_GFP_TAP_1_run1 Unique Experiment HCC827_GFP_TAP_1_run2 Unique Experiment HCC827_GFP_TAP_2_run1 Unique Experiment HCC827_GFP_TAP_2_run2 Unique Experiment HCC827_GRB2_TAP_1_run1 Unique Experiment HCC827_GRB2_TAP_1_run2 Unique Experiment HCC827_GRB2_TAP_2_run1 Unique Experiment HCC827_GRB2_TAP_2_run2 Unique Experiment HCC827_P85B_TAP_1_run1 Unique Experiment HCC827_P85B_TAP_1_run2 Unique Experiment HCC827_P85B_TAP_2_run1 Unique Experiment HCC827_P85B_TAP_2_run2 Unique Experiment HCC827ER_EGFR_TAP_1_run1 Unique Experiment HCC827ER_EGFR_TAP_1_run2 Unique Experiment HCC827ER_EGFR_TAP_2_run1 Unique Experiment HCC827ER_EGFR_TAP_2_run2 Unique Experiment HCC827ER_ERBB3_TAP_1_run1 Unique Experiment HCC827ER_ERBB3_TAP_1_run2 Unique Experiment HCC827ER_ERBB3_TAP_2_run1 Unique Experiment HCC827ER_ERBB3_TAP_2_run2 Unique Experiment HCC827ER_GRB2_TAP_1_run1 Unique Experiment HCC827ER_GRB2_TAP_1_run2 Unique Experiment HCC827ER_GRB2_TAP_2_run1 Unique Experiment HCC827ER_P85B_TAP_1_run1 Unique Experiment HCC827ER_P85B_TAP_1_run2 Unique Experiment HCC827ER_P85B_TAP_2_run1 Unique Experiment HCC827ER_P85B_TAP_2_run2 Intensity Intensity HCC827_EGFR_TAP_1_run1 Intensity HCC827_EGFR_TAP_1_run2 Intensity HCC827_EGFR_TAP_2_run1 Intensity HCC827_EGFR_TAP_2_run2 Intensity HCC827_ERBB3_TAP_1_run1 Intensity HCC827_ERBB3_TAP_1_run2 Intensity HCC827_ERBB3_TAP_2_run1 Intensity HCC827_ERBB3_TAP_2_run2 Intensity HCC827_GFP_TAP_1_run1 Intensity HCC827_GFP_TAP_1_run2 Intensity HCC827_GFP_TAP_2_run1 Intensity HCC827_GFP_TAP_2_run2 Intensity HCC827_GRB2_TAP_1_run1 Intensity HCC827_GRB2_TAP_1_run2 Intensity HCC827_GRB2_TAP_2_run1 Intensity HCC827_GRB2_TAP_2_run2 Intensity HCC827_P85B_TAP_1_run1 Intensity HCC827_P85B_TAP_1_run2 Intensity HCC827_P85B_TAP_2_run1 Intensity HCC827_P85B_TAP_2_run2 Intensity HCC827ER_EGFR_TAP_1_run1 Intensity HCC827ER_EGFR_TAP_1_run2 Intensity HCC827ER_EGFR_TAP_2_run1 Intensity HCC827ER_EGFR_TAP_2_run2 Intensity HCC827ER_ERBB3_TAP_1_run1 Intensity HCC827ER_ERBB3_TAP_1_run2 Intensity HCC827ER_ERBB3_TAP_2_run1 Intensity HCC827ER_ERBB3_TAP_2_run2 Intensity HCC827ER_GRB2_TAP_1_run1 Intensity HCC827ER_GRB2_TAP_1_run2 Intensity HCC827ER_GRB2_TAP_2_run1 Intensity HCC827ER_P85B_TAP_1_run1 Intensity HCC827ER_P85B_TAP_1_run2 Intensity HCC827ER_P85B_TAP_2_run1 Intensity HCC827ER_P85B_TAP_2_run2 Reverse Contaminant 0 165 0 0;1;2;3;4;5 0;1 1 AAAAAATAAAAASIR 11 1 0 0 0 0 0 0 0 1 0 0 0 0 0 1 1 0 0 0 0 15 0 1256.6837 Q8WVM8 Q8WVM8 C14orf163;FKSG23;KIAA0917;SCFD1;STXBP1L2 Sec1 family domain-containing protein 1;SLY1 homolog;Syntaxin-binding protein 1-like 2 yes yes 2 0.0089625 98.942 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 362430 75520 59179 70853 64505 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 56510 35868 0 0 0 0 0 0 0 0 0 0 0 0 0 1 123 1 6;7;8;9 2 2 AAAAASHLNLDALR 6 1 1 1 0 0 0 0 1 0 3 0 0 0 0 1 0 0 0 0 0 14 0 1392.7474 Q13049 Q13049 HT2A;TRIM32 72 kDa Tat-interacting protein;E3 ubiquitin-protein ligase TRIM32;Tripartite motif-containing protein 32;Zinc finger protein HT2A yes yes 2 0.037982 82.543 1 0 4 1 0 4 1 1 1 1 1 1 1 1 239340 63294 45347 64976 65722 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 76 2 10;11;12 3 3 AAELIANSLATAGDGLIELR 5 1 1 1 0 0 2 2 0 2 4 0 0 0 0 1 1 0 0 0 0 20 0 1997.0793 P35232 P35232 PHB Prohibitin yes yes 3 0.018211 74.12 1 0 3 1 0 3 1 1 1 1 1 1 228910 99794 104880 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 24237 0 0 0 0 0 0 0 0 0 0 0 0 0 3 26 3 13;14;15;16;17;18;19;20;21;22;23;24 4;5;6;7;8;9;10;11;12 12 AALQALGVAEGGER 4 1 0 0 0 1 2 3 0 0 2 0 0 0 0 0 0 0 0 1 0 14 0 1340.7048 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 3.5998E-12 190.1 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 14683000 0 0 0 0 65915 51116 77305 72536 0 0 0 0 0 0 0 0 1740300 1742200 3317400 3107600 0 0 0 0 0 0 0 0 0 0 0 907290 828790 1468000 1305200 4 50 4 25;26;27;28;29;30;31;32;33;34;35;36 13;14;15;16;17;18;19;20;21 18 ACGLVASNLNLKPGECLR 2 1 2 0 2 0 1 2 0 0 4 1 0 0 1 1 0 0 0 1 0 18 1 1971.003 P09382 P09382 LGALS1 14 kDa laminin-binding protein;14 kDa lectin;Beta-galactoside-binding lectin L-14-I;Galaptin;Galectin-1;HBL;HPL;Lactose-binding lectin 1;Lectin galactoside-binding soluble 1;Putative MAPK-activating protein PM12;S-Lac lectin 1 yes yes 3 2.625E-06 148.52 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2008500 299970 276830 201920 220110 0 0 19638 22784 0 0 0 0 0 0 229380 203950 0 0 0 15600 198370 209010 0 0 0 0 0 0 0 0 110930 0 0 0 0 5 47;48 5 37;38;39;40;41;42;43;44;45;46;47;48;49 22;23;24;25;26;27;28;29;30;31;32 23 ADLINNLGTIAK 2 0 2 1 0 0 0 1 0 2 2 1 0 0 0 0 1 0 0 0 0 12 0 1241.698 P07900;Q14568;P08238;Q58FF8 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA2;HSPCAL3;HSP90AB1;HSP90B;HSPC2;HSPCB;HSP90AB2P;HSP90BB Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock 90 kDa protein 1 alpha-like 3;Putative heat shock protein HSP 90-alpha A2;Heat shock 84 kDa;Heat shock protein HSP 90-beta;Heat shock protein 90-beta b;Putative heat shock protein HSP 90-beta 2 no no 2 2.0694E-11 186.81 1 0 13 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1518800 237070 229880 145070 168460 90068 98806 84884 98870 0 0 0 0 0 0 0 0 0 0 0 0 56382 73917 0 0 0 35761 105210 94418 0 0 0 0 0 0 0 6 39 6 50;51;52;53;54 33;34 33 ADTLTDEINFLR 1 1 1 2 0 0 1 0 0 1 2 0 0 1 0 0 2 0 0 0 0 12 0 1406.7042 P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668 P04259 K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12 yes no 2 0.00066997 143 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 509060 0 0 179190 181710 0 0 0 0 0 0 0 0 0 0 0 0 46712 55450 0 0 0 0 0 0 0 0 0 0 0 0 45996 0 0 0 0 + 7 40 7 55;56 35;36 36 AEAESLYQSK 2 0 0 0 0 1 2 0 0 0 1 1 0 0 0 2 0 0 1 0 0 10 0 1124.535 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 2.0106E-15 114.5 1 0 2 1 0 2 1 1 1 1 31976 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 31976 0 0 0 0 + 8 171 8 57;58 37 37 AEAGDAALSVAEWLR 5 1 0 1 0 0 2 1 0 0 2 0 0 0 0 1 0 1 0 1 0 15 0 1557.7787 Q96P48 Q96P48 ARAP1;CENTD2;KIAA0782 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;Centaurin-delta-2 yes yes 2 0.025821 85.457 1 0 2 1 0 2 1 1 1 1 153670 0 0 0 0 0 0 0 0 0 0 0 0 0 0 81730 71936 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 9 122 9 59;60;61;62;63 38;39 39 AEELSPAALSPSLEPIR 3 1 0 0 0 0 3 0 0 1 3 0 0 0 3 3 0 0 0 0 0 17 0 1778.9414 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 0.00045981 128.76 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 791840 0 0 0 0 0 0 0 0 0 0 0 0 181510 171410 215260 177340 0 0 0 0 0 0 0 0 0 0 0 0 0 0 46321 0 0 0 0 10 65 10 64;65;66;67;68;69 40;41;42;43;44 41 AEGILDVFQTVK 1 0 0 1 0 1 1 1 0 1 1 1 0 1 0 0 1 0 0 2 0 12 0 1318.7133 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 2 0.0036201 107.85 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 553380 0 0 0 0 0 0 0 0 0 0 0 0 51203 86668 134290 103520 0 0 0 0 0 0 0 0 0 0 0 0 39627 0 138080 0 0 0 0 11 119 11 70;71;72 45;46;47 45 AFVDFLSDEIK 1 0 0 2 0 0 1 0 0 1 1 1 0 2 0 1 0 0 0 1 0 11 0 1282.6445 Q07021 Q07021 C1QBP;GC1QBP;HABP1;SF2P32 Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33 yes yes 2 2.6536E-17 204.52 1 0 3 1 0 3 1 1 1 1 1 1 1874400 0 0 0 0 0 0 0 0 937860 826600 109940 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12 119 12 73;74;75;76;77;78;79;80;81 48;49;50;51;52;53;54 50 AFVDFLSDEIKEER 1 1 0 2 0 0 3 0 0 1 1 1 0 2 0 1 0 0 0 1 0 14 1 1696.8308 Q07021 Q07021 C1QBP;GC1QBP;HABP1;SF2P32 Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33 yes yes 2,3 0.00020233 156.81 1 0 9 1 0 9 2 3 2 1 1 2 3 2 1 1 22762000 0 0 0 0 0 0 0 0 11520000 10835000 0 172250 0 0 0 0 0 0 0 0 124740 110450 0 0 0 0 0 0 0 0 0 0 0 0 0 13 85 13 82;83;84;85;86;87;88 55;56;57;58 56 AGLFHGTELLCK 1 0 0 0 1 0 1 2 1 0 3 1 0 1 0 0 1 0 0 0 0 12 0 1344.686 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2 8.362E-07 166.55 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 775500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 104920 139910 133320 143300 0 0 0 0 0 0 0 0 0 0 0 60720 0 94018 99321 14 170 14 89;90;91;92;93;94;95;96;97;98;99;100;101;102;103;104;105;106;107;108;109;110;111;112;113;114;115;116;117;118;119;120;121;122;123;124;125;126;127;128;129;130;131;132;133;134;135;136;137;138;139;140;141;142;143;144;145;146;147 59;60;61;62;63;64;65;66;67;68;69;70;71;72;73;74 61 AHFSSEDQAMLQAMLR 3 1 0 1 0 2 1 0 1 0 2 0 2 1 0 2 0 0 0 0 0 16 0 1833.8502 Q96NH3 Q96NH3 BROMI;C6orf170;C6orf171 Protein broad-minded yes yes 2,3 0.07561 39.163 1 0 59 1 0 59 2 2 2 2 1 1 2 2 1 2 1 1 2 2 2 2 2 2 2 1 2 2 1 1 2 2 2 1 2 3 2 2 3 2 2 2 2 1 1 2 2 1 2 1 1 2 2 2 2 2 2 2 1 2 2 1 1 2 2 2 1 2 3 2 2 3 42944000 1094900 1098100 3581900 3991600 131990 137340 919430 944580 1051300 1096900 124570 128930 1574700 1702000 2482700 2533500 1284100 1167600 2311900 129660 857300 779110 0 0 33105 58832 1739700 1781600 566870 556810 1346800 2775300 2562200 1125700 1273100 15 122 15 148;149;150;151;152;153;154 75;76;77;78;79 75 AHHALEQLIR 2 1 0 0 0 1 1 0 2 1 2 0 0 0 0 0 0 0 0 0 0 10 0 1186.6571 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 0.00013351 127.4 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1429600 0 0 0 0 0 0 0 0 0 0 0 0 201000 236290 410230 370230 0 0 0 0 0 0 0 0 0 0 0 0 52475 56864 102530 0 0 0 0 16 74 16 155;156;157;158 80 80 AIACLLFGGSR 2 1 0 0 1 0 0 2 0 1 2 0 0 1 0 1 0 0 0 0 0 11 0 1163.6121 P33992 P33992 CDC46;MCM5 CDC46 homolog;DNA replication licensing factor MCM5;P1-CDC46 yes yes 2 0.026738 82.749 1 0 4 1 0 4 1 1 1 1 1 1 1 1 206260 0 0 0 0 0 0 0 0 0 0 0 0 31681 0 87327 49355 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 37899 0 17 54 17 159;160;161;162;163;164 81;82;83;84 81 AKFEELNMDLFR 1 1 1 1 0 0 2 0 0 0 2 1 1 2 0 0 0 0 0 0 0 12 1 1511.7442 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 3 0.034208 79.659 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 420460 75416 125300 33099 49703 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 73870 63075 0 0 0 0 0 0 0 0 0 0 0 0 0 18 16 18 165;166;167;168;169;170;171;172;173;174;175;176;177;178;179;180;181;182;183;184 85;86;87 86 ALEESNYELEGK 1 0 1 0 0 0 4 1 0 0 2 1 0 0 0 1 0 0 1 0 0 12 0 1380.6409 CON__P13645;P13645;CON__P02535-1 CON__P13645 KPP;KRT10;KPP;KRT10;Krt10;Krt1-10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa yes no 2 0.0016979 131.17 1 0 20 1 0 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1212800 0 0 36096 38994 94981 71109 32962 43130 0 0 42679 38320 0 0 55486 48790 89229 98078 0 29002 98833 86170 0 0 44433 53623 0 0 21307 0 121950 0 0 67597 0 + 19 26 19 185;186;187;188;189;190;191;192;193;194;195;196;197;198;199;200;201;202;203;204;205;206;207;208;209;210;211;212;213;214;215;216;217;218;219;220;221;222;223;224;225;226;227;228;229;230;231;232;233;234;235;236;237;238;239;240;241;242;243 88;89;90;91;92;93;94;95;96;97;98;99;100;101;102;103;104;105;106;107;108;109;110;111;112;113;114;115;116;117;118;119;120;121;122;123;124;125;126;127;128;129;130;131;132;133;134;135;136;137;138;139;140;141;142;143;144 96 ALGATFGPLLLR 2 1 0 0 0 0 0 2 0 0 4 0 0 1 1 0 1 0 0 0 0 12 0 1227.7339 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 1.0763E-17 204.5 1 0 59 1 0 59 1 1 1 1 1 1 1 1 10 8 7 11 1 1 3 2 5 3 1 1 1 1 1 1 1 1 10 8 7 11 1 1 3 2 5 3 128390000 0 0 0 0 311940 383000 930080 983910 0 0 0 0 65060 79557 162180 191350 21305000 20647000 30709000 23991000 0 0 0 0 0 0 241470 0 0 0 57227 4813000 57810 11690000 11770000 20 37 20 244;245;246;247;248;249;250 145;146;147 147 ALGTEVIQLFPEK 1 0 0 0 0 1 2 1 0 1 2 1 0 1 1 0 1 0 0 1 0 13 0 1443.7973 O95831 O95831 AIF;AIFM1;PDCD8 Apoptosis-inducing factor 1, mitochondrial;Programmed cell death protein 8 yes yes 2 0.0059347 110.8 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 852240 0 0 0 29145 80734 111410 239350 240450 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 83681 67471 0 0 0 0 0 0 0 21 28 21 251 148 148 ALKTRGNTPK 1 1 1 0 0 0 0 1 0 0 1 2 0 0 1 0 2 0 0 0 0 10 2 1084.6353 O00567 O00567 NOL5A;NOP56 Nucleolar protein 56;Nucleolar protein 5A yes yes 2 0.034769 55.567 1 0 1 1 0 1 1 1 112330 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 112330 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 22 96 22 252;253;254;255;256;257;258 149;150;151 151 ALLANALTSALR 4 1 1 0 0 0 0 0 0 0 4 0 0 0 0 1 1 0 0 0 0 12 0 1212.719 P57088 P57088 DB83;TMEM33 Protein DB83;Transmembrane protein 33 yes yes 2 0.00086257 140.78 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 481870 45780 76048 43047 43508 0 0 0 0 0 0 0 0 0 0 22033 0 0 0 0 0 121500 129950 0 0 0 0 0 0 0 0 0 0 0 0 0 23 35 23 259;260;261 152;153 152 ALLLSTYIK 1 0 0 0 0 0 0 0 0 1 3 1 0 0 0 1 1 0 1 0 0 9 0 1020.6219 O95782;O94973 O95782 ADTAA;AP2A1;CLAPA1;ADTAB;AP2A2;CLAPA2;HIP9;HYPJ;KIAA0899 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit;100 kDa coated vesicle protein C;Adapter-related protein complex 2 alpha-2 subunit;Adaptor protein complex AP-2 subunit alpha-2;Alpha2-adaptin;Alpha-adaptin C;AP-2 complex subunit alpha-2;Clathrin assembly protein complex 2 alpha-C large chain;Huntingtin yeast partner J;Huntingtin-interacting protein 9;Huntingtin-interacting protein J;Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit yes no 2 0.06182 77.923 1 0 3 1 0 3 1 1 1 1 1 1 139060 0 0 0 0 0 0 0 0 0 0 0 0 0 45537 47341 46184 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 24 29 24 262;263;264;265;266;267;268;269;270;271;272;273;274;275;276;277;278;279;280;281;282;283;284;285;286;287;288;289;290;291;292;293;294;295;296;297;298;299;300;301;302;303 154;155;156;157;158;159;160;161;162;163;164;165;166 155 ALLSEPPEPGGEDGPVNLPHASR 2 1 1 1 0 0 3 3 1 0 3 0 0 0 5 2 0 0 0 1 0 23 0 2338.1553 O15482 O15482 CXorf2;TEX28 Testis-specific protein TEX28 yes yes 3 0.0023643 79.489 1 0 42 1 0 42 2 1 2 2 2 1 1 1 2 1 1 2 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 1 2 2 2 1 1 1 2 1 1 2 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 45587000 1461400 1352600 3233700 3216800 63812 114290 2665500 2856000 1513600 1292800 0 57765 744460 851110 2137200 2045800 1130800 1030600 275160 3921600 1937300 1866200 0 0 0 0 3022400 3344700 0 0 2364400 517560 773560 904360 891450 25 42 25 304;305;306;307 167;168;169 168 ALNSIIDVYHK 1 0 1 1 0 0 0 0 1 2 1 1 0 0 0 1 0 0 1 1 0 11 0 1271.6874 P05109 P05109 CAGA;CFAG;MRP8;S100A8 Calgranulin-A;Calprotectin L1L subunit;Cystic fibrosis antigen;Leukocyte L1 complex light chain;Migration inhibitory factor-related protein 8;Protein S100-A8;S100 calcium-binding protein A8;Urinary stone protein band A yes yes 2 0.0013014 94.692 1 0 4 1 0 4 1 1 2 1 1 2 208650 0 0 0 0 0 0 0 0 0 0 43963 46303 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 118390 0 0 0 0 26 85 26 308;309;310;311;312;313;314;315;316;317;318;319;320;321;322;323;324 170;171;172;173;174;175;176;177 177 ALPHFILVECCK 1 0 0 0 2 0 1 0 1 1 2 1 0 1 1 0 0 0 0 1 0 12 0 1485.7472 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2,3 0.0025356 111.61 1 0 17 1 0 17 1 1 2 2 2 2 2 1 2 2 1 1 2 2 2 2 2 1 2 2 2006800 0 0 0 0 0 32105 0 41307 0 0 0 0 0 0 0 0 290790 281980 370880 290660 0 0 0 0 0 0 0 0 0 0 0 83483 73122 280660 261760 27 35 27 325;326;327;328;329;330;331 178;179;180;181;182 182 ALQVGCLLR 1 1 0 0 1 1 0 1 0 0 3 0 0 0 0 0 0 0 0 1 0 9 0 1028.5801 O95782 O95782 ADTAA;AP2A1;CLAPA1 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit yes yes 2 0.0014257 121.96 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 351590 0 34746 0 42474 0 0 0 0 0 0 0 0 69233 76459 56989 71693 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 28 31 28 332;333;334;335;336;337;338;339;340;341;342;343 183 183 ALSAIADLLTNEHER 3 1 1 1 0 0 2 0 1 1 3 0 0 0 0 1 1 0 0 0 0 15 0 1651.8529 O60716 O60716 CTNND1;KIAA0384 Cadherin-associated Src substrate;Catenin delta-1;p120 catenin;p120(cas) yes yes 3 0.011817 92.925 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 696710 77567 81329 0 0 0 0 0 18390 0 0 0 0 24844 0 96711 109460 47763 0 45045 41807 56067 42680 0 0 0 0 0 0 0 0 55048 0 0 0 0 29 46 29 344;345;346;347;348;349;350;351;352;353;354;355;356;357;358;359;360;361;362;363;364;365;366 184;185;186;187;188;189;190;191;192;193 187 ALTVPELTQQVFDAK 2 0 0 1 0 2 1 0 0 0 2 1 0 1 1 0 2 0 0 2 0 15 0 1658.8879 P07437 P07437 OK/SW-cl.56;TUBB;TUBB5 Tubulin beta chain;Tubulin beta-5 chain yes yes 2,3 0.00026778 151.99 1 0 23 1 0 23 2 2 3 3 1 3 2 2 1 2 1 1 2 2 3 3 1 3 2 2 1 2 1 1 3732700 844400 937620 569480 543560 0 0 65224 133390 0 0 0 0 0 0 152240 140850 0 0 19821 0 205140 92832 0 0 0 0 0 28184 0 0 0 0 0 0 0 30 119 30 367;368 194;195 195 ALVLDCHYPEDEVGQEDEAESDIFSIR 2 1 0 4 1 1 5 1 1 2 2 0 0 1 1 2 0 0 1 2 0 27 0 3135.3979 Q07021 Q07021 C1QBP;GC1QBP;HABP1;SF2P32 Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33 yes yes 3 2.7077E-08 103.27 1 0 2 1 0 2 1 1 1 1 557640 0 0 0 0 0 0 0 0 277950 279690 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 31 122 31 369;370;371;372 196;197;198;199 198 ALVSSESYLQR 1 1 0 0 0 1 1 0 0 0 2 0 0 0 0 3 0 0 1 1 0 11 0 1251.6459 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 1.294E-05 162.36 1 0 4 1 0 4 1 1 1 1 1 1 1 1 331370 0 0 0 0 0 0 0 0 0 0 0 0 55070 70370 101480 104450 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 32 86 32 373;374;375;376 200;201;202 200 ALYEHLTAK 2 0 0 0 0 0 1 0 1 0 2 1 0 0 0 0 1 0 1 0 0 9 0 1044.5604 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2 0.0063335 105.14 1 0 4 1 0 4 1 1 1 1 1 1 1 1 215250 67866 0 74913 72472 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 33 47 33 377 203 203 APFDLFENR 1 1 1 1 0 0 1 0 0 0 1 0 0 2 1 0 0 0 0 0 0 9 0 1107.5349 P07900 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38 yes yes 2 0.0095187 80.438 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 34 26 34 378;379;380;381;382;383 204;205;206;207 205 APPPPSSPPPGGAPDGSEPSPDFPALLVEK 3 0 0 2 0 0 2 3 0 0 2 1 0 1 11 4 0 0 0 1 0 30 0 2906.4338 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 4.6538E-18 134.47 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 2300200 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 447230 395610 608110 534030 0 0 0 0 0 0 0 0 0 0 0 0 0 128480 186750 35 37 35 384;385;386;387;388 208;209 209 APSHVPFLLIGGGTAAFAAAR 6 1 0 0 0 0 0 3 1 1 2 0 0 2 2 1 1 0 0 1 0 21 0 2023.1003 O95831 O95831 AIF;AIFM1;PDCD8 Apoptosis-inducing factor 1, mitochondrial;Programmed cell death protein 8 yes yes 3 0.048977 68.576 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 394950 0 37473 0 0 0 0 133310 132790 0 0 0 0 0 0 0 0 0 0 38908 0 0 0 0 0 0 0 0 52466 0 0 0 0 0 0 0 36 81 36 389;390;391;392;393;394;395;396 210;211;212;213 210 AQFEGIVTDLIR 1 1 0 1 0 1 1 1 0 2 1 0 0 1 0 0 1 0 0 1 0 12 0 1360.7351 P38646 P38646 GRP75;HSPA9;HSPA9B 75 kDa glucose-regulated protein;Heat shock 70 kDa protein 9;Mortalin;Peptide-binding protein 74;Stress-70 protein, mitochondrial yes yes 2 0.0018839 128.54 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 644440 138860 147670 90460 73494 0 0 0 0 0 0 0 0 0 0 47863 46236 0 0 0 0 57958 41899 0 0 0 0 0 0 0 0 0 0 0 0 0 37 40 37 397;398;399;400;401;402;403;404;405;406;407;408;409;410;411;412;413;414;415;416;417 214;215;216;217;218;219;220;221;222 214 AQYEDIAQK 2 0 0 1 0 2 1 0 0 1 0 1 0 0 0 0 0 0 1 0 0 9 0 1064.5138 P04264 P04264 KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes yes 2 0.0087383 99.815 1 0 21 1 0 21 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1347300 0 0 48939 43429 71627 81045 45323 0 0 39684 61141 67723 61799 0 0 0 82508 82221 0 0 92541 76345 0 0 78002 83121 0 0 40861 0 148940 0 0 61840 80232 + 38 79;39;18 38 418;419;420;421;422;423;424 223;224;225;226;227;228 223 AQYEEIAQR 2 1 0 0 0 2 2 0 0 1 0 0 0 0 0 0 0 0 1 0 0 9 0 1106.5356 P35908;CON__P35908;Q01546;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P19013;P19013 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;KRT2B;KRT2P;KRT76;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;CYK4;KRT4;CYK4;KRT4 Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-2P;Keratin, type II cytoskeletal 2 oral;Keratin-76;Type-II keratin Kb9;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4 no no 2 4.5894E-08 149.72 1 0 7 NaN NaN 1 1 1 1 1 1 1 165650 0 0 0 0 47093 0 0 0 0 0 16502 0 0 0 0 0 0 41533 0 0 0 0 0 0 0 0 0 0 0 0 60521 0 0 0 0 + 39 55 39 425;426;427;428;429;430;431;432;433;434;435;436;437 229;230;231;232;233;234;235 231 ARFEELNADLFR 2 2 1 1 0 0 2 0 0 0 2 0 0 2 0 0 0 0 0 0 0 12 1 1479.747 P11142;P54652 P11142 HSC70;HSP73;HSPA10;HSPA8;HSPA2 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 yes no 2,3 0.0039309 106.49 1 0 13 1 0 13 2 2 2 2 1 2 2 2 2 2 2 1 2 2 1734300 333570 299640 307650 340060 0 0 48360 0 0 0 0 0 0 0 0 0 0 0 0 0 216420 188580 0 0 0 0 0 0 0 0 0 0 0 0 0 40 162 40 438;439 236;237 237 ARIQEAVYKNVR 2 2 1 0 0 1 1 0 0 1 0 1 0 0 0 0 0 0 1 2 0 12 2 1445.8103 Q8TEM1 Q8TEM1 KIAA0906;NUP210;PSEC0245 Nuclear envelope pore membrane protein POM 210;Nuclear pore membrane glycoprotein 210;Nucleoporin Nup210;Pore membrane protein of 210 kDa yes yes 3 0.0015906 57.532 1 0 2 1 0 2 1 1 1 1 148110 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 76025 72086 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 41 106 41 440;441;442;443;444;445;446;447 238;239;240 240 ATADDELSFK 2 0 0 2 0 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 0 10 0 1095.5084 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 0.00048135 120.99 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1202300 0 24427 0 0 0 0 0 0 0 0 0 0 166080 154750 220380 221630 0 0 0 0 0 0 0 0 0 0 0 0 123570 147170 144250 0 0 0 0 42 38 42 448;449;450;451;452;453;454;455;456;457;458;459;460;461;462;463;464;465;466;467;468;469;470 241;242;243;244;245;246;247;248;249 242 ATGQVCHALCSPEGCWGPEPR 2 1 0 0 3 1 2 3 1 0 1 0 0 0 3 1 1 1 0 1 0 21 0 2368.0147 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 4.297E-10 155.2 1 0 23 1 0 23 2 1 2 3 1 1 2 2 1 1 2 2 1 1 1 2 1 2 3 1 1 2 2 1 1 2 2 1 1 1 19633000 4801900 110920 4006300 4310400 0 0 0 0 0 0 0 0 670370 680530 1084900 975280 0 0 57725 49098 1429300 1152400 0 0 0 0 0 0 24997 39990 238940 0 0 0 0 43 122 43 471;472;473;474;475;476;477;478;479;480 250;251;252 252 ATLSNQEHQWLFSR 1 1 1 0 0 2 1 0 1 0 2 0 0 1 0 2 1 1 0 0 0 14 0 1715.838 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2,3 0.00023828 155.66 1 0 10 1 0 10 2 2 2 2 1 1 2 2 2 2 1 1 2077300 0 0 0 0 0 0 0 0 0 0 0 0 261150 297570 691350 689690 0 0 0 0 0 0 0 0 0 0 0 0 0 25132 112380 0 0 0 0 44 134 44 481;482 253;254 254 ATMIPPVK 1 0 0 0 0 0 0 0 0 1 0 1 1 0 2 0 1 0 0 1 0 8 0 855.48881 Q15751 Q15751 HERC1 HECT domain and RCC1-like domain-containing protein 1;p532;p619;Probable E3 ubiquitin-protein ligase HERC1 yes yes 2 0.082935 31.372 1 0 2 1 0 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 45 5;150;109 45 483;484 255;256 256 AVCMLSNTTAIAEAWAR 5 1 1 0 1 0 1 0 0 1 1 0 1 0 0 1 2 1 0 1 0 17 0 1863.8971 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q13748;Q6PEY2;Q9NY65;P68366 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha no no 3 0.0043871 81.311 1 0 2 NaN NaN 1 1 212260 106160 106100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 46 1 46 485;486;487;488;489 257 257 AVFPSIVGRPR 1 2 0 0 0 0 0 1 0 1 0 0 0 1 2 1 0 0 0 2 0 11 1 1197.6982 A5A3E0;P0CG38;Q6S8J3;P68032;P68133;CON__P60712;P60709;P63261;Q9BYX7;P62736;P63267 A5A3E0 A26C1B;POTEF;A26C1A;POTE2;POTEE;ACTC;ACTC1;ACTA;ACTA1;ACTB;ACTB;ACTG;ACTG1;ACTBL3;FKSG30;POTEKP;ACTA2;ACTSA;ACTVS;GIG46;ACTA3;ACTG2;ACTL3;ACTSG ANKRD26-like family C member 1B;Chimeric POTE-actin protein;POTE ankyrin domain family member F;ANKRD26-like family C member 1A;POTE ankyrin domain family member E;Prostate, ovary, testis-expressed protein on chromosome 2;Actin, alpha cardiac muscle 1;Alpha-cardiac actin;Actin, alpha skeletal muscle;Alpha-actin-1;Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Beta-actin;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Gamma-actin;Kappa-actin;POTE ankyrin domain family member K;Putative beta-actin-like protein 3;Actin, aortic smooth muscle;Alpha-actin-2;Cell growth-inhibiting gene 46 protein;Actin, gamma-enteric smooth muscle;Alpha-actin-3;Gamma-2-actin;Smooth muscle gamma-actin yes no 2 0.035919 76.943 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 254710 46154 56484 73265 66506 0 0 0 0 0 12300 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 47 109 47 490;491 258;259 258 AVFVDLEPTVIDEIR 1 1 0 2 0 0 2 0 0 2 1 0 0 1 1 0 1 0 0 3 0 15 0 1714.9142 P68366 P68366 TUBA1;TUBA4A Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha yes yes 3 0.12995 66.989 1 0 2 1 0 2 1 1 1 1 202450 112770 89674 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 48 5;150 48 492;493;494;495;496;497;498;499;500;501;502;503;504;505;506;507;508;509;510;511;512;513;514;515;516;517;518;519;520 260;261;262;263;264;265;266;267;268;269;270 263 AVFVDLEPTVIDEVR 1 1 0 2 0 0 2 0 0 1 1 0 0 1 1 0 1 0 0 4 0 15 0 1700.8985 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6 Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain no no 2,3 2.882E-20 211.38 1 0 29 NaN NaN 2 2 2 2 2 2 1 2 2 1 1 2 2 2 2 1 1 11713000 2830100 2451200 1560800 1401900 0 0 357510 326240 0 0 0 0 25354 0 460040 442250 51917 41708 274340 198560 626990 525870 0 0 0 0 94723 43265 0 0 0 0 0 0 0 + 49 174 49 521;522;523;524;525 271 271 AVQFFVQALR 2 1 0 0 0 2 0 0 0 0 1 0 0 2 0 0 0 0 0 2 0 10 0 1177.6608 Q99615 Q99615 DNAJC7;TPR2;TTC2 DnaJ homolog subfamily C member 7;Tetratricopeptide repeat protein 2 yes yes 2 0.027095 85.29 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 210590 48787 35974 56477 56290 0 0 0 13066 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 50 113 50 526;527;528;529;530 272;273 273 AWGILTFK 1 0 0 0 0 0 0 1 0 1 1 1 0 1 0 0 1 1 0 0 0 8 0 934.52764 P82930 P82930 MRPS34 28S ribosomal protein S34, mitochondrial yes yes 2 0.12041 79.116 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 451870 0 0 0 0 78475 74406 137950 106090 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 54950 0 0 0 0 0 0 0 51 78 51 531;532;533 274 274 CGHSENFFFIEVGR 0 1 1 0 1 0 2 2 1 1 0 0 0 3 0 1 0 0 0 1 0 14 0 1697.762 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 3 0.010562 96.745 1 0 3 1 0 3 1 1 1 1 1 1 225550 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 26649 116850 82051 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 52 202 52 534;535;536;537;538;539;540;541;542;543;544;545;546;547;548;549;550;551;552;553;554;555;556;557;558;559;560;561;562 275;276;277;278 276 CHRNLLDCLMLMMR 0 2 1 1 2 0 0 0 1 0 4 0 3 0 0 0 0 0 0 0 0 14 1 1861.8606 REV__Q8WX94 REV__Q8WX94 yes yes 3 0.088848 34.685 1 0 29 1 0 29 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 2 2 1 2 1 1 1 1 1 3203200 0 44615 92145 118780 116760 152730 76139 69328 67246 95190 37737 0 261470 297420 134680 142960 178900 190760 216170 26497 160880 79098 0 0 0 0 0 21729 0 0 0 80273 0 270210 271500 + 53 73 53 563;564;565;566 279;280;281;282 281 CMMAQYNR 1 1 1 0 1 1 0 0 0 0 0 0 2 0 0 0 0 0 1 0 0 8 0 1072.4252 P31948 P31948 STIP1 Hsc70/Hsp90-organizing protein;Renal carcinoma antigen NY-REN-11;Stress-induced-phosphoprotein 1;Transformation-sensitive protein IEF SSP 3521 yes yes 2 0.082907 13.053 1 0 4 1 0 4 1 2 1 1 2 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 54 38 54 567;568;569;570;571;572;573;574;575;576;577 283;284;285;286;287;288;289 284 CNLLEGEPR 0 1 1 0 1 0 2 1 0 0 2 0 0 0 1 0 0 0 0 0 0 9 0 1086.5128 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 6.7954E-12 107.57 1 0 11 1 0 11 1 1 2 1 1 2 1 1 1 1 1 2 1 1 2 1 1 1 714700 152760 127560 151830 107700 0 0 0 0 0 0 0 0 0 24835 0 0 0 0 0 0 104360 0 0 45663 0 0 0 0 0 0 0 0 0 0 0 55 16 55 578;579;580;581;582;583;584;585;586;587;588;589;590;591;592;593 290;291;292;293;294;295;296;297;298 290 DAEAWFNEK 2 0 1 1 0 0 2 0 0 0 0 1 0 1 0 0 0 1 0 0 0 9 0 1108.4825 CON__P13645;P13645;CON__Q7Z3Y7;CON__Q148H6;Q7Z3Y7;CON__Q7Z3Y8;Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Z0 CON__P13645 KPP;KRT10;KPP;KRT10;KRT25D;KRT28;KRT25D;KRT28;KRT25C;KRT27;KRT25C;KRT27;KRT25;KRT25A;KRT25;KRT25A Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-28;Keratin, type I cytoskeletal 28;Keratin-25D;Keratin-28;Type I inner root sheath-specific keratin-K25irs4;Cytokeratin-27;Keratin, type I cytoskeletal 27;Keratin-25C;Keratin-27;Type I inner root sheath-specific keratin-K25irs3;Cytokeratin-25;Keratin, type I cytoskeletal 25;Keratin-25;Keratin-25A;Type I inner root sheath-specific keratin-K25irs1 yes no 2 3.7884E-12 116.05 1 0 16 1 0 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 817100 0 0 0 43266 46155 71498 37672 37352 0 0 30302 0 0 0 41854 0 103020 87910 29421 25013 70563 60490 0 0 0 0 0 0 0 0 83251 0 0 0 49328 + 56 8 56 594;595;596;597 299;300 300 DAEEWFFTK 1 0 0 1 0 0 2 0 0 0 0 1 0 2 0 0 1 1 0 0 0 9 0 1171.5186 CON__P02533;P02533;CON__Q6IFX2 CON__P02533 KRT14;KRT14;Ka22;Krt42 Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-42;Keratin, type I cytoskeletal 42;Keratin-17n;Keratin-42;Type I keratin Ka22 yes no 2 0.0098159 97.431 1 0 4 1 0 4 1 1 1 1 1 1 1 1 103120 0 0 0 0 0 0 0 0 0 0 0 0 26039 0 0 0 0 40684 0 0 0 0 0 0 0 0 0 0 0 0 36394 0 0 0 0 + 57 55 57 598;599;600;601;602;603;604;605;606;607;608;609;610;611;612;613;614;615;616;617;618;619;620;621;622;623;624;625;626;627;628;629;630;631;632;633;634;635;636;637;638;639;640 301;302;303;304;305;306;307;308;309;310;311;312;313;314;315;316;317;318;319;320;321;322;323;324;325;326;327;328 307 DAGTIAGLNVLR 2 1 1 1 0 0 0 2 0 1 2 0 0 0 0 0 1 0 0 1 0 12 0 1198.667 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 2 1.2361E-45 199.43 1 0 43 1 0 43 2 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 1 1 1 2 2 1 1 1 1 1 2 2 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 1 1 1 1 2 2 1 1 1 1 1 2 17017000 2115200 2225500 2148700 2401700 334600 324570 431070 489740 139910 134670 160140 166880 152100 176930 154400 202750 173290 123430 102660 154280 1319500 1245800 146780 168510 60322 78756 570730 548920 57466 70282 47693 67452 64466 257900 0 58 52 58 641;642;643;644;645;646;647;648;649;650;651;652;653;654;655;656;657;658;659;660 329;330;331;332;333;334;335;336;337;338;339;340;341;342;343 329 DAGVIAGLNVLR 2 1 1 1 0 0 0 2 0 1 2 0 0 0 0 0 0 0 0 2 0 12 0 1196.6877 P0DMV8;P0DMV9 P0DMV8 no no 2 2.2739E-05 163.12 1 0 20 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2347900 352060 354390 279040 302320 73672 62483 67414 62365 0 0 0 0 44529 54552 67923 78037 40724 34384 44855 34865 146710 154800 0 0 0 0 43483 49313 0 0 0 0 0 0 0 59 85;25 59 661;662;663;664 344;345;346 345 DALLNWLK 1 0 1 1 0 0 0 0 0 0 3 1 0 0 0 0 0 1 0 0 0 8 0 971.54402 P42338;O00329 P42338 PIK3C1;PIK3CB;PIK3CD Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform;Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform no no 2 0.0032099 127.02 1 0 4 NaN NaN 1 1 1 1 751440 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 247150 203640 176930 123730 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 60 58 60 665;666;667;668;669;670;671;672;673;674;675;676;677;678;679 347;348;349;350;351;352;353;354;355;356;357;358;359 348 DFLAGGIAAAISK 4 0 0 1 0 0 0 2 0 2 1 1 0 1 0 1 0 0 0 0 0 13 0 1232.6765 P12236 P12236 ANT3;CDABP0051;SLC25A6 Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6 yes yes 2 1.2049E-21 172.92 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1655400 351280 284340 184240 209280 0 30275 46739 52739 0 0 0 0 0 0 80915 91761 18644 0 0 0 143340 124510 0 0 0 0 0 37346 0 0 0 0 0 0 0 61 43 61 680;681;682;683;684;685;686;687;688;689;690;691;692;693;694;695;696;697;698;699;700;701;702 360;361;362;363;364;365;366;367;368;369;370;371;372;373;374;375;376;377 373 DFLAGGVAAAISK 4 0 0 1 0 0 0 2 0 1 1 1 0 1 0 1 0 0 0 1 0 13 0 1218.6608 P05141 P05141 ANT2;SLC25A5 Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5 yes yes 2 2.5752E-43 205.46 1 0 23 1 0 23 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4621800 712810 740110 588950 573990 118270 126410 116350 124590 0 0 0 0 147220 156350 179180 163460 0 41226 42135 0 287850 253130 0 0 0 0 59150 51084 0 26380 81190 0 0 31948 0 62 35 62 703;704;705;706;707;708;709;710;711 378;379;380 380 DFLTPPLLSVR 0 1 0 1 0 0 0 0 0 0 3 0 0 1 2 1 1 0 0 1 0 11 0 1256.7129 O95782 O95782 ADTAA;AP2A1;CLAPA1 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit yes yes 2 0.035104 77.662 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 506930 60288 61262 46610 45290 0 0 0 0 0 0 0 0 0 39073 107380 87692 0 0 0 0 0 24901 0 0 0 0 0 0 0 0 34438 0 0 0 0 63 84 63 712;713;714;715;716;717 381;382;383;384;385 381 DFLWSHR 0 1 0 1 0 0 0 0 1 0 1 0 0 1 0 1 0 1 0 0 0 7 0 959.46135 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.015366 122.79 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 641670 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 125940 135090 134150 111750 0 0 0 0 0 0 0 0 0 0 0 0 0 61854 72878 64 26 64 718;719 386;387 386 DGAPEPGLTLPDLPEQFSPPDVAPPLLVK 2 0 0 3 0 1 2 2 0 0 5 1 0 1 8 1 1 0 0 2 0 29 0 3008.5747 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 1.3222E-08 103.9 1 0 2 1 0 2 1 1 1 1 11976000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 6106800 5869100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 65 163 65 720;721 388 388 DGFVCALLR 1 1 0 1 1 0 0 1 0 0 2 0 0 1 0 0 0 0 0 1 0 9 0 1049.5328 Q8WUY1 Q8WUY1 C8orf55;PSEC0098 Mesenchymal stem cell protein DSCD75;UPF0670 protein C8orf55 yes yes 2 0.0095436 98.033 1 0 2 1 0 2 1 1 1 1 78885 0 0 0 56864 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 22021 0 0 0 0 0 0 0 0 0 0 0 0 0 0 66 197 66 722;723 389 389 DHQFILR 0 1 0 1 0 1 0 0 1 1 1 0 0 1 0 0 0 0 0 0 0 7 0 927.49265 REV__Q6IE37 REV__Q6IE37 yes yes 2 0.049035 101.64 1 0 2 1 0 2 1 1 1 1 2330700 0 0 0 0 0 0 0 0 0 0 0 0 0 25763 2305000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 67 32 67 724;725;726;727 390;391 391 DIVQFVPFR 0 1 0 1 0 1 0 0 0 1 0 0 0 2 1 0 0 0 0 2 0 9 0 1119.6077 Q9UBL6;Q9HCH3;Q86YQ8;O95741;Q96A23;Q8IYJ1;Q96FN4;O75131 Q9UBL6 CPNE7;CPNE5;KIAA1599;CPNE8;CPNE6;CPNE4;CPNE9;CPNE2;CPN3;CPNE3;KIAA0636 Copine VII;Copine-7;Copine V;Copine-5;Copine VIII;Copine-8;Copine VI;Copine-6;Neuronal-copine;Copine IV;Copine-4;Copine IX;Copine-9;Copine II;Copine-2;Copine III;Copine-3 yes no 2 0.0081552 101.11 1 0 4 1 0 4 1 1 1 1 1 1 1 1 160180 38969 40669 40183 40356 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 68 84 68 728;729;730;731 392;393 392 DKNKGEIYDAAIDLFTR 2 1 1 3 0 0 1 1 0 2 1 2 0 1 0 0 1 0 1 0 0 17 2 1967.9953 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 3 0.004851 90.367 1 0 4 1 0 4 1 1 1 1 1 1 1 1 406350 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 93089 105430 106500 101320 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 69 91 69 732;733;734;735;736;737;738;739 394;395 395 DLEKPFLLPVEAVYSVPGR 1 1 0 1 0 0 2 1 0 0 3 1 0 1 3 1 0 0 1 3 0 19 1 2128.1568 P49411 P49411 TUFM Elongation factor Tu, mitochondrial;P43 yes yes 3 0.0021616 82.259 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1853800 532560 595720 144060 157900 0 0 0 43231 0 0 0 0 0 0 0 68198 0 0 0 0 150360 161740 0 0 0 0 0 0 0 0 0 0 0 0 0 70 49 70 740;741;742;743;744;745;746;747;748;749;750;751;752 396;397;398;399;400;401;402;403;404;405 399 DLIGFGLQVAK 1 0 0 1 0 1 0 2 0 1 2 1 0 1 0 0 0 0 0 1 0 11 0 1159.6601 P08581 P08581 MET Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met yes yes 2 0.00057186 129.89 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1126500 36690 0 0 0 0 0 0 0 0 0 0 0 28854 0 74291 55753 0 0 0 0 145350 128050 0 0 0 0 42115 39497 71548 73250 330050 0 0 51709 49388 71 54 71 753;754;755;756;757;758;759;760;761;762;763;764;765;766;767;768;769;770;771;772;773;774;775;776;777;778;779;780;781;782;783;784;785;786;787;788;789;790;791;792;793;794;795;796;797;798 406;407;408;409;410;411;412;413;414;415;416;417 410 DNHLLGTFDLTGIPPAPR 1 1 1 2 0 0 0 2 1 1 3 0 0 1 3 0 2 0 0 0 0 18 0 1933.0058 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2,3 0.00055502 111.01 1 0 46 1 0 46 4 7 4 4 3 4 2 2 1 2 4 4 1 2 2 4 7 4 4 3 4 2 2 1 2 4 4 1 2 2 13609000 2854300 2343800 1327700 1503300 0 0 562890 573530 0 0 0 0 0 0 88575 125680 0 0 29210 66862 1632300 1847500 0 0 0 0 261900 317720 0 0 73635 0 0 0 0 72 84 72 799;800 418;419 418 DPLSEITEQEKDFLWSHR 0 1 0 2 0 1 3 0 1 1 2 1 0 1 1 2 1 1 0 0 0 18 1 2229.0702 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 3 0.00054666 102.5 1 0 2 1 0 2 1 1 1 1 900490 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 451580 448910 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 73 26 73 801;802;803;804;805;806;807;808;809;810;811;812;813;814;815 420;421;422;423;424;425;426;427;428;429;430 421 DQYLVWLTQK 0 0 0 1 0 2 0 0 0 0 2 1 0 0 0 0 1 1 1 1 0 10 0 1292.6765 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 8.0914E-08 173.64 1 0 15 1 0 15 1 1 1 3 2 2 1 1 1 1 1 1 1 1 3 2 2 1 1 1 1 1 11441000 0 0 0 0 0 23940 62531 82052 0 0 0 0 0 0 0 0 4440000 4316400 43045 0 0 0 0 0 0 0 0 0 0 0 0 492450 480800 723320 776180 74 87 74 816;817 431 431 DSLIIIDELGR 0 1 0 2 0 0 1 1 0 3 2 0 0 0 0 1 0 0 0 0 0 11 0 1242.682 P43246 P43246 MSH2 DNA mismatch repair protein Msh2;MutS protein homolog 2 yes yes 2 0.077264 70.977 1 0 2 1 0 2 1 1 1 1 72406 0 0 0 0 0 0 0 0 0 0 0 0 32096 40310 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 75 113 75 818;819;820;821 432 432 DSQLYAVDYETLTRPFSGR 1 2 0 2 0 1 1 1 0 0 2 0 0 1 1 2 2 0 2 1 0 19 1 2217.0702 P82930 P82930 MRPS34 28S ribosomal protein S34, mitochondrial yes yes 3 0.0019854 83.37 1 0 4 1 0 4 1 1 1 1 1 1 1 1 342040 0 0 0 0 0 0 82413 125350 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 67413 66856 0 0 0 0 0 0 0 76 157 76 822 433 433 DSSVKRGYFQK 0 1 0 1 0 1 0 1 0 0 0 2 0 1 0 2 0 0 1 1 0 11 2 1313.6728 Q8NEG7 Q8NEG7 FAM116B Protein FAM116B yes yes 2 0.08203 35.652 1 0 1 1 0 1 1 1 1376200 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1376200 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 77 101;70 77 823;824;825;826;827;828;829;830 434;435 434 DSTLIMQLLR 0 1 0 1 0 1 0 0 0 1 3 0 1 0 0 1 1 0 0 0 0 10 0 1188.6536 P62258;P31947;P61981;P31946;Q04917;P63104;P27348 P62258 YWHAE;HME1;SFN;YWHAG;YWHAB;YWHA1;YWHAH;YWHAZ;YWHAQ 14-3-3 protein epsilon;14-3-3 protein sigma;Epithelial cell marker protein 1;Stratifin;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;Protein kinase C inhibitor protein 1;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;Protein 1054;14-3-3 protein eta;Protein AS1;14-3-3 protein zeta/delta;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1 no no 2 0.0034526 105.98 1 0 8 NaN NaN 1 1 1 1 1 1 1 1 601060 83757 74147 0 0 0 0 0 0 0 0 0 0 0 0 87782 62041 69073 82737 71383 70138 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 78 26 78 831;832;833;834;835;836;837;838 436;437;438;439;440 439 DTPDGTFLVR 0 1 0 2 0 0 0 1 0 0 1 0 0 1 1 0 2 0 0 1 0 10 0 1119.556 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.00087659 113.71 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1246000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 151230 176180 286450 249400 0 0 0 0 0 0 0 0 0 0 0 80754 83728 108200 110050 79 5;150 79 839;840;841;842 441;442;443;444 441 DVNAAIATIK 3 0 1 1 0 0 0 0 0 2 0 1 0 0 0 0 1 0 0 1 0 10 0 1014.571 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain no no 2 0.002013 109.42 1 0 4 NaN NaN 1 1 1 1 230990 50939 63868 52103 64084 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 80 26 80 843;844;845;846;847;848;849;850;851;852;853;854;855;856;857;858;859;860;861;862;863;864;865;866;867;868;869;870;871;872 445;446;447;448;449;450;451;452 446 EAAGPVGPALEPPTLPLHR 3 1 0 0 0 0 2 2 1 0 3 0 0 0 5 0 1 0 0 1 0 19 0 1921.0421 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 0.0001128 129.01 1 0 30 1 0 30 1 1 1 1 1 1 1 1 3 2 4 2 1 3 3 2 2 1 1 1 1 1 1 1 1 3 2 4 2 1 3 3 2 2 40371000 0 145360 0 0 96485 96376 240790 308000 0 0 0 0 19307 0 95236 41052 5340000 5171300 9761000 7290500 0 0 0 0 0 0 0 63342 0 0 0 2527100 2603000 3247200 3325000 81 166 81 873;874;875;876;877;878 453;454;455;456;457 455 EALDVLGAVLK 2 0 0 1 0 0 1 1 0 0 3 1 0 0 0 0 0 0 0 2 0 11 0 1126.6598 Q92552 Q92552 KIAA0264;MRPS27 28S ribosomal protein S27, mitochondrial yes yes 2 0.00087624 112.36 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 959600 0 0 0 0 149290 189620 211030 189320 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 109260 111090 0 0 0 0 0 0 0 82 85 82 879;880 458 458 EALELLDFNYPDQYVR 1 1 1 2 0 1 2 0 0 0 3 0 0 1 1 0 0 0 2 1 0 16 0 1983.9578 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2 0.0039645 120.7 1 0 2 1 0 2 1 1 1 1 514920 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 260890 254030 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 83 128 83 881;882 459;460 459 EALSVALEEAQAWR 4 1 0 0 0 1 3 0 0 0 2 0 0 0 0 1 0 1 0 1 0 14 0 1571.7944 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 3 0.0081786 124.42 1 0 2 1 0 2 1 1 1 1 167820 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 104460 63351 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 84 26 84 883;884;885;886;887;888 461;462;463;464;465 463 EDSVEAVGAQLK 2 0 0 1 0 1 2 1 0 0 1 1 0 0 0 1 0 0 0 2 0 12 0 1244.6248 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.0028082 110.66 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 398780 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 55483 60843 93867 83881 0 0 0 0 0 0 0 0 0 0 0 0 0 49374 55331 85 114 85 889 466 466 EEGVLTLWR 0 1 0 0 0 0 2 1 0 0 2 0 0 0 0 0 1 1 0 1 0 9 0 1101.5819 Q02978 Q02978 SLC20A4;SLC25A11 Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11 yes yes 2 0.11783 51.066 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 86 194 86 890;891;892;893;894;895;896;897 467 467 EFKAEINKLLQEEK 1 0 1 0 0 1 4 0 0 1 2 3 0 1 0 0 0 0 0 0 0 14 2 1717.9251 REV__Q0VFZ6 REV__Q0VFZ6 yes yes 3 0.088848 83.204 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1494200 453930 411620 218710 201300 0 0 0 0 0 0 0 0 0 0 38379 51807 0 0 0 0 59827 58648 0 0 0 0 0 0 0 0 0 0 0 0 0 + 87 120;121 87 898;899;900;901;902 468 468 EFTDYLFNK 0 0 1 1 0 0 1 0 0 0 1 1 0 2 0 0 1 0 1 0 0 9 0 1175.5499 Q07889;Q07890 Q07889 SOS1;SOS2 Son of sevenless homolog 1;Son of sevenless homolog 2 no no 2 0.060002 78.516 1 0 5 NaN NaN 1 1 1 1 1 212240 0 0 0 0 0 0 24611 0 0 0 0 0 35903 72032 0 46865 0 0 0 32828 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 88 67 88 903;904;905;906;907;908;909 469;470;471 471 EGFYLFPDGR 0 1 0 1 0 0 1 2 0 0 1 0 0 2 1 0 0 0 1 0 0 10 0 1199.5611 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 2 0.017875 101.65 1 0 7 1 0 7 1 1 1 1 2 1 1 1 1 1 2 1 483170 0 0 0 0 0 0 0 0 0 0 0 0 0 0 42290 41695 69470 73768 190550 65402 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 89 108 89 910;911;912 472 472 EHALLAYTLGVK 2 0 0 0 0 0 1 1 1 0 3 1 0 0 0 0 1 0 1 1 0 12 0 1313.7343 Q05639;P68104;Q5VTE0 Q05639 EEF1A2;EEF1AL;STN;EEF1A;EEF1A1;EF1A;LENG7;EEF1AL3 Elongation factor 1-alpha 2;Eukaryotic elongation factor 1 A-2;Statin-S1;Elongation factor 1-alpha 1;Elongation factor Tu;Eukaryotic elongation factor 1 A-1;Leukocyte receptor cluster member 7;Eukaryotic elongation factor 1 A-like 3;Putative elongation factor 1-alpha-like 3 yes no 2 0.0046044 104.43 1 0 3 1 0 3 1 1 1 1 1 1 159010 58335 0 46189 54485 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 90 38 90 913;914;915 473;474 474 EHKDNIGSQYLLNWCVQIAK 1 0 2 1 1 2 1 1 1 2 2 2 0 0 0 1 0 1 1 1 0 20 1 2415.2005 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 2.3732E-06 115.8 1 0 3 1 0 3 1 1 1 1 1 1 717860 328020 270390 0 0 0 0 0 0 0 0 0 0 0 0 119450 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 91 5;150 91 916;917;918;919;920;921;922;923;924;925;926;927;928;929;930;931 475;476;477;478;479;480;481;482;483;484;485 477 EIIDLVLDR 0 1 0 2 0 0 1 0 0 2 2 0 0 0 0 0 0 0 0 1 0 9 0 1084.6128 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6 Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain no no 2 0.0042642 109.71 1 0 16 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2381800 513950 517160 316740 347920 55785 59700 73746 75043 0 0 0 0 40387 38125 79446 78943 32448 0 0 0 74441 53795 0 0 0 0 24137 0 0 0 0 0 0 0 0 + 92 94 92 932;933;934;935;936 486;487;488 488 EIIELLFHK 0 0 0 0 0 0 2 0 1 2 2 1 0 1 0 0 0 0 0 0 0 9 0 1140.6543 P52735 P52735 VAV2 Guanine nucleotide exchange factor VAV2 yes yes 2 0.0070845 78.516 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 139250 0 0 36728 0 0 0 0 0 0 0 0 0 0 42183 60335 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 93 38 93 937;938;939;940;941 489 489 EILDEAYVMASVDNPHVCR 2 1 1 2 1 0 2 0 1 1 1 0 1 0 1 1 0 0 1 3 0 19 0 2217.0194 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.075365 63.128 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1031600 325640 270730 0 0 0 0 0 0 0 0 0 0 0 0 76713 0 0 0 0 0 198810 159730 0 0 0 0 0 0 0 0 0 0 0 0 0 94 38 94 942;943;944;945;946;947;948;949;950;951;952;953 490;491;492;493;494;495;496;497;498 496 EISDGDVIISGNK 0 0 1 2 0 0 1 2 0 3 0 1 0 0 0 2 0 0 0 1 0 13 0 1345.6725 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 4.444E-19 215.08 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2487700 466530 498690 277990 327300 0 0 0 0 0 0 0 0 57282 74862 94154 78824 0 0 0 0 166150 170010 143370 132500 0 0 0 0 0 0 0 0 0 0 0 95 138 95 954 499 499 EKEEMEMEIMEMEEEK 0 0 0 0 0 0 9 0 0 1 0 2 4 0 0 0 0 0 0 0 0 16 1 2072.8298 Q4G1C9 Q4G1C9 GLIPR1L2 GLIPR1-like protein 2 yes yes 4 0.05097 5.4286 1 0 1 1 0 1 1 1 101790 0 0 0 0 0 0 0 0 0 0 0 0 0 101790 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 96 66 96 955;956;957;958;959;960;961;962;963 500;501;502 501 ELANEFTR 1 1 1 0 0 0 2 0 0 0 1 0 0 1 0 0 1 0 0 0 0 8 0 978.47706 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 0.00051478 136.11 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 717730 0 0 0 0 116200 124980 129510 124280 0 0 0 0 0 0 0 0 0 32493 0 43250 0 0 0 0 45076 46143 55807 0 0 0 0 0 0 0 0 97 54 97 964;965;966;967;968;969;970;971;972;973;974;975;976 503;504;505;506;507;508;509;510;511 503 ELEEIVQPIISK 0 0 0 0 0 1 3 0 0 3 1 1 0 0 1 1 0 0 0 1 0 12 0 1396.7813 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.00017107 155.48 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4265100 492730 523920 504840 512610 298140 301730 298730 235000 0 0 0 0 0 0 0 0 0 0 0 0 396350 415570 0 0 0 0 150140 120030 0 15279 0 0 0 0 0 98 38 98 977;978;979;980;981;982;983;984;985;986;987;988;989;990;991;992;993;994;995;996 512;513;514;515;516;517;518 515 ELIIEFSK 0 0 0 0 0 0 2 0 0 2 1 1 0 1 0 1 0 0 0 0 0 8 0 977.54335 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.029827 100.19 1 0 20 1 0 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 22588000 3494800 3159700 3937700 4543200 55833 45593 75102 79680 0 0 0 0 1087000 977170 0 1304600 99087 151140 174210 134790 2368200 0 358030 0 0 0 0 48222 235500 258610 0 0 0 0 0 99 160 99 997;998;999;1000;1001;1002;1003;1004;1005;1006;1007;1008 519 519 ELPRPEMPMFLGLAFATQYR 2 2 0 0 0 1 2 1 0 0 3 0 2 2 3 0 1 0 1 0 0 20 1 2366.1915 Q8NFI3 Q8NFI3 ENGASE Cytosolic endo-beta-N-acetylglucosaminidase yes yes 3 0.18691 12.714 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5241800 0 401400 0 0 0 0 500210 461880 0 0 0 0 0 0 0 448840 0 338830 237630 170120 0 473850 0 0 0 0 653160 654260 0 0 558930 0 0 342660 0 100 129 100 1009;1010;1011;1012 520;521;522 522 ELQNFLR 0 1 1 0 0 1 1 0 0 0 2 0 0 1 0 0 0 0 0 0 0 7 0 918.49232 Q14571 Q14571 ITPR2 Inositol 1,4,5-trisphosphate receptor type 2;IP3 receptor isoform 2;Type 2 inositol 1,4,5-trisphosphate receptor yes yes 2 0.069662 89.296 1 0 4 1 0 4 1 1 1 1 1 1 1 1 232220 0 0 0 0 0 0 0 0 0 0 0 0 0 47481 89627 67958 0 0 0 0 0 0 0 0 0 0 0 0 0 27153 0 0 0 0 0 101 83 101 1013;1014;1015;1016 523;524;525 524 ELSAVTFPDIIR 1 1 0 1 0 0 1 0 0 2 1 0 0 1 1 1 1 0 0 1 0 12 0 1359.7398 P42224 P42224 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84 yes yes 2 3.7066E-05 162.38 1 0 4 1 0 4 1 1 1 1 1 1 1 1 579980 181450 0 178730 191830 0 0 0 0 0 0 0 0 0 0 27980 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 102 16 102 1017;1018;1019;1020;1021;1022;1023;1024;1025;1026;1027;1028;1029 526;527;528;529;530;531;532;533 528 ELTTEIDNNIEQISSYK 0 0 2 1 0 1 3 0 0 3 1 1 0 0 0 2 2 0 1 0 0 17 0 1995.9637 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 1.511E-24 214.53 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2100500 0 0 100510 75811 0 0 0 27983 50249 0 0 0 0 0 158590 161660 250200 195930 121490 128140 239770 223370 0 0 0 0 0 0 0 0 366790 0 0 0 0 + 103 38 103 1030;1031;1032;1033;1034;1035;1036;1037;1038;1039;1040;1041;1042;1043;1044;1045;1046;1047;1048;1049;1050;1051;1052;1053;1054;1055;1056;1057;1058;1059;1060;1061;1062;1063;1064;1065;1066 534;535;536;537;538;539;540;541;542;543;544;545;546;547;548;549;550;551;552;553;554;555;556;557;558;559 544 ELVEPLTPSGEAPNQALLR 2 1 1 0 0 1 3 1 0 0 4 0 0 0 3 1 1 0 0 1 0 19 0 2033.0793 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 2.4222E-16 184.02 1 0 37 1 0 37 2 2 3 3 1 1 1 1 2 2 2 3 1 1 2 2 2 3 1 1 1 2 2 3 3 1 1 1 1 2 2 2 3 1 1 2 2 2 3 1 1 1 51252000 7397400 7701700 9860600 10103000 24667 34951 77730 93499 0 0 0 0 1642000 1778400 2184800 2194800 135980 125060 326770 240460 3494600 3086300 0 0 0 0 0 0 160330 216380 372540 0 0 0 0 104 43;58 104 1067;1068;1069;1070;1071;1072;1073;1074;1075;1076;1077;1078;1079;1080;1081;1082;1083;1084 560;561;562;563;564;565;566 565 EQGVLSFWR 0 1 0 0 0 1 1 1 0 0 1 0 0 1 0 1 0 1 0 1 0 9 0 1120.5665 P05141;P12236 P05141 ANT2;SLC25A5;ANT3;CDABP0051;SLC25A6 Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6 no no 2 0.0021207 118.18 1 0 18 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3400700 542010 469710 525500 483170 48197 57610 84978 94788 0 0 0 0 53835 75517 163150 146150 0 32327 0 29474 268480 236180 0 0 0 0 0 36856 0 0 52773 0 0 0 0 105 151 105 1085;1086;1087;1088;1089;1090 567;568;569 567 EQPLDLIK 0 0 0 1 0 1 1 0 0 1 2 1 0 0 1 0 0 0 0 0 0 8 0 954.5386 Q75V66 Q75V66 ANO5;GDD1;TMEM16E Anoctamin-5;Gnathodiaphyseal dysplasia 1 protein;Transmembrane protein 16E yes yes 2 0.019307 111.17 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 2111500 526100 459260 588830 0 0 0 0 0 0 0 0 0 0 0 207160 0 0 0 0 0 0 269340 0 0 0 0 0 0 0 0 60793 0 0 0 0 106 26 106 1091;1092;1093;1094;1095;1096;1097;1098;1099;1100;1101;1102;1103;1104;1105;1106;1107;1108;1109;1110;1111;1112;1113;1114;1115;1116;1117;1118 570;571;572;573;574;575;576;577;578;579;580;581;582;583;584;585 578 ERPEDLELLPGDVLVVSR 0 2 0 2 0 0 3 1 0 0 4 0 0 0 2 1 0 0 0 3 0 18 1 2035.095 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 1.2925E-06 156.5 1 0 28 1 0 28 1 2 1 2 2 6 5 1 1 1 2 2 2 1 2 1 2 2 6 5 1 1 1 2 2 2 56634000 0 0 0 0 0 0 248100 342880 0 0 0 0 0 0 0 63570 7567300 7012100 21436000 15806000 0 0 0 0 0 0 95855 60116 0 0 0 344780 495680 1571800 1589900 107 38 107 1119;1120;1121;1122;1123;1124;1125;1126;1127;1128;1129;1130 586;587;588 586 ESDCLVCR 0 1 0 1 2 0 1 0 0 0 1 0 0 0 0 1 0 0 0 1 0 8 0 1037.427 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.064802 89.142 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3533300 685930 580410 551780 563050 0 0 0 0 0 0 0 0 64552 80374 104790 119010 0 0 0 0 159220 138560 233180 252410 0 0 0 0 0 0 0 0 0 0 0 108 106 108 1131;1132;1133;1134;1135;1136;1137;1138;1139;1140;1141;1142 589;590;591;592 590 ESESAPGDFSLSVK 1 0 0 1 0 0 2 1 0 0 1 1 0 1 1 4 0 0 0 1 0 14 0 1451.678 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 0.07481 74.46 1 0 12 1 0 12 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1841000 0 0 0 0 0 0 22064 0 0 0 0 0 292450 277880 275550 323360 0 37772 35971 0 0 34479 0 0 0 0 0 0 159670 195920 185900 0 0 0 0 109 51 109 1143;1144;1145;1146;1147;1148;1149;1150;1151;1152;1153;1154;1155;1156;1157;1158;1159;1160;1161;1162;1163;1164;1165;1166;1167;1168;1169;1170;1171;1172 593;594;595;596;597;598;599;600;601 598 ESTLHLVLR 0 1 0 0 0 0 1 0 1 0 3 0 0 0 0 1 1 0 0 1 0 9 0 1066.6135 P0CG48;P0CG47;P62979;P62987 P0CG48 RPS27A;UBA80;UBCEP1;UBA52;UBCEP2 40S ribosomal protein S27a;60S ribosomal protein L40;CEP52 yes no 2 0.0033491 111.74 1 0 30 1 0 30 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4255400 177150 172630 302360 333460 112960 115420 135690 128970 0 0 0 0 159710 192620 241310 268930 154320 119900 218480 239730 181750 163610 58283 64814 50599 63571 81318 85022 73658 68950 85253 0 41907 89885 73091 110 71 110 1173;1174;1175;1176;1177;1178;1179;1180;1181;1182;1183;1184;1185;1186;1187;1188;1189;1190;1191;1192;1193;1194;1195;1196;1197;1198;1199 602;603;604;605;606;607 603 ESTTTPGQYVLTGLQSGQPK 0 0 0 0 0 3 1 3 0 0 2 1 0 0 2 2 4 0 1 1 0 20 0 2091.0484 P29353 P29353 SHC;SHC1;SHCA SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1 yes yes 2,3 2.162E-14 165.8 1 0 27 1 0 27 1 2 2 2 1 2 2 2 2 1 1 2 1 2 2 2 1 2 2 2 1 2 2 2 2 1 1 2 1 2 2 2 3644200 54938 118540 161710 158960 0 0 25716 0 0 0 0 0 638800 728500 547540 576120 40425 36920 119230 52984 0 0 0 0 0 0 0 0 54444 111300 218110 0 0 0 0 111 49 111 1200 608 608 EVFNILQAAYVSKPGAQLAR 4 1 1 0 0 2 1 1 0 1 2 1 0 1 1 1 0 0 1 2 0 20 1 2174.1848 P08581 P08581 MET Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met yes yes 3 1.4909E-07 140.96 1 0 1 1 0 1 1 1 485740 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 485740 0 0 0 0 112 119 112 1201;1202;1203;1204 609;610 609 EVSFQSTGESEWK 0 0 0 0 0 1 3 1 0 0 0 1 0 1 0 3 1 1 0 1 0 13 0 1512.6733 Q07021 Q07021 C1QBP;GC1QBP;HABP1;SF2P32 Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33 yes yes 2 6.262E-13 198.55 1 0 4 1 0 4 1 1 1 1 1 1 1 1 354840 0 0 0 0 0 0 0 0 122710 127520 48954 55659 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 113 78 113 1205;1206;1207;1208;1209;1210;1211 611;612;613;614;615 615 EVWQVILKPK 0 0 0 0 0 1 1 0 0 1 1 2 0 0 1 0 0 1 0 2 0 10 1 1238.7387 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 2 0.0020257 109.29 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1306100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 218050 181470 199820 135810 0 0 0 0 0 0 0 0 0 0 0 111160 113180 0 346620 114 26 114 1212;1213;1214;1215;1216;1217;1218;1219 616;617;618;619 617 EYDQLYEEYTR 0 1 0 1 0 1 3 0 0 0 1 0 0 0 0 0 1 0 3 0 0 11 0 1507.6467 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 9.4494E-05 150.04 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 795460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 91912 115340 179000 181650 0 0 0 0 0 0 0 0 0 0 0 46254 32705 83105 65499 115 18 115 1220;1221 620;621 620 FASFIDKVQFLEQQNK 1 0 1 1 0 3 1 0 0 1 1 2 0 3 0 1 0 0 0 1 0 16 1 1940.9996 CON__P19013;P19013 CON__P19013 CYK4;KRT4;CYK4;KRT4 Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4 yes no 3 0.0035805 125.03 1 0 2 1 0 2 1 1 1 1 168570 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 71954 96612 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 116 79;39;17;23;14;12 116 1222;1223;1224;1225;1226;1227;1228;1229;1230;1231;1232;1233;1234;1235;1236;1237;1238;1239;1240;1241;1242;1243 622;623;624;625;626;627;628;629;630;631;632;633;634;635;636;637;638 637 FASFIDKVR 1 1 0 1 0 0 0 0 0 1 0 1 0 2 0 1 0 0 0 1 0 9 1 1081.592 CON__Q6NXH9;CON__Q7Z794;Q7Z794;CON__Q6IFZ6;CON__Q32MB2;Q86Y46;CON__Q9R0H5;CON__Q01546;CON__P12035;P12035;CON__Q6ISB0;CON__Q9NSB2;Q9NSB2;CON__Q7RTS7;Q7RTS7;CON__P07744;CON__Q3SY84;Q3SY84;CON__Q6IME9;CON__Q14CN4-1;Q14CN4;CON__Q9DCV7;P35908;CON__P35908;Q01546;CON__O95678;O95678;CON__Q5XKE5;Q5XKE5;CON__Q8VED5;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P05787;P05787;CON__P13647;P13647;CON__P08729;CON__Q3KNV1;P08729 P35908 Kb36;Krt73;KRT1B;KRT77;KRT1B;KRT77;Krt1b;Krt77;K6IRS3;KB36;KRT6IRS3;KRT73;K6IRS3;KB36;KRT6IRS3;KRT73;K6irs1;Kb34;Krt2-6g;Krt6g;Krt71;KRT2B;KRT2P;KRT76;KRT3;KRT3;KRT84;KRTHB4;KRT84;KRTHB4;KRT84;KRTHB4;K6IRS4;KB37;KRT5C;KRT6IRS4;KRT74;K6IRS4;KB37;KRT5C;KRT6IRS4;KRT74;Krt2-4;Krt4;K6IRS1;KB34;KRT6IRS1;KRT71;K6IRS1;KB34;KRT6IRS1;KRT71;Kb35;Krt72;K6IRS2;KB35;KRT6;KRT6IRS2;KRT72;K6IRS2;KB35;KRT6;KRT6IRS2;KRT72;Krt2-7;Krt7;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;KRT2B;KRT2P;KRT76;K6HF;KB18;KRT75;K6HF;KB18;KRT75;K6L;KB38;KRT6L;KRT79;K6L;KB38;KRT6L;KRT79;Kb38;Krt79;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;CYK8;KRT8;CYK8;KRT8;KRT5;KRT5;KRT7;SCL;KRT7;KRT7;SCL Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-1B;Keratin, type II cytoskeletal 1b;Keratin-77;Type-II keratin Kb39;Embryonic type II keratin-1;Cytokeratin-6G;Cytokeratin-71;Keratin, type II cytoskeletal 71;Keratin-6G;Keratin-71;Type II inner root sheath-specific keratin-K6irs1;Type-II keratin Kb34;Cytokeratin-2P;Keratin, type II cytoskeletal 2 oral;Keratin-76;Type-II keratin Kb9;65 kDa cytokeratin;Cytokeratin-3;Keratin, type II cytoskeletal 3;Keratin-3;Type-II keratin Kb3;Keratin, type II cuticular Hb4;Keratin-84;Type II hair keratin Hb4;Type-II keratin Kb24;Cytokeratin-74;Keratin, type II cytoskeletal 74;Keratin-5c;Keratin-74;Type II inner root sheath-specific keratin-K6irs4;Type-II keratin Kb37;Cytokeratin-4;Cytoskeletal 57 kDa keratin;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4;Cytokeratin-72;Keratin, type II cytoskeletal 72;Keratin-72;Type II inner root sheath-specific keratin-K6irs2;Type-II keratin Kb35;Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Type-II keratin Kb7;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-75;Keratin, type II cytoskeletal 75;Keratin-6 hair follicle;Keratin-75;Type II keratin-K6hf;Type-II keratin Kb18;Cytokeratin-79;Keratin, type II cytoskeletal 79;Keratin-6-like;Keratin-79;Type-II keratin Kb38;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;Cytokeratin-8;Keratin, type II cytoskeletal 8;Keratin-8;Type-II keratin Kb8;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5;Sarcolectin;KRT7 protein;Putative uncharacterized protein no no 2 8.446E-12 128.36 1 0 22 NaN NaN 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1550700 0 0 77683 62401 73454 81850 58266 64254 0 0 46419 37149 0 0 52962 44486 112250 115030 0 0 56689 67687 0 0 0 42435 0 0 50527 46430 330130 0 0 68448 62149 + 117 117 117 1244;1245;1246;1247;1248;1249;1250;1251;1252;1253 639;640;641;642;643 641 FDSLTDLVEHYK 0 0 0 2 0 0 1 0 1 0 2 1 0 1 0 1 1 0 1 1 0 12 0 1465.7089 Q06124 Q06124 PTP2C;PTPN11;SHPTP2 Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11 yes yes 3 0.0024346 112.36 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1306700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 108380 75201 243550 164800 240040 207230 0 0 0 0 0 0 0 0 0 0 74918 0 21809 78302 92480 118 52;64 118 1254;1255;1256;1257 644;645;646 645 FEELCSDLFR 0 1 0 1 1 0 2 0 0 0 2 0 0 2 0 1 0 0 0 0 0 10 0 1314.5914 P0DMV8;P0DMV9;P17066;P48741 P0DMV8 HSP70B;HSPA6;HSP70B;HSPA7 Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7 no no 2 0.00063394 118.18 1 0 4 NaN NaN 1 1 1 1 300870 78881 92083 65628 64280 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 119 55 119 1258;1259;1260;1261;1262;1263;1264;1265;1266;1267;1268;1269;1270;1271;1272;1273;1274;1275;1276;1277;1278;1279;1280;1281;1282;1283;1284 647;648;649;650;651;652;653;654;655;656;657;658 647 FEELNADLFR 1 1 1 1 0 0 2 0 0 0 2 0 0 2 0 0 0 0 0 0 0 10 0 1252.6088 P11142;P54652 P11142 HSC70;HSP73;HSPA10;HSPA8;HSPA2 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 yes no 2 3.2548E-18 215.06 1 0 27 1 0 27 2 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 6902700 952260 1018000 1206300 1214700 87266 132660 103660 331300 61562 61195 42622 54881 60456 53264 129010 110690 0 21300 0 0 495270 398660 0 0 0 0 121780 127220 0 0 36918 0 0 42017 39654 120 54 120 1285;1286;1287;1288;1289;1290 659;660;661;662 659 FEELNMDLFR 0 1 1 1 0 0 2 0 0 0 2 0 1 2 0 0 0 0 0 0 0 10 0 1312.6122 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 5.6807E-05 128.81 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 757750 198970 211730 83398 84515 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 103680 75451 0 0 0 0 0 0 0 0 0 0 0 0 0 121 9 121 1291;1292;1293;1294;1295;1296;1297;1298;1299 663;664;665 665 FFVAPFPEVFGK 1 0 0 0 0 0 1 1 0 0 0 1 0 4 2 0 0 0 0 2 0 12 0 1383.7227 CON__P02662 CON__P02662 yes yes 2 0.0060079 99.568 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1568600 421340 504360 50023 44124 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 30242 39974 0 0 0 0 37873 0 0 0 0 0 0 213320 227380 + 122 84 122 1300;1301;1302;1303;1304;1305;1306;1307;1308;1309;1310;1311;1312;1313;1314;1315;1316;1317;1318;1319 666;667;668;669;670;671;672;673;674;675;676;677;678;679;680 678 FGLLLESYCR 0 1 0 0 1 0 1 1 0 0 3 0 0 1 0 1 0 0 1 0 0 10 0 1256.6223 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 2.3794E-05 133.57 1 0 20 1 0 20 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 12312000 0 48035 0 0 153290 169810 318490 287380 0 0 0 0 0 0 62085 44800 1572500 1570900 2311000 1718300 0 0 0 0 0 0 98008 120120 0 0 39806 550620 497660 1371500 1377500 123 106 123 1320;1321;1322;1323;1324;1325;1326 681;682;683;684;685;686;687 683 FGNDVQHFK 0 0 1 1 0 1 0 1 1 0 0 1 0 2 0 0 0 0 0 1 0 9 0 1090.5196 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 4.0999E-06 145.72 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 797340 0 0 0 0 0 0 0 0 0 0 0 0 93426 95862 151370 180240 0 0 0 0 0 0 0 0 0 0 0 0 76744 65613 134090 0 0 0 0 124 95 124 1327;1328;1329;1330;1331;1332;1333;1334;1335;1336;1337 688;689;690;691;692;693 692 FILIQNR 0 1 1 0 0 1 0 0 0 2 1 0 0 1 0 0 0 0 0 0 0 7 0 902.53379 P53680 P53680 AP17;AP2S1;CLAPS2 Adapter-related protein complex 2 sigma subunit;Adaptor protein complex AP-2 subunit sigma;AP-2 complex subunit sigma;Clathrin assembly protein 2 small chain;Clathrin coat assembly protein AP17;Clathrin coat-associated protein AP17;HA2 17 kDa subunit;Plasma membrane adaptor AP-2 17 kDa protein;Sigma2-adaptin yes yes 2 0.016653 122.15 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 840800 121120 88809 63848 67888 0 0 0 0 0 0 0 0 84370 83082 113040 111140 0 0 0 0 53367 0 0 25387 0 0 0 0 0 0 28736 0 0 0 0 125 111 125 1338 694 694 FLASVSTVLTSK 1 0 0 0 0 0 0 0 0 0 2 1 0 1 0 3 2 0 0 2 0 12 0 1251.7075 P69905 P69905 HBA1;HBA2 Alpha-globin;Hemoglobin alpha chain;Hemoglobin subunit alpha yes yes 2 7.9446E-05 66.595 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 126 40;79;23 126 1339;1340;1341;1342;1343;1344;1345;1346;1347;1348;1349;1350;1351;1352;1353;1354;1355;1356;1357;1358;1359;1360;1361;1362;1363;1364;1365;1366;1367;1368;1369;1370;1371;1372;1373;1374 695;696;697;698;699;700;701;702;703;704;705;706;707;708;709;710;711;712;713;714;715;716;717;718;719;720;721;722;723;724;725;726 715 FLEQQNQVLQTK 0 0 1 0 0 4 1 0 0 0 2 1 0 1 0 0 1 0 0 1 0 12 0 1474.778 CON__Q6NXH9;CON__Q7Z794;Q7Z794;CON__Q6IFZ6;CON__Q9R0H5;P04264;CON__P04264;P35908;CON__P35908 P04264 Kb36;Krt73;KRT1B;KRT77;KRT1B;KRT77;Krt1b;Krt77;K6irs1;Kb34;Krt2-6g;Krt6g;Krt71;KRT1;KRTA;KRT1;KRTA;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-1B;Keratin, type II cytoskeletal 1b;Keratin-77;Type-II keratin Kb39;Embryonic type II keratin-1;Cytokeratin-6G;Cytokeratin-71;Keratin, type II cytoskeletal 71;Keratin-6G;Keratin-71;Type II inner root sheath-specific keratin-K6irs1;Type-II keratin Kb34;67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 no no 2 2.0084E-47 262.54 1 0 36 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 34877000 246500 282210 1049000 992050 1246500 1257100 673610 630640 783650 718640 1691600 1617900 1543300 1541500 1003900 1011600 1617900 1839100 342720 366430 1616300 1537000 194080 198000 1193900 1266100 356580 0 575940 554950 3122500 348060 361080 1518300 1578100 + 127 26 127 1375;1376;1377;1378;1379;1380;1381;1382;1383;1384;1385;1386;1387;1388;1389;1390;1391;1392;1393;1394;1395;1396;1397;1398;1399;1400;1401;1402;1403;1404;1405;1406;1407;1408 727;728;729;730;731;732;733;734;735;736;737;738;739;740;741;742;743;744;745;746;747;748;749;750;751;752;753;754;755;756;757;758;759;760;761;762;763;764 744 FLLQHLGR 0 1 0 0 0 1 0 1 1 0 3 0 0 1 0 0 0 0 0 0 0 8 0 982.57123 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 8.6452E-25 138.9 1 0 34 1 0 34 1 1 1 1 1 1 1 1 3 4 4 6 1 1 1 1 1 3 1 1 1 1 1 1 1 1 1 3 4 4 6 1 1 1 1 1 3 1 80915000 0 0 0 0 426570 379180 535590 485630 0 0 0 0 48236 58485 83332 82554 10898000 11442000 14982000 14931000 0 0 0 0 0 0 118840 115900 0 0 0 4515300 4601500 8525000 8685500 128 82 128 1409;1410;1411;1412;1413;1414 765;766;767 767 FLQESNVLYQHNLR 0 1 2 0 0 2 1 0 1 0 3 0 0 1 0 1 0 0 1 1 0 14 0 1759.9006 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 3 0.011814 93.959 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 1742600 442890 517690 327400 338970 0 0 0 0 0 0 0 0 0 0 64545 51098 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 129 122 129 1415;1416;1417;1418;1419;1420;1421;1422;1423 768;769;770;771;772;773 773 FLVFDHAPFSSIR 1 1 0 1 0 0 0 0 1 1 1 0 0 3 1 2 0 0 0 1 0 13 0 1534.7932 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2,3 0.0059588 110.66 1 0 9 1 0 9 1 2 2 2 2 1 2 2 2 2 3428700 0 0 0 0 0 0 0 0 0 0 0 0 171530 237780 1362100 1371800 0 0 0 0 0 0 0 0 0 0 0 0 0 0 285450 0 0 0 0 130 106 130 1424;1425;1426;1427;1428;1429;1430;1431;1432;1433;1434;1435;1436;1437;1438;1439;1440;1441;1442;1443;1444;1445;1446;1447;1448;1449;1450;1451;1452;1453;1454;1455;1456;1457;1458;1459;1460;1461;1462;1463;1464;1465;1466;1467;1468;1469;1470;1471;1472;1473;1474 774;775;776;777;778;779;780;781;782;783;784;785;786;787;788;789;790;791;792;793;794;795;796;797;798;799;800;801;802;803;804;805;806 801 FNSLNELVDYHR 0 1 2 1 0 0 1 0 1 0 2 0 0 1 0 1 0 0 1 1 0 12 0 1505.7263 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2,3 1.5601E-18 214.82 1 0 51 1 0 51 3 2 2 2 1 1 3 5 4 6 2 1 1 2 1 2 2 3 3 1 2 1 1 3 2 2 2 1 1 3 5 4 6 2 1 1 2 1 2 2 3 3 1 2 1 1 87873000 1183700 1176400 1036900 1083100 0 0 47284 61809 0 0 0 0 10981000 12273000 18748000 19726000 413690 334290 409630 375150 401970 419530 0 0 0 0 0 0 4491000 4814200 8817300 174060 216600 375060 314570 131 2 131 1475;1476;1477;1478;1479;1480;1481;1482;1483;1484;1485 807 807 FPAHLSTHWVADAAASVR 5 1 0 1 0 0 0 0 2 0 1 0 0 1 1 2 1 1 0 2 0 18 0 1934.9751 A6NK06 A6NK06 IRG1 Immune-responsive gene 1 protein homolog yes yes 2 0.074191 62.378 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1623300 0 0 196830 216370 0 0 161320 0 154000 144760 0 0 0 0 0 281250 0 46133 123160 91215 0 0 0 0 0 0 105160 103080 0 0 0 0 0 0 0 132 153 132 1486;1487;1488;1489;1490;1491;1492;1493;1494 808;809 809 FPSNIIVTNGAAR 2 1 2 0 0 0 0 1 0 2 0 0 0 1 1 1 1 0 0 1 0 13 0 1358.7306 Q86WR7 Q86WR7 C10orf47 Uncharacterized protein C10orf47 yes yes 2 0.064837 74.392 1 0 9 1 0 9 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1426800 0 0 308710 289740 0 63361 110270 101100 0 0 0 0 108370 208030 0 0 0 0 237220 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 133 10 133 1495 810 810 FQNALLVR 1 1 1 0 0 1 0 0 0 0 2 0 0 1 0 0 0 0 0 1 0 8 0 959.55525 CON__P02768-1;P02768 CON__P02768-1 ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341;ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341 Serum albumin yes no 2 2.4769E-06 96.492 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 134 38 134 1496;1497;1498;1499;1500;1501;1502;1503;1504;1505;1506;1507;1508 811;812;813;814;815;816;817;818;819;820;821 820 FRELIIEFSK 0 1 0 0 0 0 2 0 0 2 1 1 0 2 0 1 0 0 0 0 0 10 1 1280.7129 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 8.7335E-06 151.15 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 9789700 2156100 2039100 1319900 1170200 0 0 0 0 0 0 0 0 280780 316140 519510 499920 0 0 0 0 650530 664210 0 0 0 0 0 0 37731 48143 87417 0 0 0 0 135 83 135 1509 822 822 FSLENNFLLQHNIR 0 1 3 0 0 1 1 0 1 1 3 0 0 2 0 1 0 0 0 0 0 14 0 1743.9057 P42224 P42224 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84 yes yes 3 0.01034 54.7 1 0 1 1 0 1 1 1 59382 0 59382 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 136 112 136 1510 823 823 FSMKMKMIDSAR 1 1 0 1 0 0 0 0 0 1 0 2 3 1 0 2 0 0 0 0 0 12 2 1443.7036 P78527 P78527 HYRC;HYRC1;PRKDC DNA-dependent protein kinase catalytic subunit;DNPK1;p460 yes yes 2 0.1246 14.258 1 0 1 1 0 1 1 1 27276 0 0 0 0 0 0 0 0 27276 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 137 38 137 1511;1512;1513;1514;1515;1516;1517;1518;1519;1520;1521;1522;1523;1524;1525;1526;1527;1528;1529;1530;1531;1532;1533;1534;1535;1536;1537;1538;1539;1540;1541;1542;1543;1544;1545;1546;1547;1548;1549;1550;1551;1552;1553;1554;1555;1556;1557;1558;1559 824;825;826;827;828;829;830;831;832;833;834;835;836;837;838;839;840;841;842;843;844;845;846;847;848;849;850;851 831 FSNNPALCNVESIQWR 1 1 3 0 1 1 1 0 0 1 1 0 0 1 1 2 0 1 0 1 0 16 0 1933.9105 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 1.5647E-20 210.34 1 0 49 1 0 49 5 2 4 3 2 2 3 2 2 3 2 2 2 2 2 4 2 2 3 5 2 4 3 2 2 3 2 2 3 2 2 2 2 2 4 2 2 3 250220000 60221000 62961000 16469000 17156000 0 0 154050 219250 0 0 0 0 1089500 1118200 18590000 18174000 392230 371430 1152700 1004900 25334000 21318000 0 0 0 0 132710 135770 0 0 4231000 0 0 0 0 138 40 138 1560;1561;1562;1563;1564;1565;1566;1567;1568;1569;1570 852;853 853 FSSCGGGGGSFGAGGGFGSR 1 1 0 0 1 0 0 10 0 0 0 0 0 3 0 4 0 0 0 0 0 20 0 1764.7274 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 1.2085E-09 147.64 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 697460 0 0 0 50232 0 0 0 0 50041 45703 0 0 0 0 55357 44562 51254 60456 0 0 92597 86252 0 0 0 0 0 0 0 0 133490 0 0 27512 0 + 139 19 139 1571;1572;1573;1574;1575;1576;1577;1578;1579 854;855;856 856 FSSSSGYGGGSSR 0 1 0 0 0 0 0 4 0 0 0 0 0 1 0 6 0 0 1 0 0 13 0 1234.5214 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 2 1.7295E-13 129.34 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 369890 0 0 0 0 0 0 0 0 0 0 0 0 0 50230 0 0 33246 33640 0 0 0 40580 0 0 32439 0 0 0 0 0 96014 0 0 48767 34971 + 140 128 140 1580;1581;1582;1583;1584;1585;1586;1587;1588 857;858;859 859 FTDLLQLVEFHQLNR 0 1 1 1 0 2 1 0 1 0 4 0 0 2 0 0 1 0 0 1 0 15 0 1871.9894 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 3 0.0068219 129.37 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1140200 38004 48171 0 0 0 0 106780 58040 0 0 0 0 0 0 35774 28739 0 24593 410900 389210 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 141 112 141 1589;1590 860;861 860 FVPLLPGNR 0 1 1 0 0 0 0 1 0 0 2 0 0 1 2 0 0 0 0 1 0 9 0 1011.5866 P78527 P78527 HYRC;HYRC1;PRKDC DNA-dependent protein kinase catalytic subunit;DNPK1;p460 yes yes 2 0.036766 61.999 1 0 2 1 0 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 142 41 142 1591;1592;1593;1594;1595;1596;1597;1598;1599;1600 862;863;864 862 FVVIQNEDLGPASPLDSTFYR 1 1 1 2 0 1 1 1 0 1 2 0 0 2 2 2 1 0 1 2 0 21 0 2367.1747 P04626 P04626 ERBB2;HER2;MLN19;NEU;NGL Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2 yes yes 2,3 0.00026197 92.633 1 0 10 1 0 10 1 1 2 2 1 1 2 1 1 2 2 1 1 2 1369900 169920 206550 0 0 0 0 0 0 0 0 0 0 0 0 389840 402370 0 0 44081 0 70926 0 0 0 0 0 0 0 0 0 86225 0 0 0 0 143 24 143 1601;1602;1603;1604;1605;1606;1607;1608 865;866;867;868 868 FYGPEGPYGVFAGR 1 1 0 0 0 0 1 4 0 0 0 0 0 2 2 0 0 0 2 1 0 14 0 1515.7147 O00264 O00264 HPR6.6;PGRMC;PGRMC1 Membrane-associated progesterone receptor component 1 yes yes 2 1.2342E-07 177.1 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1031000 187620 179530 163650 218180 0 0 0 0 0 0 0 0 0 0 40479 47453 0 0 0 0 101040 92996 0 0 0 0 0 0 0 0 0 0 0 0 0 144 84 144 1609;1610;1611;1612;1613 869 869 GALQFNSHTLHQWLK 1 0 1 0 0 2 0 1 2 0 3 1 0 1 0 1 1 1 0 0 0 15 0 1778.9216 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 3 0.17311 62.088 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1660500 0 0 0 0 0 0 0 39951 0 0 0 0 0 0 0 0 402320 399700 455580 362930 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 145 43;58 145 1614;1615;1616;1617;1618;1619;1620;1621;1622;1623;1624 870;871;872;873;874;875;876 876 GAWSNVLR 1 1 1 0 0 0 0 1 0 0 1 0 0 0 0 1 0 1 0 1 0 8 0 901.477 P05141;P12235;P12236 P05141 ANT2;SLC25A5;ANT1;SLC25A4;ANT3;CDABP0051;SLC25A6 Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6 no no 2 1.9653E-06 111.04 1 0 11 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1303200 240390 234390 252900 268090 0 0 0 44037 0 0 0 0 41080 63712 50422 0 0 0 0 0 0 87446 0 0 0 0 0 0 0 0 20722 0 0 0 0 146 26 146 1625;1626;1627;1628;1629;1630;1631;1632;1633;1634;1635;1636;1637 877;878;879;880;881;882;883;884;885;886;887;888;889;890;891 888 GDFPGTYVEFLGPVALAR 2 1 0 1 0 0 1 3 0 0 2 0 0 2 2 0 1 0 1 2 0 18 0 1907.9781 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 1.2752E-46 250.31 1 0 13 1 0 13 1 3 2 4 3 1 3 2 4 3 12898000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 31819 0 470810 392050 6288800 5714300 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 147 38 147 1638;1639;1640;1641;1642;1643;1644;1645;1646;1647;1648;1649;1650;1651;1652;1653;1654;1655;1656;1657;1658;1659;1660;1661;1662;1663;1664;1665;1666;1667;1668;1669;1670;1671;1672;1673;1674;1675;1676;1677;1678;1679 892;893;894;895;896;897;898;899;900;901;902;903;904;905;906;907;908;909;910;911;912;913;914;915;916 896 GDSFTHTPPLDPQELDILK 0 0 0 3 0 1 1 1 1 1 3 1 0 1 3 1 2 0 0 0 0 19 0 2122.0582 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 2.0661E-07 161.24 1 0 42 1 0 42 5 4 5 4 1 1 2 1 3 2 1 1 1 1 3 3 1 1 2 5 4 5 4 1 1 2 1 3 2 1 1 1 1 3 3 1 1 2 105010000 18724000 19342000 17151000 17400000 0 0 134560 175730 0 0 0 0 855290 892610 5332900 5081600 412020 405920 606620 466900 8972700 7652200 0 0 0 0 110560 100950 0 0 1195300 0 0 0 0 148 84 148 1680;1681 917;918 917 GEIYDAAIDLFTR 2 1 0 2 0 0 1 1 0 2 1 0 0 1 0 0 1 0 1 0 0 13 0 1482.7355 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.0019116 140.31 1 0 2 1 0 2 1 1 1 1 288180 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 176590 111580 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 149 88 149 1682;1683;1684 919;920 920 GFITIVDVQR 0 1 0 1 0 1 0 1 0 2 0 0 0 1 0 0 1 0 0 2 0 10 0 1146.6397 P43304 P43304 GPD2 Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD yes yes 2 0.0066822 98.249 1 0 3 1 0 3 1 1 1 1 1 1 205360 0 61146 56896 87315 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 150 66 150 1685;1686;1687;1688;1689;1690 921;922;923 921 GFSLLIMK 0 0 0 0 0 0 0 1 0 1 2 1 1 1 0 1 0 0 0 0 0 8 0 907.52011 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 0.054138 91.065 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 472000 0 0 0 0 92547 95474 70826 106570 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 45617 60968 0 0 0 0 0 0 0 151 79 151 1691;1692;1693;1694;1695;1696;1697;1698;1699;1700;1701;1702;1703;1704;1705;1706 924;925;926;927;928;929;930;931;932;933;934 928 GFSSGSAVVSGGSR 1 1 0 0 0 0 0 4 0 0 0 0 0 1 0 5 0 0 0 2 0 14 0 1253.6 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 no no 2 0.00012804 159.64 1 0 16 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 850910 0 0 61519 49935 63993 50658 0 0 26499 0 0 0 0 46813 23413 0 59523 62707 0 0 58595 55578 0 0 58337 48801 0 0 0 0 118450 0 0 30320 35769 + 152 79 152 1707;1708;1709;1710;1711;1712 935 935 GGGFGGGSSFGGGSGFSGGGFGGGGFGGGR 0 1 0 0 0 0 0 20 0 0 0 0 0 5 0 4 0 0 0 0 0 30 0 2398.0111 P35908 P35908 KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes yes 2 0.0034089 73.341 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 518280 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 30008 0 0 48797 42266 48170 65156 0 0 0 0 0 0 0 0 283880 0 0 0 0 + 153 19 153 1713;1714;1715;1716;1717;1718 936;937 937 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 1 1 0 0 0 0 0 17 0 0 1 0 0 3 0 7 0 0 2 0 0 32 0 2704.1538 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 1.7444E-18 123.44 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 2161600 0 0 0 0 0 0 0 0 0 63822 0 0 0 0 127040 0 0 0 125060 84423 0 268010 0 0 0 0 0 0 0 0 1493300 0 0 0 0 + 154 156 154 1719 938 938 10;11;12 GGMPGKLIKINIMNMNK 0 0 3 0 0 0 0 3 0 3 1 3 3 0 1 0 0 0 0 0 0 17 2 1857.9991 Q8NDL9 Q8NDL9 AGBL5;CCP5 ATP/GTP-binding protein-like 5;Cytosolic carboxypeptidase-like protein 5 yes yes 3 0.036336 10.593 1 0 1 1 0 1 1 1 47744 47744 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 155 46;125 155 1720;1721;1722;1723;1724;1725;1726;1727;1728 939;940 939 GHYTEGAELVDSVLDVVR 1 1 0 2 0 0 2 2 1 0 2 0 0 0 0 1 1 0 1 4 0 18 0 1957.9745 P07437;P68371;Q13885;Q9BVA1;Q13509 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB2;TUBB2A;TUBB2B;TUBB3;TUBB4 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-4 chain;Tubulin beta-III no no 3 0.00010647 140.1 1 0 9 NaN NaN 1 1 1 1 1 1 1 1 1 3866200 1451800 1296200 0 0 0 0 0 0 0 0 0 0 0 0 230300 224740 0 0 89458 79819 255050 214570 0 0 0 0 0 0 0 0 24225 0 0 0 0 156 67 156 1729;1730 941 941 GIFPSGLFQGDTFR 0 1 0 1 0 1 0 3 0 1 1 0 0 3 1 1 1 0 0 0 0 14 0 1540.7674 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 2 0.036468 83.204 1 0 2 1 0 2 1 1 1 1 135420 0 0 0 0 0 0 0 0 0 0 0 0 0 0 44567 0 0 0 90855 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 157 128 157 1731;1732;1733;1734;1735;1736;1737;1738;1739;1740;1741;1742;1743 942;943;944;945;946;947;948;949 944 GILPCLLR 0 1 0 0 1 0 0 1 0 1 3 0 0 0 1 0 0 0 0 0 0 8 0 940.55281 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 2 0.032817 97.068 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1742500 0 0 0 0 190480 168960 285900 293120 0 0 0 0 0 0 0 0 78446 75128 105560 84739 0 0 0 0 0 0 0 51260 0 0 0 65150 68440 153390 121880 158 114 158 1744;1745;1746;1747;1748;1749;1750;1751 950;951;952 952 GIYTGLSAGLLR 1 1 0 0 0 0 0 3 0 1 3 0 0 0 0 1 1 0 1 0 0 12 0 1219.6925 Q02978 Q02978 SLC20A4;SLC25A11 Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11 yes yes 2 0.017102 89.266 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 473660 65165 58458 74201 95838 0 0 0 0 0 0 0 0 0 0 30503 24890 0 0 0 0 52493 72115 0 0 0 0 0 0 0 0 0 0 0 0 0 159 35 159 1752;1753;1754;1755;1756;1757;1758;1759;1760;1761;1762;1763 953;954;955;956;957;958;959;960;961;962 959 GLAVFISDIR 1 1 0 1 0 0 0 1 0 2 1 0 0 1 0 1 0 0 0 1 0 10 0 1089.6182 O95782;O94973 O95782 ADTAA;AP2A1;CLAPA1;ADTAB;AP2A2;CLAPA2;HIP9;HYPJ;KIAA0899 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit;100 kDa coated vesicle protein C;Adapter-related protein complex 2 alpha-2 subunit;Adaptor protein complex AP-2 subunit alpha-2;Alpha2-adaptin;Alpha-adaptin C;AP-2 complex subunit alpha-2;Clathrin assembly protein complex 2 alpha-C large chain;Huntingtin yeast partner J;Huntingtin-interacting protein 9;Huntingtin-interacting protein J;Plasma membrane adaptor HA2/AP2 adaptin alpha C subunit yes no 2 1.627E-05 141.88 1 0 12 1 0 12 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1391300 128330 150610 121400 128430 0 0 0 0 0 0 0 0 91314 99245 215560 194540 0 0 0 0 134330 57043 0 0 0 0 0 0 0 0 70526 0 0 0 0 160 118 160 1764;1765;1766;1767;1768 963 963 GLFIIDDK 0 0 0 2 0 0 0 1 0 2 1 1 0 1 0 0 0 0 0 0 0 8 0 919.50148 Q06830;Q13162 Q06830 PAGA;PAGB;PRDX1;TDPX2;PRDX4 Natural killer cell-enhancing factor A;Peroxiredoxin-1;Proliferation-associated gene protein;Thioredoxin peroxidase 2;Thioredoxin-dependent peroxide reductase 2;Antioxidant enzyme AOE372;Peroxiredoxin IV;Peroxiredoxin-4;Thioredoxin peroxidase AO372;Thioredoxin-dependent peroxide reductase A0372 yes no 2 0.036407 94.262 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 182100 43879 0 30053 51807 0 0 0 0 0 0 0 0 0 21696 0 34664 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 161 89 161 1769;1770;1771;1772 964;965;966 965 GLFPFTHVK 0 0 0 0 0 0 0 1 1 0 1 1 0 2 1 0 1 0 0 1 0 9 0 1044.5757 P46109 P46109 CRKL Crk-like protein yes yes 2 0.041461 84.568 1 0 4 1 0 4 1 1 1 1 1 1 1 1 160320 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 64893 49298 46130 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 162 45 162 1773;1774;1775;1776;1777;1778;1779;1780;1781;1782;1783;1784;1785;1786;1787;1788;1789;1790 967;968;969;970;971;972;973;974;975;976 971 GLGTDEDSLIEIICSR 0 1 0 2 1 0 2 2 0 3 2 0 0 0 0 2 1 0 0 0 0 16 0 1776.8564 P07355;A6NMY6 P07355 ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein yes no 2,3 5.8684E-21 214.23 1 0 18 1 0 18 2 2 1 2 2 2 1 2 2 2 2 2 1 2 2 2 1 2 2 2 2931300 649780 600810 0 29499 0 0 0 0 0 0 0 0 0 0 466380 455220 0 0 67117 34722 265670 249280 0 0 0 0 0 0 0 0 112840 0 0 0 0 163 180 163 1791;1792;1793;1794;1795 977;978 977 GLGWVQFSSEEGLR 0 1 0 0 0 1 2 3 0 0 2 0 0 1 0 2 0 1 0 1 0 14 0 1563.7682 Q9GZT3 Q9GZT3 C14orf156;DC23;DC50;PD04872;SLIRP SRA stem-loop-interacting RNA-binding protein, mitochondrial yes yes 2 0.010273 102.87 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 710500 264500 242020 0 0 0 0 0 0 0 0 0 0 0 0 28286 0 0 0 0 0 95929 79765 0 0 0 0 0 0 0 0 0 0 0 0 0 164 82 164 1796;1797;1798;1799 979;980 980 GLSIEQLTTLAEK 1 0 0 0 0 1 2 1 0 1 3 1 0 0 0 1 2 0 0 0 0 13 0 1401.7715 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 2 4.9662E-05 162.32 1 0 4 1 0 4 1 1 1 1 1 1 1 1 939800 255520 253790 197750 232740 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 165 38 165 1800;1801;1802;1803;1804;1805;1806;1807;1808;1809;1810;1811;1812;1813;1814;1815;1816;1817;1818 981;982;983;984;985;986;987;988;989 984 GLWIPEGEK 0 0 0 0 0 0 2 2 0 1 1 1 0 0 1 0 0 1 0 0 0 9 0 1027.5338 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.03704 86.011 1 0 19 1 0 19 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 11407000 1846100 1864300 1754400 1905800 0 0 0 0 0 0 0 0 374510 455090 421720 370100 0 0 44051 55446 840280 839200 85209 85968 0 0 0 0 188300 100050 176370 0 0 0 0 166 38 166 1819;1820 990;991 990 GMNYLEDR 0 1 1 1 0 0 1 1 0 0 1 0 1 0 0 0 0 0 1 0 0 8 0 996.43348 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.028777 101.28 1 0 2 1 0 2 1 1 1 1 91584 52663 38921 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 167 21 167 1821 992 992 GNVLECLQDGER 0 1 1 1 1 1 2 2 0 0 2 0 0 0 0 0 0 0 0 1 0 12 0 1388.6354 CON__Q3SZ57 CON__Q3SZ57 yes yes 2 0.072497 44.616 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 168 55 168 1822;1823;1824;1825;1826;1827;1828;1829;1830 993;994 993 GPAVGIDLGTTYSCVGVFQHGK 1 0 0 1 1 1 0 5 1 1 1 1 0 1 1 1 2 0 1 3 0 22 0 2262.1103 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 3 0.00010782 93.768 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1211200 324770 310160 0 0 0 0 0 0 33514 0 0 0 0 0 50641 38132 0 0 0 33043 149660 248010 0 0 0 0 0 0 0 0 23297 0 0 0 0 169 38 169 1831;1832 995 995 GPDNCIQCAHYIDGPHCVK 1 0 1 2 3 1 0 2 2 2 0 1 0 0 2 0 0 0 1 1 0 19 0 2239.9561 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.00022801 105.14 1 0 2 1 0 2 1 1 1 1 281680 136990 144690 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 170 100 170 1833;1834;1835 996 996 GPLQSVQVFGR 0 1 0 0 0 2 0 2 0 0 1 0 0 1 1 1 0 0 0 2 0 11 0 1186.6459 P62249 P62249 RPS16 40S ribosomal protein S16 yes yes 2 0.085818 69.721 1 0 3 1 0 3 1 1 1 1 1 1 122130 34698 41596 0 45838 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 171 38 171 1836;1837;1838;1839;1840;1841;1842;1843;1844;1845;1846 997;998;999;1000;1001;1002;1003;1004 1000 GSHQISLDNPDYQQDFFPK 0 0 1 3 0 3 0 1 1 1 1 1 0 2 2 2 0 0 1 0 0 19 0 2235.0233 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.0001276 126.77 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 8528100 1602900 1423400 1467200 1597100 0 0 0 0 0 0 0 0 103730 122660 252030 324940 0 0 0 0 833540 681250 0 0 0 0 0 0 0 0 119390 0 0 0 0 172 16 172 1847;1848;1849;1850;1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861;1862;1863;1864;1865;1866;1867;1868;1869;1870 1005;1006;1007;1008;1009;1010;1011;1012;1013;1014;1015;1016;1017;1018;1019;1020;1021;1022;1023;1024;1025;1026 1011 GSLGGGFSSGGFSGGSFSR 0 1 0 0 0 0 0 8 0 0 1 0 0 3 0 6 0 0 0 0 0 19 0 1706.7649 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 3.1971E-24 199.15 1 0 24 1 0 24 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 11018000 154110 153890 827520 800000 48778 0 343960 306150 459660 421180 0 0 142900 177240 468490 522470 820980 851490 231160 243840 816760 745250 0 0 0 0 193510 168310 0 0 1775200 0 0 174570 171110 + 173 16 173 1871;1872;1873;1874;1875;1876;1877;1878;1879 1027;1028 1028 GSSGGGCFGGSSGGYGGLGGFGGGSFR 0 1 0 0 1 0 0 15 0 0 1 0 0 3 0 5 0 0 1 0 0 27 0 2341.9771 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 7.6568E-14 113.24 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1756200 0 0 0 0 0 0 0 0 0 158580 0 0 0 0 237950 239580 46588 60835 100360 80625 159610 0 0 0 0 0 0 0 0 0 672060 0 0 0 0 + 174 38 174 1880;1881;1882;1883;1884;1885;1886;1887;1888;1889;1890;1891 1029;1030;1031;1032;1033;1034;1035;1036;1037;1038;1039 1030 GSTAENAEYLR 2 1 1 0 0 0 2 1 0 0 1 0 0 0 0 1 1 0 1 0 0 11 0 1209.5626 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 3.3473E-07 169.65 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5611800 976540 1072200 728650 814840 0 0 0 0 0 0 0 0 79199 85851 157550 108920 0 0 0 0 386710 373510 438300 389540 0 0 0 0 0 0 0 0 0 0 0 175 60 175 1892;1893;1894;1895;1896;1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914;1915;1916;1917;1918 1040 1040 GTPMGMPPPGMRPPPPGMR 0 2 0 0 0 0 0 4 0 0 0 0 4 0 8 0 1 0 0 0 0 19 1 1959.9304 P14678 P14678 COD;SNRPB;SNRPB1 Sm protein B/B;Small nuclear ribonucleoprotein-associated proteins B and B yes yes 2 0.049745 4.4385 1 0 27 1 0 27 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4779200 113130 97169 453180 511610 0 0 119310 125370 138560 152630 0 0 142720 184770 378670 351400 69283 96751 197810 189360 98118 120310 0 0 0 0 159810 154950 35534 36383 109940 332490 305070 55890 49002 176 161 176 1919 1041 1041 GVASLCQLDN 1 0 1 1 1 1 0 1 0 0 2 0 0 0 0 1 0 0 0 1 0 10 0 1075.4968 Q8TD57 Q8TD57 DNAH3;DNAHC3B Axonemal beta dynein heavy chain 3;Ciliary dynein heavy chain 3;Dnahc3-b;Dynein heavy chain 3, axonemal yes yes 2 0.044506 55.567 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 177 45 177 1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930;1931;1932;1933;1934;1935;1936;1937;1938;1939 1042;1043;1044;1045;1046;1047;1048;1049;1050;1051;1052;1053;1054 1047 GVDEVTIVNILTNR 0 1 2 1 0 0 1 1 0 2 1 0 0 0 0 0 2 0 0 3 0 14 0 1541.8413 P07355 P07355 ANX2;ANX2L4;ANXA2;CAL1H;LPC2D Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I yes yes 2,3 8.3559E-08 178.58 1 0 20 1 0 20 2 2 1 1 2 2 1 1 1 1 2 2 2 2 2 1 1 2 2 1 1 1 1 2 2 2 3568400 626290 675560 102790 81176 0 0 0 0 0 0 0 0 0 0 589010 589620 58291 38826 70800 54029 272100 250900 0 0 0 0 0 0 0 0 158970 0 0 0 0 178 87 178 1940;1941;1942;1943;1944 1055 1055 GVSTFMAEMLETASILR 2 1 0 0 0 0 2 1 0 1 2 0 2 1 0 2 2 0 0 1 0 17 0 1854.922 P43246 P43246 MSH2 DNA mismatch repair protein Msh2;MutS protein homolog 2 yes yes 2 0.17899 22.475 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 174860 0 0 0 0 0 0 0 0 0 0 0 0 37352 51915 0 0 21050 0 0 0 0 32786 0 0 0 0 0 0 31761 0 0 0 0 0 0 179 47;48 179 1945;1946;1947;1948;1949;1950;1951;1952;1953 1056;1057;1058 1056 GVVDSEDLPLNISR 0 1 1 2 0 0 1 1 0 1 2 0 0 0 1 2 0 0 0 2 0 14 0 1512.7784 P07900;Q58FF7;P08238 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AB3P;HSP90BC;HSP90AB1;HSP90B;HSPC2;HSPCB Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-beta c;Putative heat shock protein HSP 90-beta-3;Heat shock 84 kDa;Heat shock protein HSP 90-beta no no 2 0.006134 132.79 1 0 9 NaN NaN 1 1 1 1 1 1 1 1 1 1557800 193030 196010 231000 245640 0 0 142060 140850 0 0 0 0 0 0 0 0 0 0 0 0 139470 125290 0 0 0 0 0 144490 0 0 0 0 0 0 0 180 66 180 1954;1955;1956;1957;1958;1959;1960;1961;1962;1963;1964;1965;1966;1967;1968;1969;1970;1971;1972 1059 1059 GVWIPEGESIK 0 0 0 0 0 0 2 2 0 2 0 1 0 0 1 1 0 1 0 1 0 11 0 1213.6343 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 0.14846 60.518 1 0 19 1 0 19 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2586300 277190 340040 181610 169190 213850 210250 192340 219050 0 0 0 0 57948 40637 53534 0 45770 47832 91722 60447 102730 0 0 0 0 0 127260 116870 0 0 0 0 0 0 38033 181 122 181 1973;1974;1975;1976 1060;1061;1062 1060 GWFPVQQVEFISNPEVR 0 1 1 0 0 2 2 1 0 1 0 0 0 2 2 1 0 1 0 3 0 17 0 2031.0214 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2,3 9.417E-05 143.25 1 0 4 1 0 4 2 1 1 2 1 1 2712500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1906900 653630 0 0 0 0 0 0 0 0 0 0 0 0 0 0 151970 0 0 0 0 182 106 182 1977;1978;1979;1980;1981;1982;1983;1984;1985;1986;1987;1988;1989;1990;1991;1992;1993 1063;1064;1065;1066;1067;1068;1069;1070;1071 1071 HDGAFLIR 1 1 0 1 0 0 0 1 1 1 1 0 0 1 0 0 0 0 0 0 0 8 0 927.49265 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 0.00011699 144.38 1 0 17 1 0 17 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 9491200 187490 136580 200170 195450 0 0 0 0 0 0 0 0 1550700 1650500 0 2270400 49470 110690 56425 68218 0 56957 31536 0 0 0 0 0 968860 975030 954360 0 28401 0 0 183 187 183 1994 1072 1072 HELAEIVFK 1 0 0 0 0 0 2 0 1 1 1 1 0 1 0 0 0 0 0 1 0 9 0 1084.5917 Q9Y2R5 Q9Y2R5 HSPC011;MRPS17;RPMS17 28S ribosomal protein S17, mitochondrial yes yes 2 0.0022012 87.639 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 184 26 184 1995;1996;1997;1998 1073;1074;1075 1074 HESLAQYNAK 2 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 0 0 10 0 1159.5622 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.0029383 107.21 1 0 4 1 0 4 1 1 1 1 1 1 1 1 241090 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 50526 73020 54665 62874 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 185 19 185 1999;2000;2001;2002;2003;2004;2005;2006;2007;2008;2009;2010;2011;2012;2013;2014;2015;2016;2017;2018;2019;2020;2021;2022;2023;2024 1076;1077;1078;1079;1080;1081;1082;1083;1084;1085;1086;1087;1088;1089;1090;1091;1092 1088 HGVQELEIELQSQLSK 0 0 0 0 0 3 3 1 1 1 3 1 0 0 0 2 0 0 0 1 0 16 0 1836.9581 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 2,3 6.4078E-05 157.86 1 0 26 1 0 26 1 1 1 1 1 1 1 1 1 2 2 2 1 2 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 2 1 2 2 1 1 2 1 1 5936400 119450 119070 25507 0 0 0 93601 90734 279240 231430 0 0 0 0 151620 159580 541290 519970 417510 271970 867910 785830 0 0 0 0 54611 43515 0 0 978680 0 0 92136 92782 + 186 19 186 2025;2026;2027;2028;2029;2030;2031 1093;1094 1093 HGVQELEIELQSQLSKK 0 0 0 0 0 3 3 1 1 1 3 2 0 0 0 2 0 0 0 1 0 17 1 1965.0531 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 0.0062092 89.624 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 672960 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 162640 205250 93571 44479 67120 47347 0 0 0 0 0 0 0 0 52553 0 0 0 0 + 187 47 187 2032;2033;2034;2035;2036 1095;1096;1097 1096 HIYYITGETK 0 0 0 0 0 0 1 1 1 2 0 1 0 0 0 0 2 0 2 0 0 10 0 1223.6186 P07900;Q58FG0 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA5P;HSP90AE Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-alpha E;Putative heat shock protein HSP 90-alpha A5 yes no 2 0.0018895 109.71 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 255760 65793 53655 46993 60919 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 28402 0 0 0 0 0 0 0 0 0 0 0 0 0 0 188 35 188 2037 1098 1098 HLCELLAQQF 1 0 0 0 1 2 1 0 1 0 3 0 0 1 0 0 0 0 0 0 0 10 0 1257.6176 O95782 O95782 ADTAA;AP2A1;CLAPA1 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit yes yes 2 0.080884 57.598 1 0 1 1 0 1 1 1 94973 0 0 0 0 0 0 0 0 0 0 0 0 0 0 94973 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 189 48 189 2038;2039;2040;2041;2042;2043;2044;2045;2046;2047 1099;1100;1101;1102;1103 1101 HLEINPDHPIVETLR 0 1 1 1 0 0 2 0 2 2 2 0 0 0 2 0 1 0 0 1 0 15 0 1781.9424 P08238 P08238 HSP90AB1;HSP90B;HSPC2;HSPCB Heat shock 84 kDa;Heat shock protein HSP 90-beta yes yes 3 0.0068299 129.34 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1535100 297720 260230 250380 243450 66954 58344 92256 116050 0 0 0 0 0 0 0 0 0 0 0 0 93022 0 0 0 0 0 56671 0 0 0 0 0 0 0 0 190 47 190 2048;2049;2050;2051;2052;2053;2054;2055;2056;2057;2058;2059 1104;1105 1105 HLEINPDHSIIETLR 0 1 1 1 0 0 2 0 2 3 2 0 0 0 1 1 1 0 0 0 0 15 0 1785.9373 P07900 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38 yes yes 3 0.0089624 98.902 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2661000 414180 438580 315730 332620 37283 76482 127790 154660 0 0 0 0 0 0 0 0 0 0 0 0 250470 202300 0 0 0 0 167550 143400 0 0 0 0 0 0 0 191 71 191 2060;2061;2062;2063;2064;2065;2066;2067;2068;2069;2070;2071;2072;2073;2074;2075;2076;2077;2078;2079 1106;1107;1108;1109;1110;1111;1112 1107 HLLLVDPEGVVR 0 1 0 1 0 0 1 1 1 0 3 0 0 0 1 0 0 0 0 3 0 12 0 1345.7718 P29353;P98077 P29353 SHC;SHC1;SHCA;SCK;SHC2;SHCB SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1;Protein Sck;SHC-transforming protein 2;SHC-transforming protein B;Src homology 2 domain-containing-transforming protein C2 yes no 2 0.00015165 156.48 1 0 20 1 0 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4599500 141580 133350 217220 192030 0 0 57033 64669 0 0 0 0 569730 647410 737440 681990 79419 104310 221270 128480 50598 65728 0 0 0 0 0 0 143130 145610 177320 0 0 41158 0 192 78 192 2080;2081;2082;2083;2084;2085;2086;2087 1113;1114;1115 1115 HLVALYTR 1 1 0 0 0 0 0 0 1 0 2 0 0 0 0 0 1 0 1 1 0 8 0 971.55525 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 2 0.095461 83.614 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2251600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 226020 267120 267960 293070 0 0 0 0 0 0 0 0 0 0 0 265180 249400 318500 364380 193 47 193 2088;2089;2090;2091;2092;2093;2094 1116;1117 1116 HSQFIGYPITLFVEK 0 0 0 0 0 1 1 1 1 2 1 1 0 2 1 1 1 0 1 1 0 15 0 1777.9403 P07900;Q58FG0 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AA5P;HSP90AE Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-alpha E;Putative heat shock protein HSP 90-alpha A5 yes no 3 0.040473 77.644 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 725570 230490 211190 0 0 0 0 0 46472 0 0 0 0 0 0 0 0 0 0 0 0 121460 45392 0 0 0 0 46634 23927 0 0 0 0 0 0 0 194 78 194 2095;2096;2097;2098;2099;2100;2101;2102 1118 1118 HSSASFENVWLRPGELGGAPK 2 1 1 0 0 0 2 3 1 0 2 1 0 1 2 3 0 1 0 1 0 21 1 2238.1182 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 3 0.031136 71.697 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2190000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 341600 286100 442120 302540 0 0 0 0 0 0 0 0 0 0 0 98601 95105 313630 310270 195 84 195 2103;2104;2105;2106;2107;2108;2109;2110;2111;2112;2113 1119;1120;1121;1122;1123;1124 1124 HYCVTIPEILPK 0 0 0 0 1 0 1 0 1 2 1 1 0 0 2 0 1 0 1 1 0 12 0 1468.7748 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.00021692 153.12 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1982300 0 0 0 0 38178 41856 49705 0 0 0 0 0 0 0 0 0 308970 308950 323580 259940 0 0 0 0 0 0 0 0 0 0 0 102410 79977 241160 227530 196 173 196 2114;2115;2116;2117 1125 1125 IACANVLSDLYAMGITECDNMLMLLSVSQSMSEEER 3 1 2 2 2 1 4 1 0 2 5 0 4 0 0 5 1 0 1 2 0 36 0 4079.8328 Q99611 Q99611 SEPHS2;SPS2 Selenide, water dikinase 2;Selenium donor protein 2;Selenophosphate synthase 2 yes yes 4 0.087166 5.5855 1 0 4 1 0 4 1 1 1 1 1 1 1 1 1829200 709330 632210 0 0 0 0 0 0 0 0 0 0 0 0 259710 0 0 0 0 0 227930 0 0 0 0 0 0 0 0 0 0 0 0 0 0 197 26 197 2118;2119;2120 1126 1126 IAEIHESR 1 1 0 0 0 0 2 0 1 2 0 0 0 0 0 1 0 0 0 0 0 8 0 953.49304 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 4.2062E-07 150.84 1 0 3 1 0 3 1 1 1 1 1 1 311130 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 135360 140840 0 0 0 0 0 0 0 0 0 0 0 34926 0 0 0 198 40;79 198 2121;2122;2123;2124;2125;2126;2127;2128;2129;2130;2131;2132;2133;2134;2135;2136;2137;2138;2139;2140;2141;2142;2143;2144;2145;2146;2147;2148 1127;1128;1129;1130;1131;1132;1133;1134;1135;1136;1137;1138;1139;1140;1141;1142;1143;1144;1145;1146;1147 1127 IEISELNR 0 1 1 0 0 0 2 0 0 2 1 0 0 0 0 1 0 0 0 0 0 8 0 972.52401 P04264;CON__P04264;P35908;CON__P35908 P04264 KRT1;KRTA;KRT1;KRTA;KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 no no 2 2.5666E-124 143.12 1 0 28 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3332400 0 0 103180 100080 172360 186320 39683 45892 100460 102530 166750 134820 102340 106490 107250 0 252860 227110 52980 0 200890 214290 32116 0 118480 93740 31406 0 66891 66658 207280 0 0 153250 146330 + 199 54 199 2149;2150;2151;2152;2153;2154;2155 1148;1149;1150;1151 1149 IEWLESHQDADIEDFK 1 0 0 3 0 1 3 0 1 2 1 1 0 1 0 1 0 1 0 0 0 16 0 1973.9007 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 3 0.0045923 109.15 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1174200 319800 263760 95096 118420 0 0 26053 0 0 0 0 0 0 0 0 0 0 0 0 0 200810 150300 0 0 0 0 0 0 0 0 0 0 0 0 0 200 57 200 2156;2157 1152 1152 IFDLIGLPPEDDWPR 0 1 0 3 0 0 1 1 0 2 2 0 0 1 3 0 0 1 0 0 0 15 0 1781.8988 P11802 P11802 CDK4 Cell division protein kinase 4;Cyclin-dependent kinase 4;PSK-J3 yes yes 2 0.0089606 98.531 1 0 2 1 0 2 1 1 1 1 194020 91968 102050 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 201 26 201 2158;2159;2160;2161;2162;2163;2164 1153;1154;1155;1156;1157 1154 IFEEQGQTQEK 0 0 0 0 0 3 3 1 0 1 0 1 0 1 0 0 1 0 0 0 0 11 0 1335.6307 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 3.7464E-07 168.22 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 867080 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 149960 119450 197140 195000 0 0 0 0 0 0 0 0 0 0 0 0 35713 84449 85371 202 122 202 2165;2166;2167;2168;2169;2170;2171;2172;2173;2174;2175;2176 1158;1159;1160;1161;1162 1162 IFPLISQSR 0 1 0 0 0 1 0 0 0 2 1 0 0 1 1 2 0 0 0 0 0 9 0 1059.6077 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 0.0023307 117.04 1 0 12 1 0 12 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 2 1 1 9079800 28307 21898 14443 0 0 0 0 0 0 0 0 0 1577500 1386600 2296600 2428800 0 0 0 0 0 0 0 0 0 0 0 0 465480 406370 453760 0 0 0 0 203 89 203 2177;2178;2179 1163;1164 1164 IGDQEFDHLPALLEFYK 1 0 0 2 0 1 2 1 1 1 3 1 0 2 1 0 0 0 1 0 0 17 0 2034.0098 P46109 P46109 CRKL Crk-like protein yes yes 3 0.0030897 86.214 1 0 3 1 0 3 1 1 1 1 1 1 573620 0 0 0 0 0 0 0 0 0 0 0 0 0 0 29574 0 0 0 306290 237760 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 204 108 204 2180 1165 1165 IGGIGTVPVGR 0 1 0 0 0 0 0 4 0 2 0 0 0 0 1 0 1 0 0 2 0 11 0 1024.6029 Q05639;P68104;Q5VTE0 Q05639 EEF1A2;EEF1AL;STN;EEF1A;EEF1A1;EF1A;LENG7;EEF1AL3 Elongation factor 1-alpha 2;Eukaryotic elongation factor 1 A-2;Statin-S1;Elongation factor 1-alpha 1;Elongation factor Tu;Eukaryotic elongation factor 1 A-1;Leukocyte receptor cluster member 7;Eukaryotic elongation factor 1 A-like 3;Putative elongation factor 1-alpha-like 3 yes no 2 4.8137E-08 70.028 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 205 84 205 2181;2182;2183;2184;2185 1166;1167 1166 IGHFFFWHLK 0 0 0 0 0 0 0 1 2 1 1 1 0 3 0 0 0 1 0 0 0 10 0 1330.6975 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.013279 91.853 1 0 5 1 0 5 1 1 1 2 1 1 1 2 383350 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 48544 48093 130680 156030 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 206 5;150;109 206 2186;2187;2188;2189;2190;2191;2192;2193;2194;2195;2196;2197;2198;2199;2200;2201;2202;2203 1168;1169;1170;1171;1172;1173 1168 IHFPLATYAPVISAEK 3 0 0 0 0 0 1 0 1 2 1 1 0 1 2 1 1 0 1 1 0 16 0 1755.956 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;P68366 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA1;TUBA4A Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha no no 3 6.4264E-12 115.34 1 0 18 NaN NaN 1 1 2 1 1 2 1 1 1 2 1 2 2 2450000 611870 0 411060 416990 0 0 134450 26996 0 0 0 0 0 0 180400 111520 29034 46817 0 0 188230 142830 0 0 0 0 62074 87736 0 0 0 0 0 0 0 + 207 89 207 2204;2205;2206;2207;2208;2209;2210;2211;2212;2213 1174;1175 1174 IHYLDTTTLIEPAPR 1 1 0 1 0 0 1 0 1 2 2 0 0 0 2 0 3 0 1 0 0 15 0 1738.9254 P46109 P46109 CRKL Crk-like protein yes yes 3 0.04994 76.073 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1075200 32567 0 34951 0 0 0 0 0 0 0 0 0 45604 0 51139 0 208300 212680 0 0 0 0 0 0 0 0 0 0 0 0 0 87851 91903 146110 164110 208 15 208 2214;2215;2216;2217;2218;2219 1176;1177 1177 IIAATIENAQPILQIDNAR 4 1 2 1 0 2 1 0 0 5 1 0 0 0 1 0 1 0 0 0 0 19 0 2063.1375 CON__P08779;P08779 CON__P08779 KRT16;KRT16A;KRT16;KRT16A Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16 yes no 3 8.7361E-07 151.56 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 786730 0 0 254790 224940 0 0 0 0 43921 44071 0 0 0 0 0 0 42741 0 0 0 0 0 0 0 0 0 0 0 0 0 176270 0 0 0 0 + 209 38 209 2220;2221;2222;2223;2224;2225;2226;2227;2228;2229;2230;2231;2232;2233 1178;1179;1180;1181;1182;1183;1184;1185;1186;1187;1188;1189;1190;1191 1180 IICAQQCSGR 1 1 0 0 2 2 0 1 0 2 0 0 0 0 0 1 0 0 0 0 0 10 0 1191.5489 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 3.5595E-17 200.05 1 0 14 1 0 14 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 9655400 2034300 1890900 1255100 1343300 0 0 0 0 0 0 0 0 182210 230700 343460 289030 0 0 0 0 471370 470830 485180 485630 0 0 0 0 0 62194 111260 0 0 0 0 210 184 210 2234;2235;2236;2237;2238 1192 1192 IIHNFIR 0 1 1 0 0 0 0 0 1 3 0 0 0 1 0 0 0 0 0 0 0 7 0 911.53412 Q9NS86 Q9NS86 GPR69B;LANCL2;TASP LanC-like protein 2;Testis-specific adriamycin sensitivity protein yes yes 2 0.077364 86.113 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 287800 73415 77760 51654 51671 0 0 0 0 0 0 0 0 0 0 0 33305 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 211 99 211 2239;2240;2241;2242;2243;2244;2245;2246;2247;2248 1193;1194;1195;1196;1197 1194 IILDLISESPIK 0 0 0 1 0 0 1 0 0 4 2 1 0 0 1 2 0 0 0 0 0 12 0 1339.7963 P61978 P61978 HNRNPK;HNRPK Heterogeneous nuclear ribonucleoprotein K;Transformation up-regulated nuclear protein yes yes 2 0.00019514 154.24 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1047200 67627 81254 0 0 0 0 0 0 0 0 0 0 0 66757 237850 236230 55649 63116 61472 70062 0 0 0 0 0 0 0 0 0 0 107190 0 0 0 0 212 54;55 212 2249;2250;2251;2252;2253;2254;2255;2256;2257;2258;2259;2260;2261;2262;2263;2264;2265;2266;2267;2268;2269;2270;2271;2272;2273;2274;2275;2276;2277;2278;2279;2280 1198;1199;1200;1201;1202;1203;1204;1205;1206;1207;1208;1209;1210;1211;1212;1213;1214;1215;1216;1217;1218 1198 IINEPTAAAIAYGLDK 4 0 1 1 0 0 1 1 0 3 1 1 0 0 1 0 1 0 1 0 0 16 0 1658.8879 P11021;P11142;P54652 P11021 GRP78;HSPA5;HSC70;HSP73;HSPA10;HSPA8;HSPA2 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein;Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 no no 2,3 6.6972E-05 157.58 1 0 32 NaN NaN 2 2 2 2 2 2 2 2 1 1 1 1 2 2 2 2 2 1 1 11865000 2183500 2165600 1537400 1565900 232340 269380 336270 359570 58586 37204 0 0 47070 0 83868 157650 0 0 0 0 1005400 980160 0 0 0 0 369450 376640 0 0 68761 0 0 30609 0 213 55 213 2281;2282;2283;2284;2285 1219 1219 IINEPTAAAIAYGLDKK 4 0 1 1 0 0 1 1 0 3 1 2 0 0 1 0 1 0 1 0 0 17 1 1786.9829 P11142;P54652 P11142 HSC70;HSP73;HSPA10;HSPA8;HSPA2 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2 yes no 2 0.015522 77.222 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 387850 79966 82868 103510 97628 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 23873 0 0 0 0 0 0 0 0 0 0 0 0 0 214 54 214 2286;2287;2288;2289;2290;2291;2292;2293;2294;2295;2296;2297;2298;2299;2300;2301;2302;2303;2304;2305;2306;2307;2308;2309;2310;2311 1220;1221;1222;1223;1224;1225;1226;1227;1228;1229;1230;1231;1232 1225 IINEPTAAAIAYGLDKR 4 1 1 1 0 0 1 1 0 3 1 1 0 0 1 0 1 0 1 0 0 17 1 1814.989 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2,3 9.2535E-05 145.69 1 0 26 1 0 26 2 2 2 2 1 1 2 2 1 1 1 1 2 2 1 2 1 2 2 2 2 1 1 2 2 1 1 1 1 2 2 1 2 1 31733000 5532300 5064300 3871500 3830500 449670 580250 1409000 1459800 0 0 0 0 60583 116250 103770 134330 0 0 0 0 3564500 3309300 0 0 0 0 1031500 1081600 0 0 134340 0 0 0 0 215 52;64 215 2312;2313;2314;2315;2316;2317;2318;2319;2320;2321;2322;2323;2324;2325;2326;2327;2328;2329;2330;2331;2332 1233;1234;1235;1236;1237;1238;1239 1234 IINEPTAAAIAYGLDR 4 1 1 1 0 0 1 1 0 3 1 0 0 0 1 0 1 0 1 0 0 16 0 1686.8941 P0DMV8;P0DMV9;P17066 P0DMV8 HSP70B;HSPA6 Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B no no 2,3 0.00012495 151.8 1 0 21 NaN NaN 2 2 2 2 1 1 2 2 2 2 1 2 3151900 626580 643370 493320 487430 0 0 29862 40881 0 0 0 0 0 0 141470 115060 0 0 0 0 257630 229120 0 0 0 0 28991 58214 0 0 0 0 0 0 0 216 85 216 2333;2334;2335;2336 1240;1241 1240 IISHVWENNNPFQIVLVK 0 0 3 0 0 1 1 0 1 3 1 1 0 1 1 1 0 1 0 3 0 18 0 2149.1684 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 3 0.00045416 118.13 1 0 4 1 0 4 1 1 1 1 1 1 1 1 956230 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 67241 88449 439350 361180 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 217 7 217;218 2337;2338;2339;2340;2341;2342;2343;2344;2345;2346;2347;2348;2349;2350;2351;2352;2353;2354;2355;2356;2357;2358;2359;2360;2361;2362;2363;2364 1242;1243;1244;1245;1246;1247;1248;1249;1250 1243 0 IITHPNFNGNTLDNDIMLIK 0 0 4 2 0 0 0 1 1 4 2 1 1 1 1 0 2 0 0 0 0 20 0 2282.1729 CON__P00761 CON__P00761 yes yes 3 7.2272E-06 95.347 1 0 28 1 0 28 2 2 2 1 1 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 1 2 2 2 1 1 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 1 10564000 1084500 1201100 422350 378290 0 0 449160 506960 183990 166070 0 0 0 0 94810 64796 919380 900260 222990 191960 1072800 98462 0 0 0 0 953460 1064700 0 0 226350 0 0 165670 196090 + 218 133 219 2365;2366;2367 1251;1252 1252 IITLAGPTNAIFK 2 0 1 0 0 0 0 1 0 3 1 1 0 1 1 0 2 0 0 0 0 13 0 1357.7969 Q15366 Q15366 PCBP2 Alpha-CP2;Heterogeneous nuclear ribonucleoprotein E2;Poly(rC)-binding protein 2 yes yes 2 0.031859 83.314 1 0 3 1 0 3 1 1 1 1 1 1 143920 50673 52066 0 41184 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 219 16 220 2368;2369;2370;2371;2372;2373;2374;2375;2376;2377;2378;2379;2380 1253;1254;1255 1253 IKEWYEK 0 0 0 0 0 0 2 0 0 1 0 2 0 0 0 0 0 1 1 0 0 7 1 994.51238 CON__P13645;P13645;CON__P02535-1 CON__P13645 KPP;KRT10;KPP;KRT10;Krt10;Krt1-10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa yes no 2 0.050631 81.297 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 605740 0 0 48042 37698 0 56979 24625 0 0 0 0 0 0 19048 0 43057 66161 79124 0 0 42315 0 0 0 0 31786 0 0 0 0 121970 0 0 34937 0 + 220 67 221 2381;2382;2383;2384;2385;2386;2387;2388 1256;1257;1258 1257 IKPSSSANAIYSLAAR 4 1 1 0 0 0 0 0 0 2 1 1 0 0 1 4 0 0 1 0 0 16 1 1647.8944 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 3 0.015579 83.087 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1127200 0 0 0 0 0 0 0 0 0 0 0 0 74796 78260 69152 67399 196850 205300 221770 213700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 221 38 222 2389;2390;2391;2392 1259 1259 IKVLGSGAFGTVYK 1 0 0 0 0 0 0 3 0 1 1 2 0 1 0 1 1 0 1 2 0 14 1 1438.8184 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.17344 63.662 1 0 4 1 0 4 1 1 1 1 1 1 1 1 508220 192370 161230 73975 80641 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 222 55 223 2393;2394 1260;1261 1260 ILDKCNEIINWLDK 0 0 2 2 1 0 1 0 0 3 2 2 0 0 0 0 0 1 0 0 0 14 1 1772.9131 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 3 0.010158 100.93 1 0 2 1 0 2 1 1 1 1 210110 119970 90135 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 223 76 224 2395;2396;2397;2398;2399 1262;1263;1264 1262 ILFRPVASQLPR 1 2 0 0 0 1 0 0 0 1 2 0 0 1 2 1 0 0 0 1 0 12 1 1395.8351 P35232 P35232 PHB Prohibitin yes yes 3 0.006065 98.943 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 522800 167140 139730 91793 82001 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 42140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 224 124 225 2400;2401 1265;1266 1265 ILGIIDAIQDAVGPPK 2 0 0 2 0 1 0 2 0 4 1 1 0 0 2 0 0 0 0 1 0 16 0 1618.9294 Q13191 Q13191 CBLB;Nbla00127;RNF56 Casitas B-lineage lymphoma proto-oncogene b;E3 ubiquitin-protein ligase CBL-B;RING finger protein 56;SH3-binding protein CBL-B;Signal transduction protein CBL-B yes yes 2 0.0057814 93.237 1 0 2 1 0 2 1 1 1 1 203260 0 0 0 0 0 0 0 0 0 0 0 0 0 0 107270 95989 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 225 38 226 2402;2403;2404;2405 1267;1268;1269 1267 ILKETEFK 0 0 0 0 0 0 2 0 0 1 1 2 0 1 0 0 1 0 0 0 0 8 1 1006.5699 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.050008 91.626 1 0 4 1 0 4 1 1 1 1 1 1 1 1 343670 95053 82337 89335 76942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 226 38 227 2406;2407;2408 1270 1270 ILKETEFKK 0 0 0 0 0 0 2 0 0 1 1 3 0 1 0 0 1 0 0 0 0 9 2 1134.6649 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.080562 87.308 1 0 3 1 0 3 1 1 1 1 1 1 127380 45873 42235 0 39271 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 227 137 228 2409;2410;2411;2412 1271;1272;1273;1274 1271 ILMMNTGDVGAR 1 1 1 1 0 0 0 2 0 1 1 0 2 0 0 0 1 0 0 1 0 12 0 1276.6268 Q4G0P3 Q4G0P3 HYDIN;HYDIN1;HYDIN2;KIAA1864 Hydrocephalus-inducing protein homolog yes yes 2 0.088493 28.177 1 0 4 1 0 4 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 228 145 229 2413;2414;2415;2416;2417;2418;2419;2420;2421 1275;1276;1277;1278;1279;1280;1281 1276 ILSFVYPIR 0 1 0 0 0 0 0 0 0 2 1 0 0 1 1 1 0 0 1 1 0 9 0 1106.6488 Q6P1M0 Q6P1M0 ACSVL4;FATP4;SLC27A4 Long-chain fatty acid transport protein 4;Solute carrier family 27 member 4 yes yes 2 0.0010651 123.92 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 750520 124370 160230 94553 114610 0 0 0 0 0 0 0 0 29435 41363 0 42596 0 0 0 0 77044 66335 0 0 0 0 0 0 0 0 0 0 0 0 0 229 93 230 2422;2423;2424;2425;2426 1282;1283 1282 ILSLLEGQK 0 0 0 0 0 1 1 1 0 1 3 1 0 0 0 1 0 0 0 0 0 9 0 999.59645 P51648 P51648 ALDH10;ALDH3A2;FALDH Aldehyde dehydrogenase 10;Aldehyde dehydrogenase family 3 member A2;Fatty aldehyde dehydrogenase;Microsomal aldehyde dehydrogenase yes yes 2 0.054724 80.239 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 471260 134130 147350 66352 77305 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 46125 0 0 0 0 0 0 0 0 0 0 0 0 0 0 230 6 231 2427;2428 1284 1284 ILTATIENNR 1 1 2 0 0 0 1 0 0 2 1 0 0 0 0 0 2 0 0 0 0 10 0 1143.6248 CON__P13646-1;P13646;CON__ENSEMBL:ENSP00000377550 CON__P13646-1 KRT13;KRT13 Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13 yes no 2 0.017114 90.15 1 0 2 1 0 2 1 1 1 1 66286 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 35065 31222 0 0 0 0 0 0 0 0 0 0 0 + 231 8 232 2429;2430;2431;2432;2433 1285 1285 ILTATVDNANVLLQIDNAR 3 1 3 2 0 1 0 0 0 2 3 0 0 0 0 0 2 0 0 2 0 19 0 2053.1168 CON__P02533;P02533 CON__P02533 KRT14;KRT14 Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14 yes no 3 0.00022872 102.65 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 504080 0 0 0 0 0 0 0 0 76693 49054 0 0 0 0 0 0 0 0 0 0 79289 62674 0 0 0 0 0 0 0 0 236370 0 0 0 0 + 232 155 233 2434;2435 1286 1286 ILYDILAFAK 2 0 0 1 0 0 0 0 0 2 2 1 0 1 0 0 0 0 1 0 0 10 0 1165.6747 Q8IXB1 Q8IXB1 DNAJC10;ERDJ5;UNQ495/PRO1012 DnaJ homolog subfamily C member 10;ER-resident protein ERdj5;Macrothioredoxin yes yes 2 0.03971 79.148 1 0 2 1 0 2 1 1 1 1 91727 42302 49425 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 233 46;125 234 2436;2437;2438;2439 1287;1288 1287 IMNTFSVVPSPK 0 0 1 0 0 0 0 0 0 1 0 1 1 1 2 2 1 0 0 2 0 12 0 1318.6955 P07437;P68371;P04350;Q13509 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB3;TUBB4 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-3 chain;Tubulin beta-III no no 2 0.0023336 115.33 1 0 4 NaN NaN 1 1 1 1 433710 154370 151850 59153 68339 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 234 26 235 2440;2441;2442;2443;2444;2445;2446;2447;2448;2449;2450;2451;2452;2453 1289;1290;1291;1292;1293;1294;1295;1296;1297;1298 1292 INEWLGIK 0 0 1 0 0 0 1 1 0 2 1 1 0 0 0 0 0 1 0 0 0 8 0 971.54402 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 1.0131E-07 161.02 1 0 14 1 0 14 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 8691800 0 0 0 0 127630 110880 47942 58951 0 0 0 0 0 0 0 19824 1267700 1351000 0 1180800 0 0 0 0 0 0 0 35064 0 0 0 465210 510810 1678900 1837100 235 84 236 2454;2455;2456;2457;2458;2459;2460;2461;2462;2463 1299;1300;1301;1302;1303;1304;1305;1306;1307 1306 INHDCVPEQVIAEAIR 2 1 1 1 1 1 2 0 1 3 0 0 0 0 1 0 0 0 0 2 0 16 0 1862.9309 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 3 1.012E-07 164.68 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3731500 0 0 0 0 0 0 103520 104530 0 0 0 0 0 0 0 0 387910 409760 1095700 788830 0 0 0 0 0 0 0 0 0 0 0 138360 137860 260910 304170 236 66 237 2464;2465;2466;2467;2468;2469;2470;2471;2472;2473;2474 1308;1309;1310;1311;1312;1313 1313 IPALDPEKLNVFR 1 1 1 1 0 0 1 0 0 1 2 1 0 1 2 0 0 0 0 1 0 13 1 1510.8508 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 3 0.0078335 98.898 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1702400 0 0 0 0 132260 172300 293370 297590 0 0 0 0 0 0 0 0 62002 72107 103830 85339 0 0 0 0 0 0 216340 221760 0 0 0 0 0 45484 0 237 103 238 2475;2476;2477;2478 1314;1315 1314 IPDWFLNR 0 1 1 1 0 0 0 0 0 1 1 0 0 1 1 0 0 1 0 0 0 8 0 1059.5502 P62269 P62269 D6S218E;RPS18 40S ribosomal protein S18;Ke-3 yes yes 2 0.019431 111.04 1 0 4 1 0 4 1 1 1 1 1 1 1 1 315210 103200 80817 67147 64048 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 238 38 239 2479;2480;2481;2482;2483;2484;2485;2486;2487;2488;2489;2490;2491;2492;2493;2494;2495;2496;2497;2498;2499;2500;2501;2502;2503;2504;2505;2506;2507;2508;2509;2510;2511;2512;2513;2514;2515;2516;2517;2518;2519;2520;2521;2522;2523;2524;2525;2526;2527;2528;2529;2530;2531;2532;2533;2534;2535;2536;2537;2538;2539;2540;2541;2542;2543;2544;2545;2546;2547;2548;2549;2550;2551;2552;2553;2554;2555;2556;2557;2558;2559;2560;2561;2562;2563;2564;2565;2566;2567;2568;2569;2570;2571;2572;2573;2574;2575;2576;2577;2578;2579;2580;2581 1316;1317;1318;1319;1320;1321;1322;1323;1324;1325;1326;1327;1328;1329;1330;1331;1332;1333;1334;1335;1336;1337;1338;1339;1340;1341;1342;1343;1344;1345;1346;1347;1348;1349;1350;1351;1352;1353;1354;1355;1356;1357;1358;1359;1360;1361;1362;1363;1364;1365;1366;1367;1368;1369;1370;1371;1372;1373;1374;1375;1376;1377;1378;1379;1380;1381;1382;1383;1384;1385;1386;1387;1388;1389;1390;1391;1392;1393;1394;1395 1390 IPLENLQIIR 0 1 1 0 0 1 1 0 0 3 2 0 0 0 1 0 0 0 0 0 0 10 0 1207.7289 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 7.2209E-67 266.91 1 0 103 1 0 103 14 12 10 10 1 1 1 1 3 2 9 8 1 1 1 2 6 9 1 1 1 1 1 1 1 1 1 1 1 14 12 10 10 1 1 1 1 3 2 9 8 1 1 1 2 6 9 1 1 1 1 1 1 1 1 1 1 1 257050000 38826000 42206000 26863000 28117000 459670 454810 461420 510430 0 0 0 0 8154200 8053900 17633000 18133000 1169700 1124100 1056300 943770 26826000 27224000 184040 219040 0 0 286420 220560 1975300 2420100 3079900 71571 92392 146700 142990 239 26 240 2582;2583;2584;2585;2586;2587;2588;2589;2590 1396;1397;1398;1399;1400 1397 IQGEYTLTLR 0 1 0 0 0 1 1 1 0 1 2 0 0 0 0 0 2 0 1 0 0 10 0 1192.6452 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.00076398 115.78 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5719600 0 0 0 0 0 25716 0 0 0 0 0 0 0 0 0 0 805430 736120 1220800 1147200 0 0 0 0 0 0 0 0 0 0 0 362530 303210 569580 548950 240 26 241 2591;2592;2593;2594;2595;2596;2597;2598;2599 1401;1402;1403;1404;1405;1406;1407;1408 1403 IRDQYLVWLTQK 0 1 0 1 0 2 0 0 0 1 2 1 0 0 0 0 1 1 1 1 0 12 1 1561.8617 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 0.0073306 94.465 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 13080000 0 0 0 0 0 0 54711 0 0 0 0 0 0 0 0 0 2835900 2724700 3769800 3144000 0 0 0 0 0 0 0 0 0 0 0 151130 132670 137110 129860 241 16 242 2600;2601;2602;2603;2604;2605;2606;2607;2608;2609;2610;2611;2612;2613;2614;2615;2616;2617;2618;2619;2620;2621 1409;1410;1411;1412;1413;1414 1410 IRLENEIQTYR 0 2 1 0 0 1 2 0 0 2 1 0 0 0 0 0 1 0 1 0 0 11 1 1433.7627 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2,3 0.00077248 117.52 1 0 22 1 0 22 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1681700 0 0 58077 53029 87570 77092 0 0 49482 32900 0 56693 49145 39389 90177 95730 125770 107260 48767 42298 177530 99726 0 0 0 0 0 0 0 0 275820 0 0 53052 62168 + 242 17 243 2622;2623;2624;2625;2626;2627;2628;2629;2630;2631;2632;2633;2634;2635 1415;1416;1417;1418;1419;1420;1421;1422;1423 1419 ISISTSGGSFR 0 1 0 0 0 0 0 2 0 2 0 0 0 1 0 4 1 0 0 0 0 11 0 1110.5669 CON__P13647;P13647 CON__P13647 KRT5;KRT5 58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5 yes no 2 2.0339E-08 96.342 1 0 14 1 0 14 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 551560 0 0 38342 48584 0 28136 0 0 0 0 41831 40464 70194 74129 0 0 41390 0 0 0 22829 0 0 0 0 0 0 0 0 19394 73749 0 0 52519 0 + 243 105 244 2636;2637;2638;2639;2640;2641;2642;2643;2644;2645;2646;2647;2648;2649;2650;2651;2652 1424;1425;1426 1425 ISLGLPVGAVINCADNTGAK 3 0 2 1 1 0 0 3 0 2 2 1 0 0 1 1 1 0 0 2 0 20 0 1969.0303 P62829 P62829 RPL23 60S ribosomal protein L17;60S ribosomal protein L23 yes yes 2,3 2.2216E-06 117.18 1 0 17 1 0 17 2 1 1 2 2 1 1 1 1 1 2 1 1 2 1 1 2 2 1 1 1 1 1 2 1 1 2100200 548340 294740 240710 309020 0 0 87197 85091 0 0 0 0 0 0 18754 0 81710 64133 50914 0 208370 64170 0 0 0 0 0 47040 0 0 0 0 0 0 0 244 53 245 2653;2654;2655;2656;2657;2658;2659;2660;2661 1427;1428 1428 ISSIQSIVPALEIANAHR 3 1 1 0 0 1 1 0 1 4 1 0 0 0 1 3 0 0 0 1 0 18 0 1918.0636 P10809 P10809 HSP60;HSPD1 60 kDa chaperonin;60 kDa heat shock protein, mitochondrial;Chaperonin 60;Heat shock protein 60;HuCHA60;Mitochondrial matrix protein P1;P60 lymphocyte protein yes yes 3 0.081167 60.918 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1241800 242050 237920 148730 147620 0 0 0 0 0 0 0 0 0 0 99773 70499 0 37232 0 0 126200 131730 0 0 0 0 0 0 0 0 0 0 0 0 0 245 8;15 246 2662 1429 1429 ISSVLAGGSCR 1 1 0 0 1 0 0 2 0 1 1 0 0 0 0 3 0 0 0 1 0 11 0 1105.555 CON__P02533;P02533;CON__P08779;P08779 CON__P02533 KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16 no no 2 0.024909 83.862 1 0 1 NaN NaN 1 45931 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 45931 0 0 0 0 + 246 127 247 2663 1430 1430 ISTLSCENK 0 0 1 0 1 0 1 0 0 1 1 1 0 0 0 2 1 0 0 0 0 9 0 1050.5016 Q14116 Q14116 IGIF;IL18;IL1F4 Iboctadekin;Interferon gamma-inducing factor;Interleukin-1 gamma;Interleukin-18 yes yes 2 0.047418 59.35 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 247 38 248 2664;2665;2666;2667;2668;2669;2670;2671;2672;2673;2674;2675 1431;1432;1433;1434;1435 1432 ITDFGLAK 1 0 0 1 0 0 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 8 0 863.47527 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 1 0.020078 110.36 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2146500 390030 377440 363670 345040 0 0 0 0 0 0 0 0 65021 42324 94375 92312 0 0 0 0 98556 84815 94132 98746 0 0 0 0 0 0 0 0 0 0 0 248 54 249 2676;2677;2678;2679;2680;2681;2682 1436;1437;1438;1439 1437 ITITNDQNR 0 1 2 1 0 1 0 0 0 2 0 0 0 0 0 0 2 0 0 0 0 9 0 1073.5465 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.0076738 83.005 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 253670 60634 55323 0 52838 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 44546 40333 0 0 0 0 0 0 0 0 0 0 0 249 54 250 2683;2684;2685;2686;2687;2688;2689;2690;2691;2692;2693;2694 1440;1441;1442;1443;1444;1445;1446;1447;1448;1449 1449 ITPSYVAFTPEGER 1 1 0 0 0 0 2 1 0 1 0 0 0 1 2 1 2 0 1 1 0 14 0 1565.7726 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.0052466 134.99 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3096000 453390 446630 484550 473560 168880 129500 127640 146230 0 0 0 0 0 0 0 0 0 0 0 0 301840 251010 0 0 0 18489 0 94225 0 0 0 0 0 0 0 250 141 251 2695;2696;2697;2698;2699;2700;2701;2702 1450;1451;1452;1453;1454 1450 ITVLEALR 1 1 0 0 0 0 1 0 0 1 2 0 0 0 0 0 1 0 0 1 0 8 0 913.55967 Q5T9A4;Q9NVI7;Q5T2N8 Q5T9A4 ATAD3B;KIAA1273;ATAD3A;ATAD3C ATPase family AAA domain-containing protein 3B;ATPase family AAA domain-containing protein 3A;ATPase family AAA domain-containing protein 3C yes no 2 0.013007 117.4 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 607590 99465 74540 89159 101150 0 0 0 0 0 0 0 0 0 0 42076 0 0 0 0 0 111720 89477 0 0 0 0 0 0 0 0 0 0 0 0 0 251 13 252 2703;2704;2705;2706;2707;2708 1455 1455 IVLQIDNAR 1 1 1 1 0 1 0 0 0 2 1 0 0 0 0 0 0 0 0 1 0 9 0 1040.5978 CON__P19001;CON__P08727;P08727;CON__P05784;P05783 CON__P19001 Krt1-19;Krt19;KRT19;KRT19;Kerd;Krt1-18;Krt18;CYK18;KRT18;PIG46 Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin endo B;Cytokeratin-18;Keratin, type I cytoskeletal 18;Keratin-18;Cell proliferation-inducing gene 46 protein yes no 2 0.12479 71.223 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 257150 68823 64981 0 35652 0 0 0 0 0 0 0 0 20126 0 0 0 0 0 0 0 0 31737 0 0 0 0 0 0 0 35835 0 0 0 0 0 + 252 1 253 2709;2710;2711;2712;2713;2714;2715;2716;2717;2718;2719 1456;1457;1458;1459 1456 IWHHTFYNELR 0 1 1 0 0 0 1 0 2 1 1 0 0 1 0 0 1 1 1 0 0 11 0 1514.7419 A5A3E0;P0CG38;Q6S8J3;P68032;P68133;CON__P60712;P60709;P63261;Q9BYX7;P0CG39 A5A3E0 A26C1B;POTEF;A26C1A;POTE2;POTEE;ACTC;ACTC1;ACTA;ACTA1;ACTB;ACTB;ACTG;ACTG1;ACTBL3;FKSG30;POTEKP ANKRD26-like family C member 1B;Chimeric POTE-actin protein;POTE ankyrin domain family member F;ANKRD26-like family C member 1A;POTE ankyrin domain family member E;Prostate, ovary, testis-expressed protein on chromosome 2;Actin, alpha cardiac muscle 1;Alpha-cardiac actin;Actin, alpha skeletal muscle;Alpha-actin-1;Actin, cytoplasmic 1;Actin, cytoplasmic 1, N-terminally processed;Beta-actin;Actin, cytoplasmic 2;Actin, cytoplasmic 2, N-terminally processed;Gamma-actin;Kappa-actin;POTE ankyrin domain family member K;Putative beta-actin-like protein 3 yes no 3 0.0053797 100.02 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 900210 140560 156300 125950 141400 0 0 0 0 0 0 0 0 60171 55565 48683 0 26926 0 0 0 53145 51625 0 0 0 0 0 0 0 0 39892 0 0 0 0 + 253 30 254 2720 1460 1460 KELENLDSR 0 1 1 1 0 0 2 0 0 0 2 1 0 0 0 1 0 0 0 0 0 9 1 1102.5619 O43196 O43196 MSH5 MutS protein homolog 5 yes yes 2 0.089257 48.423 1 0 1 1 0 1 1 1 54977 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 54977 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 254 107 255 2721;2722;2723;2724;2725;2726;2727;2728 1461;1462 1461 KIEEIKDFLLTAR 1 1 0 1 0 0 2 0 0 2 2 2 0 1 0 0 1 0 0 0 0 13 2 1574.9032 P63173 P63173 RPL38 60S ribosomal protein L38 yes yes 3 0.040758 90.614 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 877320 246010 229770 68836 76677 0 0 0 0 0 0 0 0 0 0 54016 49658 0 0 0 0 84523 67834 0 0 0 0 0 0 0 0 0 0 0 0 0 255 26 256 2729;2730;2731;2732;2733;2734;2735;2736;2737;2738;2739 1463;1464;1465;1466;1467 1464 KINEWLGIK 0 0 1 0 0 0 1 1 0 2 1 2 0 0 0 0 0 1 0 0 0 9 1 1099.639 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.0045517 120.99 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5733800 0 0 0 0 0 30091 0 32440 0 0 0 0 0 0 0 0 1223100 1247300 884760 895840 0 0 0 0 0 0 0 0 0 0 0 163840 201650 519070 535750 256 26 257 2740;2741;2742;2743;2744 1468;1469;1470;1471 1469 KIRDQYLVWLTQK 0 1 0 1 0 2 0 0 0 1 2 2 0 0 0 0 1 1 1 1 0 13 2 1689.9566 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 0.011777 123.67 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1914600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 496680 409200 555530 414810 0 0 0 0 0 0 0 0 0 0 0 0 0 38336 0 257 54 258 2745;2746;2747;2748;2749;2750;2751;2752;2753 1472;1473;1474;1475;1476 1473 KKELEEIVQPIISK 0 0 0 0 0 1 3 0 0 3 1 3 0 0 1 1 0 0 0 1 0 14 2 1652.9713 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 3 0.024708 105.65 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1374700 280140 239730 159710 164980 82866 69297 0 75262 0 0 0 0 0 0 0 0 0 0 0 0 169700 133040 0 0 0 0 0 0 0 0 0 0 0 0 0 258 38 259 2754;2755;2756;2757;2758;2759;2760;2761 1477;1478;1479 1478 KLFGTSGQK 0 0 0 0 0 1 0 2 0 0 1 2 0 1 0 1 1 0 0 0 0 9 1 964.53418 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.042808 93.178 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1223100 285730 239860 0 317170 0 0 0 0 0 0 0 0 73953 59953 63969 63137 0 0 0 0 119300 0 0 0 0 0 0 0 0 0 0 0 0 0 0 259 148 260 2762;2763;2764;2765;2766;2767;2768;2769;2770;2771;2772;2773;2774;2775;2776;2777;2778;2779;2780;2781;2782;2783;2784;2785;2786;2787;2788;2789;2790;2791;2792;2793;2794;2795;2796;2797;2798;2799;2800;2801;2802 1480;1481;1482;1483;1484;1485;1486;1487;1488;1489;1490;1491;1492;1493;1494 1485 KRAEGLSGYAVR 2 2 0 0 0 0 1 2 0 0 1 1 0 0 0 1 0 0 1 1 0 12 2 1305.7153 Q6URK8 Q6URK8 TEPP Testis, prostate and placenta-expressed protein yes yes 2 0.0092704 113.69 1 0 41 1 0 41 3 2 2 3 1 2 2 1 2 2 2 2 1 1 1 1 2 2 2 1 1 2 2 1 3 2 2 3 1 2 2 1 2 2 2 2 1 1 1 1 2 2 2 1 1 2 2 1 93997000 12804000 12310000 18207000 17882000 61768 156100 180850 94246 0 0 0 0 2743300 3148600 5775500 5864400 133510 125910 177730 184420 6281600 6126900 45446 40342 0 0 61317 0 378680 635670 577150 0 0 0 0 260 65 261 2803 1495 1495 KVDVYGFVSR 0 1 0 1 0 0 0 1 0 0 0 1 0 1 0 1 0 0 1 3 0 10 1 1168.6241 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 2 8.3065E-05 85.355 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 261 54 262 2804;2805;2806;2807;2808;2809;2810;2811;2812;2813;2814 1496;1497;1498 1498 KVTHAVVTVPAYFNDAQR 3 1 1 1 0 1 0 0 1 0 0 1 0 1 1 0 2 0 1 4 0 18 1 2015.0589 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 3 0.026251 75.968 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 937630 167600 159530 123360 132330 31681 46236 38302 39761 0 0 0 0 0 0 0 0 0 0 0 0 95320 76522 0 0 0 0 0 26983 0 0 0 0 0 0 0 262 17 263 2815 1499 1499 LAELEEALQK 2 0 0 0 0 1 3 0 0 0 3 1 0 0 0 0 0 0 0 0 0 10 0 1142.6183 CON__P13647;P13647 CON__P13647 KRT5;KRT5 58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5 yes no 2 8.9475E-05 71.349 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 263 66 264 2816;2817;2818;2819;2820;2821;2822;2823;2824;2825;2826;2827;2828 1500;1501;1502;1503;1504;1505;1506;1507;1508 1508 LAEVPDLLEK 1 0 0 1 0 0 2 0 0 0 3 1 0 0 1 0 0 0 0 1 0 10 0 1125.6281 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 0.0026706 90.629 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3414600 0 0 0 0 547470 549600 496200 537860 0 0 0 0 0 0 0 0 104750 103140 0 143440 0 0 0 0 0 77618 333450 365250 0 0 0 0 0 67663 88191 264 88 265 2829;2830 1509 1509 LAFLNVQAAEEALPR 4 1 1 0 0 1 2 0 0 0 3 0 0 1 1 0 0 0 0 1 0 15 0 1640.8886 P43304 P43304 GPD2 Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD yes yes 3 0.0089866 104.17 1 0 2 1 0 2 1 1 1 1 172710 66460 106250 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 265 40 266 2831;2832;2833;2834;2835;2836;2837;2838;2839;2840;2841;2842;2843;2844;2845;2846;2847;2848;2849;2850;2851;2852 1510;1511;1512;1513;1514;1515;1516;1517;1518;1519;1520;1521;1522;1523;1524 1522 LALDLEIATYR 2 1 0 1 0 0 1 0 0 1 3 0 0 0 0 0 1 0 1 0 0 11 0 1276.7027 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 6.057E-12 196.27 1 0 22 1 0 22 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 3395300 0 31424 0 0 0 0 57685 37018 369850 373320 0 0 41387 0 145920 134050 139330 100040 259820 206360 228910 203010 0 0 0 0 65298 65332 0 0 703880 23771 30170 101220 77478 + 266 16;19;8;15;13 267 2853 1525 1525 LASYLDK 1 0 0 1 0 0 0 0 0 0 2 1 0 0 0 1 0 0 1 0 0 7 0 808.43307 CON__P35527;P35527;CON__P13645;P13645;CON__Q99456;Q99456;CON__P08730-1;CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P05784;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779 CON__P13645 KRT9;KRT9;KPP;KRT10;KPP;KRT10;KRT12;KRT12;Krt1-13;Krt13;Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;Kerd;Krt1-18;Krt18;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9;Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-12;Keratin, type I cytoskeletal 12;Keratin-12;47 kDa cytokeratin;Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13;Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin endo B;Cytokeratin-18;Keratin, type I cytoskeletal 18;Keratin-18;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16 no no 1 0.097602 77.748 1 0 1 NaN NaN 1 126310 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 126310 0 0 0 0 + 267 19 268 2854;2855;2856;2857;2858;2859;2860;2861;2862;2863;2864;2865;2866 1526;1527 1527 LASYLDKVQALEEANNDLENK 3 0 3 2 0 1 3 0 0 0 4 2 0 0 0 1 0 0 1 1 0 21 1 2376.1809 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 5.9425E-10 151.48 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1897000 0 0 0 63564 0 0 0 0 101180 75359 0 0 0 0 60778 75196 108070 115860 107990 96090 232140 258000 0 0 0 0 0 0 0 0 579220 0 0 0 23514 + 268 16;8;15;13 269 2867;2868;2869;2870;2871;2872;2873;2874;2875;2876;2877;2878;2879;2880;2881;2882;2883;2884;2885;2886;2887;2888;2889;2890 1528;1529;1530;1531;1532;1533;1534;1535;1536;1537;1538;1539 1533 LASYLDKVR 1 1 0 1 0 0 0 0 0 0 2 1 0 0 0 1 0 0 1 1 0 9 1 1063.6026 CON__P13645;P13645;CON__Q99456;Q99456;CON__P08730-1;CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779 CON__P13645 KPP;KRT10;KPP;KRT10;KRT12;KRT12;Krt1-13;Krt13;Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;Cytokeratin-12;Keratin, type I cytoskeletal 12;Keratin-12;47 kDa cytokeratin;Cytokeratin-13;Keratin, type I cytoskeletal 13;Keratin-13;Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16 no no 2 5.1544E-08 147.51 1 0 24 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3314800 0 0 146260 152200 111880 69020 57481 62960 58534 59800 81201 116960 0 42920 157570 120690 104640 89793 0 0 99409 120330 0 0 103420 118440 0 0 120700 118860 1033100 0 0 90600 78092 + 269 46;125 270 2891;2892;2893;2894 1540;1541;1542 1542 LAVNMVPFPR 1 1 1 0 0 0 0 0 0 0 1 0 1 1 2 0 0 0 0 2 0 10 0 1142.627 P07437;P68371;P04350;Q13885;Q9BVA1;A6NNZ2;Q3ZCM7;CON__ENSEMBL:ENSBTAP00000025008;Q9H4B7;Q13509 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB8;TUBB1;TUBB3;TUBB4 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-8 chain B;Tubulin beta-8 chain;Tubulin beta-1 chain;Tubulin beta-3 chain;Tubulin beta-III no no 2 0.018969 89.247 1 0 4 NaN NaN 1 1 1 1 435370 120290 144720 90215 80133 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 270 85 271 2895;2896;2897;2898;2899;2900;2901;2902;2903;2904;2905;2906;2907;2908;2909;2910;2911;2912;2913;2914;2915;2916;2917 1543;1544;1545;1546;1547;1548;1549;1550 1550 LCDVRPFLPVLK 0 1 0 1 1 0 0 0 0 0 3 1 0 1 2 0 0 0 0 2 0 12 1 1455.8272 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2,3 0.015232 90.108 1 0 23 1 0 23 1 1 1 1 2 2 2 2 2 1 1 1 2 2 2 1 1 1 1 2 2 2 2 2 1 1 1 2 2 2 4214000 0 0 0 0 71487 58688 96258 102420 0 0 0 0 0 0 0 34844 536250 536000 593120 424160 0 0 0 0 0 0 37958 40304 0 0 0 143520 190260 680330 668430 271 96 272 2918;2919 1551;1552 1552 LCLQSIAFISR 1 1 0 0 1 1 0 0 0 2 2 0 0 1 0 2 0 0 0 0 0 11 0 1306.7067 P57088 P57088 DB83;TMEM33 Protein DB83;Transmembrane protein 33 yes yes 2 7.0731E-09 86.014 1 0 2 1 0 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 272 84 273 2920;2921;2922;2923;2924;2925;2926;2927;2928;2929;2930;2931 1553;1554;1555;1556;1557;1558 1555 LCLSICSVK 0 0 0 0 2 0 0 0 0 1 2 1 0 0 0 2 0 0 0 1 0 9 0 1078.5515 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.00086889 124.98 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2576500 0 0 0 0 60934 61870 62910 59419 0 0 0 0 0 0 0 0 381170 352380 373640 358400 0 0 0 0 0 0 0 0 0 0 0 164920 154390 267430 279090 273 84 274 2932;2933;2934;2935;2936;2937;2938 1559;1560;1561;1562 1561 LCVLEYQGK 0 0 0 0 1 1 1 1 0 0 2 1 0 0 0 0 0 0 1 1 0 9 0 1108.5587 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.0032631 88.819 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 319480 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 56823 60047 54809 77925 0 0 0 0 0 0 0 0 0 0 0 16438 0 0 53437 274 55 275 2939;2940;2941;2942;2943;2944;2945;2946;2947;2948;2949;2950;2951 1563;1564;1565;1566;1567;1568;1569 1563 LDKSQIHDIVLVGGSTR 0 1 0 2 0 1 0 2 1 2 2 1 0 0 0 2 1 0 0 2 0 17 1 1837.0058 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 3 5.472E-10 167.89 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2152100 419370 375480 290750 269640 41929 25454 80772 81282 0 0 0 0 0 0 28697 29749 0 0 0 0 255030 228140 0 0 0 0 0 25840 0 0 0 0 0 0 0 275 183 276 2952;2953;2954;2955 1570;1571 1571 LDNWLNELETYCTR 0 1 2 1 1 0 2 0 0 0 3 0 0 0 0 0 2 1 1 0 0 14 0 1825.8305 Q9NP72 Q9NP72 RAB18 Ras-related protein Rab-18 yes yes 2 0.010119 106.13 1 0 4 1 0 4 1 1 1 1 1 1 1 1 279390 119400 102980 0 0 0 0 0 0 0 0 0 0 0 0 23950 0 0 0 0 0 0 33065 0 0 0 0 0 0 0 0 0 0 0 0 0 276 12 277 2956;2957;2958;2959;2960;2961;2962;2963;2964;2965;2966;2967;2968 1572;1573;1574;1575;1576;1577;1578;1579 1573 LEGLTDEINFLR 0 1 1 1 0 0 2 1 0 1 3 0 0 1 0 0 1 0 0 0 0 12 0 1418.7405 CON__P05787;P05787;CON__H-INV:HIT000292931 CON__P05787 CYK8;KRT8;CYK8;KRT8 Cytokeratin-8;Keratin, type II cytoskeletal 8;Keratin-8;Type-II keratin Kb8 yes no 2 2.7118E-07 176.78 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2403100 446990 448470 226600 225790 0 0 0 0 79298 69013 0 0 0 0 158660 124660 27975 24175 0 0 227660 190300 0 0 0 0 0 0 0 0 153490 0 0 0 0 + 277 199 278 2969;2970;2971;2972;2973;2974 1580 1580 LEIEQKDIELR 0 1 0 1 0 1 3 0 0 2 2 1 0 0 0 0 0 0 0 0 0 11 1 1384.7562 REV__Q86SQ7 REV__Q86SQ7 yes yes 2 0.088848 69.01 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 506070 99652 101850 57041 68992 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 105610 72931 0 0 0 0 0 0 0 0 0 0 0 0 0 + 278 195 279 2975;2976 1581 1581 LELESVQR 0 1 0 0 0 1 2 0 0 0 2 0 0 0 0 1 0 0 0 1 0 8 0 972.52401 REV__Q2M243 REV__Q2M243 yes yes 2 0.026253 103.92 1 0 2 1 0 2 1 1 1 1 138530 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 86667 0 0 0 51862 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 279 16 280 2977;2978;2979;2980;2981;2982;2983;2984;2985;2986;2987;2988;2989;2990;2991;2992;2993;2994;2995 1582;1583;1584;1585;1586;1587;1588;1589;1590;1591;1592 1587 LENEIQTYR 0 1 1 0 0 1 2 0 0 1 1 0 0 0 0 0 1 0 1 0 0 9 0 1164.5775 CON__P13645;P13645;CON__P02535-1 CON__P13645 KPP;KRT10;KPP;KRT10;Krt10;Krt1-10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa yes no 2 4.7429E-05 134.26 1 0 19 1 0 19 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 902510 52508 48461 35628 45342 58182 49510 0 0 0 0 34257 51044 0 0 50022 0 87444 75457 0 0 68246 70415 0 0 38920 28057 0 0 0 0 69679 0 0 0 39335 + 280 82 281 2996;2997;2998;2999;3000;3001;3002 1593;1594;1595;1596 1596 LENWITSLAESQLQTR 1 1 1 0 0 2 2 0 0 1 3 0 0 0 0 2 2 1 0 0 0 16 0 1887.969 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 2,3 1.0147E-06 164.15 1 0 7 1 0 7 2 2 1 2 2 2 1 2 2422100 1145100 1087900 0 0 0 0 0 0 0 0 0 0 0 0 66179 122920 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 281 206 282 3003;3004;3005;3006;3007;3008;3009;3010;3011;3012;3013;3014 1597 1597 LETSEELIAEVK 1 0 0 0 0 0 4 0 0 1 2 1 0 0 0 1 1 0 0 1 0 12 0 1359.7133 REV__Q96K76 REV__Q96K76 yes yes 2 0.034903 79.659 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 976020 41099 48924 0 0 0 0 0 0 36216 40372 0 0 0 0 65968 76150 47755 54778 49974 0 172570 143800 0 0 0 0 0 0 0 0 198410 0 0 0 0 + 282 141 283 3015 1598 1598 LFDWANTSR 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 1 1 1 0 0 0 9 0 1108.5302 Q5T9A4;Q9NVI7;Q5T2N8 Q5T9A4 ATAD3B;KIAA1273;ATAD3A;ATAD3C ATPase family AAA domain-containing protein 3B;ATPase family AAA domain-containing protein 3A;ATPase family AAA domain-containing protein 3C yes no 2 0.04071 60.91 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 283 67 284 3016;3017;3018;3019;3020;3021;3022 1599;1600;1601;1602;1603;1604;1605 1605 LFQPWSSLLR 0 1 0 0 0 1 0 0 0 0 3 0 0 1 1 2 0 1 0 0 0 10 0 1245.687 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 2 0.026963 85.355 1 0 7 1 0 7 1 1 2 1 1 1 1 1 2 1 1 1 856790 0 0 0 0 0 0 0 0 0 0 0 0 0 0 112330 120430 117750 95136 208890 202250 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 284 65 285 3023;3024;3025 1606;1607 1607 LFREEFNALPACPIQATCEAASK 5 1 1 0 2 1 3 0 0 1 2 1 0 2 2 1 1 0 0 0 0 23 1 2622.257 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 3 0.0011872 86.8 1 0 3 1 0 3 1 1 1 1 1 1 646000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 214230 235170 0 0 0 0 0 0 0 0 0 0 0 0 0 0 196590 0 0 0 0 285 120 286 3026;3027 1608 1608 LFSANDVENIFSR 1 1 2 1 0 0 1 0 0 1 1 0 0 2 0 2 0 0 0 1 0 13 0 1510.7416 Q07889 Q07889 SOS1 Son of sevenless homolog 1 yes yes 2 1.6148E-11 184.1 1 0 2 1 0 2 1 1 1 1 420600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 219200 201400 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 286 131 287 3028;3029;3030;3031;3032;3033;3034;3035;3036;3037;3038;3039 1609;1610;1611;1612;1613;1614;1615;1616 1610 LFVYDPNNPPSSEVLR 0 1 2 1 0 0 1 0 0 0 2 0 0 1 3 2 0 0 1 2 0 16 0 1845.9261 Q15165 Q15165 PON2 Aromatic esterase 2;Serum aryldialkylphosphatase 2;Serum paraoxonase/arylesterase 2 yes yes 2 5.0375E-07 164.2 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3075900 515510 481250 587550 633050 54502 67833 137580 116440 0 0 0 0 0 0 0 0 0 0 0 0 201970 160420 0 0 0 0 50776 68983 0 0 0 0 0 0 0 287 67 288 3040;3041;3042;3043;3044;3045 1617;1618;1619;1620;1621 1621 LGDSWLPRPIPK 0 1 0 1 0 0 0 1 0 1 2 1 0 0 3 1 0 1 0 0 0 12 1 1377.7769 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 3 0.0068926 96.015 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 1380600 0 0 0 0 0 0 0 0 0 0 0 0 98483 125410 0 127340 0 307310 374840 347240 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 288 7 289 3046;3047;3048;3049;3050;3051;3052;3053;3054;3055;3056;3057;3058;3059;3060;3061;3062;3063;3064;3065;3066;3067;3068;3069;3070;3071;3072;3073;3074;3075;3076;3077;3078;3079;3080;3081;3082;3083;3084;3085;3086;3087;3088;3089;3090;3091;3092;3093;3094;3095;3096;3097;3098;3099;3100;3101;3102;3103;3104;3105;3106;3107;3108;3109;3110;3111;3112;3113;3114;3115;3116;3117;3118;3119;3120;3121;3122;3123;3124;3125;3126;3127;3128;3129;3130;3131;3132;3133;3134;3135;3136;3137;3138;3139;3140;3141;3142;3143;3144;3145;3146;3147;3148;3149;3150;3151;3152;3153;3154;3155;3156;3157;3158;3159;3160;3161;3162;3163;3164;3165;3166;3167;3168 1622;1623;1624;1625;1626;1627;1628;1629;1630;1631;1632;1633;1634;1635;1636;1637;1638;1639;1640;1641;1642;1643;1644;1645;1646;1647;1648;1649;1650;1651;1652;1653;1654;1655;1656;1657;1658;1659;1660;1661;1662;1663;1664;1665;1666;1667;1668;1669;1670;1671;1672;1673;1674;1675;1676 1633 LGEHNIDVLEGNEQFINAAK 2 0 3 1 0 1 3 2 1 2 2 1 0 1 0 0 0 0 0 1 0 20 0 2210.0968 CON__P00761 CON__P00761 yes yes 2,3 1.4256E-40 227.04 1 0 123 1 0 123 3 3 5 6 2 2 7 6 3 5 1 2 5 4 2 2 7 5 7 4 5 4 1 6 6 1 1 5 3 2 4 4 3 3 5 6 2 2 7 6 3 5 1 2 5 4 2 2 7 5 7 4 5 4 1 6 6 1 1 5 3 2 4 4 454270000 10987000 12169000 15726000 16543000 896890 1382100 21293000 21031000 13102000 12286000 339310 765080 6722500 7328500 11288000 11675000 20060000 19583000 82989000 34119000 15733000 14209000 0 0 0 89990 26278000 26619000 208280 437930 18095000 4444700 5597600 11094000 11176000 + 289 114 290 3169;3170;3171;3172;3173;3174;3175 1677;1678;1679;1680 1677 LGIYTVLFER 0 1 0 0 0 0 1 1 0 1 2 0 0 1 0 0 1 0 1 1 0 10 0 1209.6758 Q02978 Q02978 SLC20A4;SLC25A11 Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11 yes yes 2 0.013589 91.867 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 475270 69576 84798 41962 44304 0 0 0 0 0 0 0 0 0 0 38805 0 0 0 0 0 99472 96355 0 0 0 0 0 0 0 0 0 0 0 0 0 290 178 291 3176 1681 1681 LGLQLGQGR 0 1 0 0 0 2 0 3 0 0 3 0 0 0 0 0 0 0 0 0 0 9 0 940.54541 Q9BYK8 Q9BYK8 KIAA1769;PRIC285 ATP-dependent helicase PRIC285;Peroxisomal proliferator-activated receptor A-interacting complex 285 kDa protein;PPAR-alpha-interacting complex protein 285;PPAR-gamma DNA-binding domain-interacting protein 1 yes yes 2 0.031383 63.486 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 291 135 292 3177;3178;3179;3180;3181;3182;3183 1682;1683;1684;1685;1686 1686 LGPGGLDPVEVYESLPEELQK 0 0 0 1 0 1 4 3 0 0 4 1 0 0 3 1 0 0 1 2 0 21 0 2268.1525 Q16543 Q16543 CDC37;CDC37A Hsp90 chaperone protein kinase-targeting subunit;Hsp90 co-chaperone Cdc37;p50Cdc37 yes yes 3 2.3522E-06 110.22 1 0 7 1 0 7 1 2 1 1 1 1 1 2 1 1 1 1 3507100 1055800 1367800 0 0 0 0 0 0 0 0 0 0 0 0 179520 175310 0 0 0 0 377500 351190 0 0 0 0 0 0 0 0 0 0 0 0 0 292 46 293 3184;3185;3186;3187;3188 1687;1688 1688 LHFFMPGFAPLTSR 1 1 0 0 0 0 0 1 1 0 2 0 1 3 2 1 1 0 0 0 0 14 0 1619.8283 P07437;P68371;P04350;Q13885;Q9BVA1;A6NNZ2;Q3ZCM7 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB8 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-8 chain B;Tubulin beta-8 chain no no 3 0.010656 94.767 1 0 5 NaN NaN 1 1 1 1 1 461460 215490 185740 0 16236 0 0 0 0 0 0 0 0 0 0 0 19796 0 0 0 0 0 24206 0 0 0 0 0 0 0 0 0 0 0 0 0 293 101 294 3189;3190;3191;3192;3193;3194;3195;3196;3197 1689;1690;1691;1692;1693;1694 1691 LICCDILDVLDK 0 0 0 3 2 0 0 0 0 2 3 1 0 0 0 0 0 0 0 1 0 12 0 1475.7364 P62258 P62258 YWHAE 14-3-3 protein epsilon yes yes 2 0.0024425 112.13 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 865520 78067 74304 24471 0 0 0 0 0 0 0 0 0 0 0 116910 91298 106710 100840 137770 135140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 294 203 295 3198;3199;3200;3201;3202;3203;3204;3205;3206 1695;1696 1696 LIDLDPSVDTLK 0 0 0 3 0 0 0 0 0 1 3 1 0 0 1 1 1 0 0 1 0 12 0 1327.7235 REV__Q8WXH0 REV__Q8WXH0 yes yes 2 0.03484 79.693 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 899780 38549 45310 0 0 0 0 0 0 42817 37892 0 0 0 0 63964 71747 0 0 0 0 180340 164610 0 0 0 0 0 0 0 0 254550 0 0 0 0 + 295 51 296 3207;3208;3209;3210;3211 1697;1698;1699 1699 LIFAGK 1 0 0 0 0 0 0 1 0 1 1 1 0 1 0 0 0 0 0 0 0 6 0 647.40065 P0CG48;P0CG47;P62979;P62987 P0CG48 RPS27A;UBA80;UBCEP1;UBA52;UBCEP2 40S ribosomal protein S27a;60S ribosomal protein L40;CEP52 yes no 1 0.033356 87.042 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 284450 49656 65506 56710 59417 0 0 0 0 0 0 0 0 0 0 53165 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 296 128 297 3212;3213;3214;3215;3216;3217;3218;3219;3220;3221;3222;3223;3224;3225;3226;3227 1700;1701;1702;1703;1704;1705 1702 LIGQQGLVDGLFLVR 0 1 0 1 0 2 0 3 0 1 4 0 0 1 0 0 0 0 0 2 0 15 0 1626.9457 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 2,3 0.0074636 124.3 1 0 16 1 0 16 1 1 2 1 1 1 1 1 2 2 1 1 1 1 1 2 1 1 1 1 1 2 2 1 1 1 1948200 52549 77188 0 0 0 0 287740 225050 0 0 0 0 0 0 52003 35272 86133 73785 528760 378610 0 0 0 0 0 0 74470 57034 0 0 0 0 0 19662 0 297 84 298 3228;3229;3230;3231;3232;3233;3234;3235;3236;3237;3238;3239;3240;3241;3242;3243;3244;3245;3246 1706;1707;1708;1709;1710;1711;1712;1713 1708 LINLTDILK 0 0 1 1 0 0 0 0 0 2 3 1 0 0 0 0 1 0 0 0 0 9 0 1041.6434 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 4.1493E-05 135.83 1 0 19 1 0 19 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 17454000 0 0 0 0 186010 244000 363000 359850 0 0 0 0 0 35945 70397 67318 3031600 2960400 3022400 2199400 0 0 0 0 0 0 148610 123230 0 0 0 509940 548540 1863700 1719500 298 122 299 3247;3248;3249;3250;3251 1714;1715;1716 1716 LINSSQLLYQEYSDVVLNK 0 0 2 1 0 2 1 0 0 1 4 1 0 0 0 3 0 0 2 2 0 19 0 2225.158 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2,3 2.6687E-24 202.03 1 0 5 1 0 5 2 2 1 2 2 1 2514700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1317900 979920 0 0 0 0 0 0 0 0 0 0 0 0 0 0 216840 0 0 0 0 299 186 300 3252;3253;3254;3255;3256;3257;3258;3259;3260;3261;3262 1717 1717 LIPLGHASK 1 0 0 0 0 0 0 1 1 1 2 1 0 0 1 1 0 0 0 0 0 9 0 934.56 Q9UJM3 Q9UJM3 ERRFI1;MIG6 ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein yes yes 2 0.0096498 97.798 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1406300 81355 62996 115080 110830 0 0 0 0 0 0 0 0 152760 195890 0 334510 0 0 0 0 42685 0 70873 0 0 0 0 0 0 95787 143490 0 0 0 0 300 27 301 3263 1718 1718 LKETVYNLR 0 1 1 0 0 0 1 0 0 0 2 1 0 0 0 0 1 0 1 1 0 9 1 1134.6397 O00461 O00461 GIMPC;GOLIM4;GOLPH4;GPP130 Golgi integral membrane protein 4;Golgi integral membrane protein, cis;Golgi phosphoprotein 4;Golgi-localized phosphoprotein of 130 kDa yes yes 2 0.036292 67.563 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 301 16 302 3264;3265;3266;3267;3268;3269 1719;1720;1721 1721 LKYENEVALR 1 1 1 0 0 0 2 0 0 0 2 1 0 0 0 0 0 0 1 1 0 10 1 1233.6717 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 0.03234 82.417 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 387900 0 0 31072 0 49739 0 0 0 0 0 0 0 0 0 0 0 0 97025 0 0 54832 55085 0 0 0 0 0 0 0 0 100150 0 0 0 0 + 302 116 303 3270;3271;3272 1722;1723 1722 LLAEALNQVTQR 2 1 1 0 0 2 1 0 0 0 3 0 0 0 0 0 1 0 0 1 0 12 0 1354.7569 Q05655 Q05655 PRKCD nPKC-delta;Protein kinase C delta type yes yes 2 8.5873E-07 166.14 1 0 3 1 0 3 1 1 1 1 1 1 280230 0 0 0 0 0 0 0 0 0 0 0 0 125650 126140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 28443 0 0 0 0 0 303 91 304 3273;3274;3275;3276;3277;3278;3279;3280;3281;3282;3283;3284;3285;3286;3287;3288;3289;3290;3291;3292;3293;3294;3295 1724;1725;1726;1727;1728;1729;1730;1731 1724 LLDAVDTYIPVPAR 2 1 0 2 0 0 0 0 0 1 2 0 0 0 2 0 1 0 1 2 0 14 0 1541.8453 P49411 P49411 TUFM Elongation factor Tu, mitochondrial;P43 yes yes 2 0.011442 94.122 1 0 23 1 0 23 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 5060100 749110 817090 615870 569620 69932 76962 158830 185690 0 0 0 0 57051 86264 136080 136030 43212 39148 46455 0 451130 375010 0 0 0 0 107160 196200 0 0 70856 0 0 44909 27500 304 0 305;306;307 3296;3297;3298;3299;3300;3301;3302;3303;3304;3305;3306;3307;3308;3309;3310;3311;3312;3313;3314;3315;3316;3317;3318;3319;3320;3321;3322 1732;1733;1734 1734 LLEEMEKISVQATWMAYDMVVMR 2 1 0 1 0 1 3 0 0 1 2 1 4 0 0 1 1 1 1 3 0 23 1 2772.3359 A1L190 A1L190 C22orf41;THEG2 Testis highly expressed gene 2 protein;Uncharacterized protein C22orf41 yes yes 3,4 0.049695 14.548 1 0 27 1 0 27 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 2 23416000 1630500 1453900 1676700 1602900 0 56134 263580 252890 0 0 0 0 280270 137880 1832000 0 3007800 0 0 60488 2011800 2007400 0 0 0 0 678760 416690 0 0 3494800 185800 253880 1133900 978100 305 63 308 3323;3324;3325;3326 1735;1736 1735 LLELQEVDSLLR 0 1 0 1 0 1 2 0 0 0 5 0 0 0 0 1 0 0 0 1 0 12 0 1426.8031 P16144 P16144 ITGB4 GP150;Integrin beta-4 yes yes 2 0.0023103 116.01 1 0 4 1 0 4 1 1 1 1 1 1 1 1 266940 106990 94008 0 0 0 0 0 0 0 0 0 0 0 0 21479 0 0 0 0 0 44461 0 0 0 0 0 0 0 0 0 0 0 0 0 0 306 163 309 3327;3328;3329;3330 1737 1737 LLEPFEVR 0 1 0 0 0 0 2 0 0 0 2 0 0 1 1 0 0 0 0 1 0 8 0 1001.5546 Q8WUY1 Q8WUY1 C8orf55;PSEC0098 Mesenchymal stem cell protein DSCD75;UPF0670 protein C8orf55 yes yes 2 0.11451 80.18 1 0 4 1 0 4 1 1 1 1 1 1 1 1 210750 49180 49668 54381 57520 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 307 100 310 3331 1738 1738 LLEPVLLLGK 0 0 0 0 0 0 1 1 0 0 5 1 0 0 1 0 0 0 0 1 0 10 0 1093.7111 P62249 P62249 RPS16 40S ribosomal protein S16 yes yes 2 4.5264E-07 90.629 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 308 36 311 3332;3333;3334;3335;3336;3337;3338;3339;3340;3341 1739;1740;1741;1742 1739 LLESLDQLELR 0 1 0 1 0 1 2 0 0 0 5 0 0 0 0 1 0 0 0 0 0 11 0 1327.7347 O95816 O95816 BAG2 BAG family molecular chaperone regulator 2;Bcl-2-associated athanogene 2 yes yes 2 1.1683E-06 125.74 1 0 10 1 0 10 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1585900 216990 552080 146860 124300 0 0 0 25387 0 0 0 0 0 0 0 0 0 0 0 0 250380 200720 0 0 0 0 30385 38784 0 0 0 0 0 0 0 309 82 312 3342;3343;3344;3345 1743;1744;1745;1746 1743 LLGPGVNYSGCQITWAK 1 0 1 0 1 1 0 3 0 1 2 1 0 0 1 1 1 1 1 1 0 17 0 1862.9349 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 2 0.00079952 115.82 1 0 4 1 0 4 1 1 1 1 1 1 1 1 666080 241800 199330 119450 105500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 310 83 313 3346;3347;3348;3349;3350;3351 1747;1748;1749 1747 LLGPNASPDGLIPWTR 1 1 1 1 0 0 0 2 0 1 3 0 0 0 3 1 1 1 0 0 0 16 0 1705.9152 P42224 P42224 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84 yes yes 2 8.2113E-08 167.89 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 655260 209060 230900 80522 54976 0 0 0 0 0 0 0 0 0 0 47048 32747 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 311 131 314 3352;3353;3354;3355;3356;3357;3358;3359;3360;3361;3362;3363;3364 1750;1751;1752;1753;1754;1755;1756;1757;1758;1759;1760 1756 LLIGTLYHR 0 1 0 0 0 0 0 1 1 1 3 0 0 0 0 0 1 0 1 0 0 9 0 1084.6393 Q15165 Q15165 PON2 Aromatic esterase 2;Serum aryldialkylphosphatase 2;Serum paraoxonase/arylesterase 2 yes yes 2 2.0484E-05 141.39 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3179500 552370 526750 624810 637940 84011 108420 105940 139960 0 0 0 0 0 0 0 0 0 0 0 0 151030 156730 0 0 0 0 47874 43707 0 0 0 0 0 0 0 312 99 315 3365;3366;3367;3368;3369;3370 1761;1762 1761 LLIHQSLAGGIIGVK 1 0 0 0 0 1 0 3 1 3 3 1 0 0 0 1 0 0 0 1 0 15 0 1517.9293 P61978 P61978 HNRNPK;HNRPK Heterogeneous nuclear ribonucleoprotein K;Transformation up-regulated nuclear protein yes yes 3 0.0089735 101.32 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 395650 0 27353 0 0 0 0 0 0 0 0 0 0 0 0 114320 109150 0 0 53753 38404 0 0 0 0 0 0 0 0 0 0 52671 0 0 0 0 313 20 316 3371;3372;3373;3374 1763 1763 LLIWQISNR 0 1 1 0 0 1 0 0 0 2 2 0 0 0 0 1 0 1 0 0 0 9 0 1141.6608 CON__Q05B55 CON__Q05B55 yes yes 2 0.081588 75.38 1 0 4 1 0 4 1 1 1 1 1 1 1 1 232530 0 112050 0 0 0 28613 58140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 33726 0 0 0 0 0 0 0 0 0 0 0 0 0 + 314 175 317 3375;3376;3377;3378;3379;3380 1764;1765;1766;1767;1768 1764 LLLGAGAVAYGVR 3 1 0 0 0 0 0 3 0 0 3 0 0 0 0 0 0 0 1 2 0 13 0 1258.7398 Q99623 Q99623 BAP;PHB2;REA B-cell receptor-associated protein BAP37;D-prohibitin;Prohibitin-2;Repressor of estrogen receptor activity yes yes 2 0.0044979 128.01 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 413550 99174 105330 73438 83809 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 24762 27032 0 0 0 0 0 0 0 0 0 0 0 0 0 315 4 318 3381;3382;3383;3384 1769 1769 LLLLGAGESGK 1 0 0 0 0 0 1 3 0 0 4 1 0 0 0 1 0 0 0 0 0 11 0 1056.6179 Q5JWF2;P63092;P38405;P04899;A8MTJ3;P08754;P09471;P19087;P63096;P11488 Q5JWF2 GNAS;GNAS1;GNAS;GNAS1;GSP;GNAL;GNAI2;GNAI2B;GNAT3;GNAI3;GNAO1;GNAT2;GNATC;GNAI1;GNAT1;GNATR Adenylate cyclase-stimulating G alpha protein;Extra large alphas protein;Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas;Guanine nucleotide-binding protein G(s) subunit alpha isoforms short;Adenylate cyclase-stimulating G alpha protein, olfactory type;Guanine nucleotide-binding protein G(olf) subunit alpha;Adenylate cyclase-inhibiting G alpha protein;Guanine nucleotide-binding protein G(i) subunit alpha-2;Guanine nucleotide-binding protein G(t) subunit alpha-3;Gustducin alpha-3 chain;G(i) alpha-3;Guanine nucleotide-binding protein G(k) subunit alpha;Guanine nucleotide-binding protein G(o) subunit alpha;Guanine nucleotide-binding protein G(t) subunit alpha-2;Transducin alpha-2 chain;Guanine nucleotide-binding protein G(i) subunit alpha-1;Guanine nucleotide-binding protein G(t) subunit alpha-1;Transducin alpha-1 chain yes no 2 0.0061243 98.048 1 0 4 1 0 4 1 1 1 1 1 1 1 1 186280 0 56368 48370 56002 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 25541 0 0 0 0 0 0 0 0 0 0 0 0 0 0 316 122 319 3385;3386;3387;3388;3389 1770;1771;1772 1772 LLLQNILK 0 0 1 0 0 1 0 0 0 1 4 1 0 0 0 0 0 0 0 0 0 8 0 953.62735 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 1.655E-167 150.84 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 503380 0 0 0 0 0 0 0 0 0 0 0 0 104820 102620 0 222940 0 0 0 0 0 0 0 0 0 0 0 0 0 0 73012 0 0 0 0 317 43;58 320 3390;3391;3392;3393;3394;3395;3396;3397;3398;3399;3400 1773;1774;1775;1776;1777;1778;1779 1776 LLLQVQHASK 1 0 0 0 0 2 0 0 1 0 3 1 0 0 0 1 0 0 0 1 0 10 0 1135.6713 P05141;P12235;P12236 P05141 ANT2;SLC25A5;ANT1;SLC25A4;ANT3;CDABP0051;SLC25A6 Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6 no no 2 0.0029597 107.15 1 0 11 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 918630 147720 112760 136470 185180 0 34480 0 0 0 0 0 0 0 32789 45321 0 0 0 0 0 52171 49458 52570 69702 0 0 0 0 0 0 0 0 0 0 0 318 55;64 321 3401;3402;3403;3404;3405;3406;3407;3408;3409 1780;1781;1782;1783;1784 1784 LLQDFFNGK 0 0 1 1 0 1 0 1 0 0 2 1 0 2 0 0 0 0 0 0 0 9 0 1080.5604 P11142;P54652;P17066 P11142 HSC70;HSP73;HSPA10;HSPA8;HSPA2;HSP70B;HSPA6 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B no no 2 0.0010074 124.23 1 0 9 NaN NaN 1 1 1 1 1 1 1 1 1 790470 168610 183680 91723 103330 59051 50352 0 0 0 0 0 0 0 0 0 0 0 0 0 0 59517 60046 0 0 0 0 0 0 0 0 0 0 0 0 14157 319 26 322 3410;3411;3412;3413;3414;3415;3416;3417;3418;3419;3420;3421;3422;3423;3424;3425;3426;3427;3428;3429;3430;3431;3432;3433;3434;3435;3436;3437;3438;3439;3440;3441;3442;3443 1785;1786;1787;1788;1789;1790;1791;1792;1793;1794;1795;1796;1797;1798 1787 LLQEHLEEQEVAPPALPPKPPK 2 0 0 0 0 2 4 0 1 0 4 2 0 0 6 0 0 0 0 1 0 22 1 2459.3424 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3,4 2.2378E-07 127.59 1 0 34 1 0 34 6 5 5 5 2 2 4 5 6 5 5 5 2 2 4 5 6763700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1049200 1064700 1213700 1266900 0 0 0 0 0 0 0 0 0 0 0 268430 310180 786260 804240 320 82 323 3444;3445;3446;3447;3448 1799;1800;1801;1802 1799 LLQTAATAAQQGGQANHPTAAVVTEK 7 0 1 0 0 4 1 2 1 0 2 1 0 0 1 0 4 0 0 2 0 26 0 2575.3354 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 3 9.9688E-11 121.46 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1705800 611060 552260 228640 242720 0 0 0 0 0 0 0 0 0 0 0 71149 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 321 40 324 3449;3450;3451;3452;3453;3454;3455;3456;3457;3458;3459;3460;3461;3462;3463;3464;3465;3466;3467;3468;3469;3470;3471;3472;3473;3474;3475;3476;3477;3478;3479;3480;3481;3482;3483;3484;3485;3486;3487;3488;3489 1803;1804;1805;1806;1807;1808;1809;1810;1811;1812;1813;1814;1815 1813 LLRDYQELMNTK 0 1 1 1 0 1 1 0 0 0 3 1 1 0 0 0 1 0 1 0 0 12 1 1522.7814 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 no no 2,3 0.0038813 106.67 1 0 41 NaN NaN 1 2 1 2 2 1 1 2 2 1 2 2 2 2 2 2 2 2 2 2 1 1 2 2 3410200 0 26097 92033 54561 123450 109210 29672 41040 101190 117510 49413 108740 114250 150010 160390 140340 135960 149070 0 0 189040 267810 0 0 0 0 0 0 0 0 443860 44522 37807 339410 384810 + 322 40 325 3490;3491;3492;3493;3494;3495;3496;3497;3498;3499;3500 1816;1817;1818;1819 1818 LNDLEDALQQAKEDLAR 3 1 1 3 0 2 2 0 0 0 4 1 0 0 0 0 0 0 0 0 0 17 1 1940.9803 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 3 0.00088448 111.12 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1553100 0 36633 0 0 0 0 0 0 65661 82857 0 0 0 0 149270 190960 0 33446 85826 56832 264660 254290 0 0 0 0 0 0 0 0 332670 0 0 0 0 + 323 87 326 3501;3502;3503;3504;3505;3506 1820 1820 LNLVEAFVEDAELR 2 1 1 1 0 0 3 0 0 0 3 0 0 1 0 0 0 0 0 2 0 14 0 1616.841 P43246 P43246 MSH2 DNA mismatch repair protein Msh2;MutS protein homolog 2 yes yes 3 0.0067867 131.17 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 328440 76663 90966 0 0 0 0 0 0 0 0 0 0 30521 0 0 0 39555 0 28347 0 0 62391 0 0 0 0 0 0 0 0 0 0 0 0 0 324 122 327 3507;3508 1821 1821 LNTRPVHLHLFNDCLLLSR 0 2 2 1 1 0 0 0 2 0 6 0 0 1 1 1 1 0 0 1 0 19 1 2317.2477 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 4 0.040173 69.729 1 0 2 1 0 2 1 1 1 1 269220 0 0 0 0 0 0 0 0 0 0 0 0 0 0 138670 130540 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 325 167 328 3509;3510;3511 1822;1823 1822 LNVWLGIK 0 0 1 0 0 0 0 1 0 1 2 1 0 0 0 0 0 1 0 1 0 8 0 941.56984 Q92569 Q92569 PIK3R3 p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma yes yes 2 0.040156 71.342 1 0 3 1 0 3 1 1 1 1 1 1 146280 0 0 0 0 74906 71375 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 326 158 329 3512;3513;3514 1824;1825 1825 LPADTCLLEFAR 2 1 0 1 1 0 1 0 0 0 3 0 0 1 1 0 1 0 0 0 0 12 0 1404.7071 Q8NF37 Q8NF37 AYTL2;LPCAT1;PFAAP3 1-acylglycerophosphocholine O-acyltransferase;1-alkylglycerophosphocholine O-acetyltransferase;Acetyl-CoA:lyso-platelet-activating factor acetyltransferase;Acyltransferase-like 2;Lysophosphatidylcholine acyltransferase 1;Phosphonoformate immuno-associated protein 3 yes yes 2 0.0020349 124.1 1 0 3 1 0 3 1 1 1 1 1 1 404110 0 0 183300 189890 0 0 0 30924 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 327 38;41 330 3515 1826 1826 LPQPPICTIDVYMIMVK 0 0 0 1 1 1 0 0 0 3 1 1 2 0 3 0 1 0 1 2 0 17 0 2017.045 P00533;P04626 P00533 EGFR;ERBB1;ERBB2;HER2;MLN19;NEU;NGL Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1;Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2 no no 3 0.00045462 65.092 1 0 1 NaN NaN 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 328 86 331 3516;3517;3518;3519;3520 1827;1828 1827 LQDAINILK 1 0 1 1 0 1 0 0 0 2 2 1 0 0 0 0 0 0 0 0 0 9 0 1026.6073 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2 0.0018321 119.75 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 372220 118020 119650 59437 45095 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 30026 0 0 0 0 0 0 0 0 0 0 0 0 0 0 329 86 332 3521;3522;3523;3524 1829;1830 1830 LQWFCDR 0 1 0 1 1 1 0 0 0 0 1 0 0 1 0 0 0 1 0 0 0 7 0 1023.4596 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2 0.091719 80.18 1 0 4 1 0 4 1 1 1 1 1 1 1 1 264520 68824 56994 66018 72684 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 330 26 333 3525;3526;3527;3528;3529;3530;3531;3532;3533;3534;3535;3536;3537;3538;3539;3540;3541 1831;1832;1833;1834;1835;1836;1837;1838;1839;1840 1839 LRDTPDGTFLVR 0 2 0 2 0 0 0 1 0 0 2 0 0 1 1 0 2 0 0 1 0 12 1 1388.7412 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 0.0073306 94.465 1 0 17 1 0 17 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 6837400 0 0 0 0 0 0 0 15682 0 0 0 0 0 0 0 0 869940 786580 1460300 1470900 0 0 0 0 0 0 0 0 0 0 0 408330 387230 743560 694850 331 149 334 3542;3543 1841 1841 LSGWGNVSK 0 0 1 0 0 0 0 2 0 0 1 1 0 0 0 2 0 1 0 1 0 9 0 946.48723 Q6Y7W6 Q6Y7W6 GIGYF2;KIAA0642;PERQ2;TNRC15 GRB10-interacting GYF protein 2;PERQ amino acid-rich with GYF domain-containing protein 2;Trinucleotide repeat-containing gene 15 protein yes yes 2 0.054113 80.438 1 0 2 1 0 2 1 1 1 1 177300 0 0 85359 91942 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 332 92 335 3544;3545;3546;3547 1842 1842 LSHAVGCAFAACLER 4 1 0 0 2 0 1 1 1 0 2 0 0 1 0 1 0 0 0 1 0 15 0 1660.7814 P49757;Q9Y6R0 P49757 NUMB;NUMBL Protein numb homolog;Protein S171;Numb-like protein;Numb-related protein yes no 3 0.0089691 100.38 1 0 4 1 0 4 1 1 1 1 1 1 1 1 203940 39219 0 0 0 0 0 0 0 0 0 0 0 0 31970 64810 67937 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 333 80 336 3548;3549;3550;3551 1843;1844;1845 1843 LSLEEFIR 0 1 0 0 0 0 2 0 0 1 2 0 0 1 0 1 0 0 0 0 0 8 0 1005.5495 P37235;P61601;P84074 P37235 BDR1;HPCAL1;NCALD;BDR2;HPCA Calcium-binding protein BDR-1;Hippocalcin-like protein 1;HLP2;Visinin-like protein 3;Neurocalcin-delta;Calcium-binding protein BDR-2;Neuron-specific calcium-binding protein hippocalcin yes no 2 0.020557 109.86 1 0 4 1 0 4 1 1 1 1 1 1 1 1 173320 44810 52013 36886 39606 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 334 139 337 3552;3553;3554;3555;3556;3557;3558 1846;1847 1846 LSLFPASPR 1 1 0 0 0 0 0 0 0 0 2 0 0 1 2 2 0 0 0 0 0 9 0 986.55492 Q53GA4 Q53GA4 BWR1C;HLDA2;IPL;PHLDA2;TSSC3 Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein;Imprinted in placenta and liver protein;p17-Beckwith-Wiedemann region 1 C;Pleckstrin homology-like domain family A member 2;Tumor-suppressing STF cDNA 3 protein;Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein yes yes 2 0.011637 94.302 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 493530 0 48849 56537 49486 96737 75300 73938 92679 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 335 94 338 3559;3560 1848;1849 1849 LSLHSIAQNK 1 0 1 0 0 1 0 0 1 1 2 1 0 0 0 2 0 0 0 0 0 10 0 1109.6193 P52735 P52735 VAV2 Guanine nucleotide exchange factor VAV2 yes yes 2 7.6681E-07 89.08 1 0 2 1 0 2 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 336 142 339 3561;3562;3563;3564;3565 1850 1850 LSSLPR 0 1 0 0 0 0 0 0 0 0 2 0 0 0 1 2 0 0 0 0 0 6 0 671.39662 Q63ZY3 Q63ZY3 ANKRD25;KANK2;KIAA1518;MXRA3;SIP Ankyrin repeat domain-containing protein 25;KN motif and ankyrin repeat domain-containing protein 2;Matrix-remodeling-associated protein 3;SRC-1-interacting protein yes yes 1 0.047624 74.417 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 918800 0 0 0 0 0 0 0 0 0 0 0 0 0 208320 0 0 0 101970 0 0 0 305430 0 0 142360 0 0 0 160720 0 0 0 0 0 0 337 7 340 3566;3567;3568;3569;3570;3571;3572;3573;3574;3575;3576;3577;3578;3579;3580;3581;3582;3583;3584;3585;3586;3587;3588;3589;3590;3591;3592;3593;3594;3595;3596;3597 1851;1852;1853;1854;1855;1856;1857;1858;1859;1860;1861;1862;1863;1864;1865;1866;1867;1868;1869;1870;1871 1868 LSSPATLNSR 1 1 1 0 0 0 0 0 0 0 2 0 0 0 1 3 1 0 0 0 0 10 0 1044.5564 CON__P00761 CON__P00761 yes yes 2 0.00013351 127.4 1 0 32 1 0 32 2 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 2 2 2 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 2 2 45480000 2517200 2450100 1352600 1474200 1725400 1459200 3140700 1655100 0 1266200 0 0 1186000 1245300 807540 811640 1472600 1578400 1950500 3466700 2805200 0 1049000 0 0 0 1596400 0 0 1150700 1451400 1261900 0 3294000 3312300 + 338 66 341 3598;3599;3600;3601;3602;3603;3604;3605;3606;3607;3608;3609;3610;3611;3612;3613;3614;3615;3616;3617;3618;3619 1872;1873;1874;1875;1876;1877;1878;1879;1880;1881;1882;1883;1884 1875 LTFQLEPNPHTK 0 0 1 0 0 1 1 0 1 0 2 1 0 1 2 0 2 0 0 0 0 12 0 1423.746 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2,3 0.002392 113.61 1 0 22 1 0 22 2 2 2 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 2 2 2 1 2 1 1 1 3936000 0 0 0 0 556590 495390 743520 754500 0 0 0 0 0 0 0 0 112560 138800 206460 191770 0 0 0 0 0 83178 443000 109490 0 0 0 0 40616 60084 0 339 49 342 3620;3621;3622 1885 1885 LTICGWDFGFR 0 1 0 1 1 0 0 2 0 1 1 0 0 2 0 0 1 1 0 0 0 11 0 1370.6441 P08581 P08581 MET Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met yes yes 2 0.027542 82.261 1 0 3 1 0 3 1 1 1 1 1 1 187970 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 78971 55730 0 0 0 0 0 0 0 0 53272 0 0 0 0 340 146 343 3623 1886 1886 LTKPQPFKDFLCISLR 0 1 0 1 1 1 0 0 0 1 3 2 0 2 2 1 1 0 0 0 0 16 2 1962.0761 Q6PIJ6 Q6PIJ6 FBXO38;SP329 F-box only protein 38;Modulator of KLF7 activity homolog yes yes 3 0.02686 51.546 1 0 1 1 0 1 1 1 37538 0 37538 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 341 38 344 3624;3625;3626;3627;3628;3629;3630;3631;3632;3633;3634;3635;3636;3637;3638;3639;3640;3641;3642;3643;3644;3645;3646;3647;3648;3649;3650;3651;3652;3653;3654;3655;3656;3657;3658;3659;3660;3661;3662;3663;3664;3665;3666;3667;3668;3669;3670;3671;3672;3673;3674;3675;3676;3677;3678;3679;3680;3681;3682;3683;3684;3685;3686;3687;3688;3689;3690;3691;3692;3693;3694;3695;3696;3697;3698;3699;3700;3701;3702;3703;3704;3705;3706;3707;3708;3709;3710;3711;3712;3713;3714;3715;3716;3717;3718;3719;3720 1887;1888;1889;1890;1891;1892;1893;1894;1895;1896;1897;1898;1899;1900;1901;1902;1903;1904;1905;1906;1907;1908;1909;1910;1911;1912;1913;1914;1915;1916;1917;1918;1919;1920;1921;1922;1923;1924;1925;1926;1927;1928;1929;1930;1931;1932;1933;1934;1935;1936;1937;1938;1939;1940 1892 LTQLGTFEDHFLSLQR 0 1 0 1 0 2 1 1 1 0 4 0 0 2 0 1 2 0 0 0 0 16 0 1903.9792 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 9.0897E-41 248.23 1 0 97 1 0 97 11 9 10 11 1 2 2 3 8 9 2 3 2 1 10 7 1 1 1 3 11 9 10 11 1 2 2 3 8 9 2 3 2 1 10 7 1 1 1 3 333120000 88423000 8952400 23575000 23813000 0 0 386020 410130 0 0 0 0 557670 634790 37202000 36058000 802490 741430 316570 148400 52806000 49515000 0 0 0 0 319810 322320 0 61071 8077700 0 0 0 0 342 10 345 3721;3722 1941;1942 1942 LVAASQAALGL 4 0 0 0 0 1 0 1 0 0 3 0 0 0 0 1 0 0 0 1 0 11 0 1012.5917 CON__P02768-1;P02768 CON__P02768-1 ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341;ALB;GIG20;GIG42;PRO0903;PRO1708;PRO2044;PRO2619;PRO2675;UNQ696/PRO1341 Serum albumin yes no 2 0.026326 83 1 0 2 1 0 2 1 1 1 1 160000 0 0 0 0 0 0 0 0 0 0 83858 76138 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 343 132 346 3723;3724;3725;3726;3727;3728;3729;3730;3731;3732;3733 1943 1943 LVALLNTLDR 1 1 1 1 0 0 0 0 0 0 4 0 0 0 0 0 1 0 0 1 0 10 0 1126.671 Q15257 Q15257 PPP2R4;PTPA Phosphotyrosyl phosphatase activator;PP2A, subunit B, PR53 isoform;Serine/threonine-protein phosphatase 2A activator;Serine/threonine-protein phosphatase 2A regulatory subunit 4;Serine/threonine-protein phosphatase 2A regulatory subunit B yes yes 2 0.0099291 93.649 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2143700 515440 476250 262630 286250 0 0 0 0 0 0 0 0 0 44232 111230 101900 0 0 0 0 155280 138780 27675 24069 0 0 0 0 0 0 0 0 0 0 0 344 169 347 3734;3735;3736;3737;3738;3739 1944;1945;1946;1947;1948 1944 LVDYLEGIR 0 1 0 1 0 0 1 1 0 1 2 0 0 0 0 0 0 0 1 1 0 9 0 1076.5866 Q96BR5 Q96BR5 C1orf163 Hcp beta-lactamase-like protein C1orf163 yes yes 2 4.7669E-12 147.51 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 388230 102730 98443 66559 72841 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 47664 0 0 0 0 0 0 0 0 0 0 0 0 0 0 345 35 348 3740;3741;3742;3743;3744;3745;3746;3747;3748;3749;3750 1949;1950;1951;1952 1951 LVECLETVLNK 0 0 1 0 1 0 2 0 0 0 3 1 0 0 0 0 1 0 0 2 0 11 0 1316.701 O95782 O95782 ADTAA;AP2A1;CLAPA1 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit yes yes 2 6.0904E-05 155.11 1 0 11 1 0 11 1 1 1 2 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 989000 117620 171790 73290 123660 0 0 0 0 0 0 0 0 105320 113790 110870 93691 0 0 0 0 0 38993 0 0 0 0 0 0 0 0 39970 0 0 0 0 346 11 349 3751;3752;3753;3754;3755;3756 1953 1953 LVNELTEFAK 1 0 1 0 0 0 2 0 0 0 2 1 0 1 0 0 1 0 0 1 0 10 0 1162.6234 CON__P02769 CON__P02769 yes yes 2 0.044667 76.943 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 285340 0 0 0 0 0 0 0 0 0 0 32103 0 0 0 0 0 38513 36646 0 0 0 26563 0 0 0 0 0 0 0 0 0 0 0 88146 63365 + 347 52 350 3757;3758;3759;3760;3761;3762 1954;1955 1954 LVNHFVEEFK 0 0 1 0 0 0 2 0 1 0 1 1 0 2 0 0 0 0 0 2 0 10 0 1260.6503 P0DMV8;P0DMV9 P0DMV8 yes no 2 0.00094982 112.36 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 518310 137190 118020 98628 68421 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 43066 52985 0 0 0 0 0 0 0 0 0 0 0 0 0 348 52 351 3763;3764;3765;3766;3767;3768;3769;3770 1956;1957 1957 LVNHFVEEFKR 0 1 1 0 0 0 2 0 1 0 1 1 0 2 0 0 0 0 0 2 0 11 1 1416.7514 P0DMV8;P0DMV9 P0DMV8 yes no 3 0.021992 94.297 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 703840 207790 204140 66259 89989 0 0 0 0 0 0 0 0 0 0 15207 23734 0 0 0 0 48978 47745 0 0 0 0 0 0 0 0 0 0 0 0 0 349 118 352 3771;3772;3773;3774;3775;3776;3777;3778;3779 1958;1959;1960;1961;1962;1963;1964 1959 LVQAFQFTDK 1 0 0 1 0 2 0 0 0 0 1 1 0 2 0 0 1 0 0 1 0 10 0 1195.6237 Q06830 Q06830 PAGA;PAGB;PRDX1;TDPX2 Natural killer cell-enhancing factor A;Peroxiredoxin-1;Proliferation-associated gene protein;Thioredoxin peroxidase 2;Thioredoxin-dependent peroxide reductase 2 yes yes 2 2.1021E-05 136.63 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 930540 184660 196230 117330 107620 36904 0 0 0 0 0 0 0 39337 55947 71561 120960 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 350 61 353 3780;3781;3782;3783;3784;3785 1965 1965 LVQNCLWTLR 0 1 1 0 1 1 0 0 0 0 3 0 0 0 0 0 1 1 0 1 0 10 0 1301.6914 P14923;P35222 P14923 CTNNG;DP3;JUP;CTNNB;CTNNB1;OK/SW-cl.35;PRO2286 Catenin gamma;Desmoplakin III;Desmoplakin-3;Junction plakoglobin;Beta-catenin;Catenin beta-1 yes no 2 0.13925 65.347 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 213080 59306 56139 0 0 0 0 0 0 0 0 0 0 0 0 0 0 22607 19907 0 0 31915 0 0 0 0 0 0 0 0 0 0 0 0 23210 0 351 200 354 3786;3787;3788;3789;3790;3791;3792;3793;3794;3795;3796;3797;3798;3799;3800;3801;3802;3803;3804;3805;3806;3807;3808;3809;3810;3811;3812;3813;3814;3815;3816;3817;3818;3819;3820;3821 1966;1967;1968;1969;1970;1971;1972;1973;1974 1966 LWDNGTISNPELLR 0 1 2 1 0 0 1 1 0 1 3 0 0 0 1 1 1 1 0 0 0 14 0 1626.8366 REV__Q8IV45 REV__Q8IV45 yes yes 3 0.0078122 127.17 1 0 36 1 0 36 3 3 2 3 1 2 2 2 3 1 1 2 2 3 3 1 2 3 3 2 3 1 2 2 2 3 1 1 2 2 3 3 1 2 50007000 11779000 11040000 2630400 2839000 0 0 0 59273 0 0 0 0 68256 343490 3634000 2842000 123890 111850 492690 332900 7065200 6112300 0 0 0 0 0 56714 0 0 475200 0 0 0 0 + 352 152 355 3822 1975 1975 LWQYLLSR 0 1 0 0 0 1 0 0 0 0 3 0 0 0 0 1 0 1 1 0 0 8 0 1077.5971 Q86VU5 Q86VU5 COMTD1;UNQ766/PRO1558 Catechol O-methyltransferase domain-containing protein 1 yes yes 2 7.591E-06 94.302 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 353 179 356;357 3823;3824;3825;3826;3827;3828;3829;3830;3831;3832;3833;3834;3835;3836;3837;3838;3839;3840;3841;3842;3843;3844;3845;3846;3847;3848;3849;3850;3851;3852;3853;3854;3855;3856;3857;3858;3859;3860;3861;3862;3863;3864;3865;3866;3867 1976;1977;1978;1979 1978 MAATLLMAGSQAPVTFEDMAMYLTR 5 1 0 1 0 1 1 1 0 0 3 0 4 1 1 1 3 0 1 1 0 25 0 2718.2889 Q9C0F3 Q9C0F3 KIAA1710;ZNF436 Zinc finger protein 436 yes yes 4 0.049374 14.944 1 0 45 1 0 45 3 1 3 2 4 4 1 1 1 1 1 1 1 2 3 1 2 4 4 3 2 3 1 3 2 4 4 1 1 1 1 1 1 1 2 3 1 2 4 4 3 2 13253000 346430 224520 1276500 1686800 0 0 907320 962550 101080 50301 0 0 154820 304320 168560 99873 145850 0 355100 522060 98492 396310 0 0 0 0 1751300 1178900 0 0 0 0 0 1278800 1243100 354 143 358 3868;3869;3870;3871;3872 1980 1980 MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMR 7 2 0 1 0 1 2 4 1 0 1 0 2 1 7 1 2 0 1 1 0 34 1 3446.65 Q69YG0 Q69YG0 TMEM42 Transmembrane protein 42 yes yes 4 0.090116 13.39 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1814100 0 0 0 0 0 0 0 0 385000 302170 0 0 0 0 0 0 0 0 542760 410360 0 0 0 0 0 0 0 0 0 0 173840 0 0 0 0 355 34 359 3873 1981 1981 MCGIFAYMNYRVPR 1 2 1 0 1 0 0 1 0 1 0 0 2 1 1 0 0 0 2 1 0 14 1 1776.8262 O94808 O94808 GFPT2 D-fructose-6-phosphate amidotransferase 2;Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2;Glutamine:fructose 6 phosphate amidotransferase 2;Hexosephosphate aminotransferase 2 yes yes 2 0.059488 26.627 1 0 1 1 0 1 1 1 3287700 0 3287700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 356 115 360 3874 1982 1982 MDQMMPGK 0 0 0 1 0 1 0 1 0 0 0 1 3 0 1 0 0 0 0 0 0 8 0 936.38673 Q03989 Q03989 ARID5A;MRF1 AT-rich interactive domain-containing protein 5A;Modulator recognition factor 1 yes yes 2 0.089489 9.2141 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 357 160 361 3875 1983 1983 MEAAAVTVTR 3 1 0 0 0 0 1 0 0 0 0 0 1 0 0 0 2 0 0 2 0 10 0 1047.5383 Q8NFI3 Q8NFI3 ENGASE Cytosolic endo-beta-N-acetylglucosaminidase yes yes 2 0.054741 45.161 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 358 72 362 3876;3877 1984;1985 1985 8;9 MGCKVLLNIGQQMLRR 0 2 1 0 1 2 0 2 0 1 3 1 2 0 0 0 0 0 0 1 0 16 2 1916.027 P30825 P30825 ATRC1;ERR;REC1L;SLC7A1 Ecotropic retroviral leukemia receptor homolog;Ecotropic retrovirus receptor homolog;High affinity cationic amino acid transporter 1;Solute carrier family 7 member 1;System Y+ basic amino acid transporter yes yes 3 0.031137 23.831 1 0 2 1 0 2 1 1 1 1 605950 0 0 0 527120 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 78830 0 0 0 0 0 0 0 0 0 0 0 0 0 359 185 363 3878 1986 1986 MGCTPTMR 0 1 0 0 1 0 0 1 0 0 0 0 2 0 1 0 2 0 0 0 0 8 0 952.39288 Q9NU02 Q9NU02 ANKRD5 Ankyrin repeat domain-containing protein 5 yes yes 2 0.082907 13.053 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 360 38 364;365 3879;3880;3881;3882;3883;3884;3885;3886;3887 1987;1988 1987 6 MHLPSPTDSNFYR 0 1 1 1 0 0 0 0 1 0 1 0 1 1 2 2 1 0 1 0 0 13 0 1563.714 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.015289 83.397 1 0 9 1 0 9 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1031800 195150 182120 208140 202850 0 0 0 0 0 0 0 0 36220 0 0 30100 0 0 0 0 80204 97019 0 0 0 0 0 0 0 0 0 0 0 0 0 361 207 366 3888;3889;3890;3891;3892;3893;3894 1989 1989 MIGNTLYQFGDYKLTTIRSMSGDVMQEVLLQLQEETMSMHR 0 2 1 2 0 4 3 3 1 2 5 1 5 1 0 3 4 0 2 2 0 41 2 4793.2995 REV__Q9UBF8 REV__Q9UBF8 yes yes 4 0.088848 2.3391 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5515500 806590 658330 0 0 0 0 0 0 0 0 0 0 0 0 914260 901820 0 0 0 0 699620 756570 0 0 0 0 0 0 0 0 778310 0 0 0 0 + 362 176 367 3895 1990 1990 13;14;15;16 MPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQR 3 2 0 0 0 4 1 6 1 0 3 0 4 0 10 4 0 0 0 0 0 38 1 3845.8586 Q9BWG4 Q9BWG4 SSBP4 Single-stranded DNA-binding protein 4 yes yes 4 0.037921 12.073 1 0 1 1 0 1 1 1 90373 0 90373 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 363 189 368 3896;3897;3898;3899;3900;3901;3902;3903;3904;3905;3906;3907;3908;3909;3910;3911;3912;3913;3914;3915;3916;3917;3918;3919;3920;3921;3922;3923;3924;3925;3926;3927;3928;3929;3930 1991;1992;1993;1994;1995 1993 MSKATEVMMQYVENLK 1 0 1 0 0 1 2 0 0 0 1 2 3 0 0 1 1 0 1 2 0 16 1 1900.9097 Q9Y6F6 Q9Y6F6 IRAG;JAW1L;MRVI1 Inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate;JAW1-related protein MRVI1;Protein MRVI1 yes yes 2 0.099464 46.926 1 0 35 1 0 35 2 2 2 2 1 1 2 2 2 2 2 2 1 1 2 2 2 1 1 1 2 2 2 2 2 1 1 2 2 2 2 2 2 1 1 2 2 2 1 1 1 2 3488000 185360 108480 551280 598320 0 0 39390 47284 106750 60682 0 0 113000 140270 272810 332000 46807 0 60740 91764 111250 112640 0 0 0 0 0 0 21337 0 40736 169670 277370 0 0 364 55 369 3931;3932;3933 1996 1996 MVNHFIAEFK 1 0 1 0 0 0 1 0 1 1 0 1 1 2 0 0 0 0 0 1 0 10 0 1234.6169 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 2 0.019379 89.047 1 0 3 1 0 3 1 1 1 1 1 1 165720 66585 57237 0 41893 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 365 54 370 3934;3935;3936;3937;3938;3939 1997;1998;1999;2000 1998 NELESYAYSLK 1 0 1 0 0 0 2 0 0 0 2 1 0 0 0 2 0 0 2 0 0 11 0 1315.6296 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 1.8135E-06 164.04 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 597720 127390 89492 129680 124920 0 36429 0 0 0 0 0 0 0 0 0 0 0 0 0 0 89812 0 0 0 0 0 0 0 0 0 0 0 0 0 0 366 166 371 3940;3941;3942 2001 2001 NFGASLLLPGLK 1 0 1 0 0 0 0 2 0 0 4 1 0 1 1 1 0 0 0 0 0 12 0 1228.718 Q92552 Q92552 KIAA0264;MRPS27 28S ribosomal protein S27, mitochondrial yes yes 2 0.039714 77.062 1 0 3 1 0 3 1 1 1 1 1 1 513740 0 0 0 0 0 150660 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 179680 183410 0 0 0 0 0 0 0 367 205 372 3943;3944;3945 2002 2002 NGGGPHIMAAILQVDVITTFDGKPDLSYMGEMEMMR 2 1 1 3 0 1 2 5 1 3 2 1 5 1 2 1 2 0 1 2 0 36 1 3923.8388 REV__Q96JB1 REV__Q96JB1 yes yes 3 0.040557 1.288 1 0 3 1 0 3 1 1 1 1 1 1 1907100 737120 472460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 697550 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 368 38 373 3946;3947;3948;3949;3950;3951;3952 2003;2004;2005 2004 NGLQSCPIKEDSFLQR 0 1 1 1 1 2 1 1 0 1 2 1 0 1 1 2 0 0 0 0 0 16 1 1890.9258 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.013816 84.892 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1400400 315770 334760 293360 0 0 0 0 0 0 0 0 0 88724 108660 0 0 0 0 0 0 130750 128330 0 0 0 0 0 0 0 0 0 0 0 0 0 369 44 374 3953;3954;3955;3956;3957 2006 2006 NIETIINTFHQYSVK 0 0 2 0 0 1 1 0 1 3 0 1 0 1 0 1 2 0 1 1 0 15 0 1805.9312 P06702 P06702 CAGB;CFAG;MRP14;S100A9 Calgranulin-B;Calprotectin L1H subunit;Leukocyte L1 complex heavy chain;Migration inhibitory factor-related protein 14;Protein S100-A9;S100 calcium-binding protein A9 yes yes 2 0.0090072 112.02 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 330980 0 0 0 21741 0 0 0 0 0 0 0 0 0 0 0 0 53658 0 0 0 54223 63844 0 0 0 0 0 0 0 0 137510 0 0 0 0 370 117 375 3958;3959;3960;3961;3962;3963;3964;3965 2007 2007 NILPFDHTR 0 1 1 1 0 0 0 0 1 1 1 0 0 1 1 0 1 0 0 0 0 9 0 1111.5774 Q06124 Q06124 PTP2C;PTPN11;SHPTP2 Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11 yes yes 2 0.096645 73.931 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 599400 0 0 0 0 0 0 0 0 0 0 0 0 0 0 34512 40140 74089 85887 135260 127040 0 0 0 0 0 0 0 0 0 0 0 0 0 52917 49562 371 76 376 3966;3967 2008 2008 NITYLPAGQSVLLQLPQ 1 0 1 0 0 3 0 1 0 1 4 0 0 0 2 1 1 0 1 1 0 17 0 1854.0251 P35232 P35232 PHB Prohibitin yes yes 2 0.00090684 99.055 1 0 2 1 0 2 1 1 1 1 342770 158040 184730 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 372 84 377 3968;3969;3970;3971;3972;3973;3974 2009;2010;2011;2012 2012 NKGEIYDAAIDLFTR 2 1 1 2 0 0 1 1 0 2 1 1 0 1 0 0 1 0 1 0 0 15 1 1724.8733 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 3 0.0035518 138.02 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1998900 0 0 0 0 0 0 0 18594 0 0 0 0 0 0 0 0 388190 372870 586750 538130 0 0 0 0 0 0 0 0 0 0 0 0 0 48855 45551 373 40 378 3975;3976;3977;3978;3979;3980;3981;3982;3983;3984;3985;3986;3987;3988;3989 2013;2014 2013 NKLNDLEDALQQAK 2 0 2 2 0 2 1 0 0 0 3 2 0 0 0 0 0 0 0 0 0 14 1 1598.8264 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 2.9369E-07 170.56 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1087600 0 0 0 0 27181 27697 0 0 34783 27323 0 0 28701 38176 0 0 266790 219250 61407 44987 67408 55379 0 0 0 0 0 0 0 0 67043 0 0 64026 57406 + 374 40 379 3990;3991;3992;3993;3994;3995;3996;3997 2015;2016;2017;2018;2019;2020 2018 NKLNDLEDALQQAKEDLAR 3 1 2 3 0 2 2 0 0 0 4 2 0 0 0 0 0 0 0 0 0 19 2 2183.1182 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 3 0.00020036 133.86 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2010000 0 0 0 0 0 0 0 0 108230 91009 0 0 0 0 225960 212210 0 0 0 90439 411360 401960 0 0 0 0 0 0 0 0 468810 0 0 0 0 + 375 79 380 3998;3999;4000;4001 2021;2022 2022 NKLNDLEEALQQAK 2 0 2 1 0 2 2 0 0 0 3 2 0 0 0 0 0 0 0 0 0 14 1 1612.842 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes no 3 0.019095 90.614 1 0 4 1 0 4 1 1 1 1 1 1 1 1 221980 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 68459 90709 0 0 42389 0 0 0 0 0 0 0 0 0 0 0 0 20423 0 + 376 38 381 4002;4003;4004;4005;4006;4007;4008;4009;4010;4011;4012;4013;4014;4015;4016 2023;2024;2025;2026;2027;2028;2029;2030;2031 2024 NLCYANTINWK 1 0 3 0 1 0 0 0 0 1 1 1 0 0 0 0 1 1 1 0 0 11 0 1395.6605 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 9.6528E-61 276.57 1 0 15 1 0 15 2 1 1 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 2 1 1 19089000 2857700 2766300 3171100 3143500 42826 0 0 0 0 0 0 0 861370 909020 818410 857130 0 0 0 0 1242800 2257300 0 0 0 0 0 0 79082 82036 0 0 0 0 0 377 79;39;17 382 4017;4018;4019;4020;4021;4022;4023;4024;4025;4026;4027;4028;4029;4030;4031;4032;4033;4034;4035;4036;4037;4038;4039;4040;4041;4042;4043;4044;4045;4046;4047;4048;4049;4050 2032;2033;2034;2035;2036;2037;2038;2039;2040;2041;2042;2043;2044;2045;2046;2047;2048;2049;2050;2051;2052;2053;2054;2055;2056 2047 NLDLDSIIAEVK 1 0 1 2 0 0 1 0 0 2 2 1 0 0 0 1 0 0 0 1 0 12 0 1328.7187 P35908;CON__P35908;CON__O95678;O95678;CON__Q5XKE5;Q5XKE5;CON__Q8VED5;P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P13647;P13647 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E;K6HF;KB18;KRT75;K6HF;KB18;KRT75;K6L;KB38;KRT6L;KRT79;K6L;KB38;KRT6L;KRT79;Kb38;Krt79;K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;KRT5;KRT5 Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2;Cytokeratin-75;Keratin, type II cytoskeletal 75;Keratin-6 hair follicle;Keratin-75;Type II keratin-K6hf;Type-II keratin Kb18;Cytokeratin-79;Keratin, type II cytoskeletal 79;Keratin-6-like;Keratin-79;Type-II keratin Kb38;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5 no no 2 2.9486E-26 231.17 1 0 34 NaN NaN 1 2 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 2 1 1 1 1 3 1 1 1 1 35214000 606700 670600 1116200 1143300 104660 129010 708890 617160 859980 796610 0 0 189410 202180 2493100 2467400 2655100 2417300 1272400 1291900 3289000 3221000 0 0 0 0 522500 538470 0 32986 7037900 42202 54954 385880 346760 + 378 23;18 383 4051;4052;4053;4054 2057;2058 2058 NLDLDSIIAEVR 1 1 1 2 0 0 1 0 0 2 2 0 0 0 0 1 0 0 0 1 0 12 0 1356.7249 CON__Q6NXH9;CON__Q32MB2;Q86Y46;CON__P19013;P19013 CON__Q6NXH9 Kb36;Krt73;K6IRS3;KB36;KRT6IRS3;KRT73;K6IRS3;KB36;KRT6IRS3;KRT73;CYK4;KRT4;CYK4;KRT4 Cytokeratin-73;Keratin, type II cytoskeletal 73;Keratin-73;Type II inner root sheath-specific keratin-K6irs3;Type-II keratin Kb36;Cytokeratin-4;Keratin, type II cytoskeletal 4;Keratin-4;Type-II keratin Kb4 no no 2 0.00037782 146.36 1 0 4 NaN NaN 1 1 1 1 245340 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 99875 77535 0 0 33177 34753 0 0 0 0 0 0 0 0 0 0 0 0 0 + 379 172 384 4055;4056 2059 2059 NLLEKYK 0 0 1 0 0 0 1 0 0 0 2 2 0 0 0 0 0 0 1 0 0 7 1 906.51747 Q99575 Q99575 KIAA0061;POP1 Ribonucleases P/MRP protein subunit POP1 yes yes 2 0.081747 83.614 1 0 2 1 0 2 1 1 1 1 845840 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 449640 396200 380 101;70 385 4057;4058;4059;4060;4061;4062;4063;4064;4065;4066;4067;4068;4069 2060;2061 2061 NLLSVAYK 1 0 1 0 0 0 0 0 0 0 2 1 0 0 0 1 0 0 1 1 0 8 0 906.51747 P62258;P31947;P61981;P31946;Q04917;P63104;P27348 P62258 YWHAE;HME1;SFN;YWHAG;YWHAB;YWHA1;YWHAH;YWHAZ;YWHAQ 14-3-3 protein epsilon;14-3-3 protein sigma;Epithelial cell marker protein 1;Stratifin;14-3-3 protein gamma;14-3-3 protein gamma, N-terminally processed;Protein kinase C inhibitor protein 1;14-3-3 protein beta/alpha;14-3-3 protein beta/alpha, N-terminally processed;Protein 1054;14-3-3 protein eta;Protein AS1;14-3-3 protein zeta/delta;14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1 no no 2 0.17335 73.931 1 0 13 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 2907500 115440 108160 0 0 0 0 0 0 0 0 0 0 163760 175040 157680 0 442090 435870 401120 476820 0 38596 0 0 0 0 0 0 0 0 69056 158840 164990 0 0 381 38 386 4070;4071;4072;4073;4074;4075;4076;4077;4078;4079;4080;4081;4082;4083;4084;4085;4086;4087;4088;4089;4090;4091;4092;4093;4094;4095;4096;4097;4098;4099;4100;4101;4102;4103;4104;4105;4106;4107;4108;4109;4110;4111;4112;4113;4114;4115;4116;4117;4118;4119;4120;4121;4122;4123;4124;4125;4126;4127;4128;4129;4130;4131;4132 2062;2063;2064;2065;2066;2067;2068;2069;2070;2071;2072;2073;2074;2075;2076;2077;2078;2079;2080;2081;2082;2083;2084;2085;2086;2087;2088;2089;2090;2091;2092;2093;2094;2095;2096;2097;2098;2099;2100;2101;2102;2103;2104;2105;2106;2107;2108;2109;2110;2111;2112;2113;2114;2115;2116;2117;2118;2119;2120;2121;2122;2123;2124;2125;2126;2127;2128;2129;2130 2069 NLQEILHGAVR 1 1 1 0 0 1 1 1 1 1 2 0 0 0 0 0 0 0 0 1 0 11 0 1248.6939 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 9.6478E-47 231.05 1 0 63 1 0 63 5 5 8 8 1 2 1 1 2 2 3 3 1 1 1 1 3 4 1 1 1 1 1 1 1 1 1 1 1 5 5 8 8 1 2 1 1 2 2 3 3 1 1 1 1 3 4 1 1 1 1 1 1 1 1 1 1 1 207600000 26827000 26338000 33441000 31394000 355090 429180 509470 625350 0 0 0 0 6824400 7648100 13932000 13039000 902080 829660 1271400 1270200 16312000 16634000 176620 197370 0 0 273140 258190 1841000 2168300 3712600 68982 64175 135650 124580 382 83 387 4133 2131 2131 NLSFFLTPPCAR 1 1 1 0 1 0 0 0 0 0 2 0 0 2 2 1 1 0 0 0 0 12 0 1421.7126 P42224 P42224 STAT1 Signal transducer and activator of transcription 1-alpha/beta;Transcription factor ISGF-3 components p91/p84 yes yes 2 0.0166 83.182 1 0 1 1 0 1 1 1 115280 115280 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 383 128 388 4134;4135;4136;4137;4138;4139;4140;4141;4142;4143;4144 2132 2132 NPQGFVLSLCHLQK 0 0 1 0 1 2 0 1 1 0 3 1 0 1 1 1 0 0 0 1 0 14 0 1639.8504 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 3 0.18613 62.694 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1055600 0 0 0 0 66999 103760 146260 174450 0 0 0 0 0 0 0 0 95037 63317 87510 72657 0 0 0 0 0 0 40377 0 0 0 0 0 0 106630 98625 384 16 389 4145;4146;4147;4148;4149;4150;4151 2133;2134 2134 NQILNLTTDNANILLQIDNAR 2 1 5 2 0 2 0 0 0 3 4 0 0 0 0 0 2 0 0 0 0 21 0 2366.2554 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 3 2.6389E-67 258.92 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1137300 0 30175 0 0 0 0 0 0 0 0 0 0 0 0 86838 74380 0 0 93964 0 227950 161610 0 0 0 0 0 0 0 0 462350 0 0 0 0 + 385 54 390 4152;4153;4154;4155;4156;4157;4158;4159 2135;2136;2137 2137 NQLTSNPENTVFDAK 1 0 3 1 0 1 1 0 0 0 1 1 0 1 1 1 2 0 0 1 0 15 0 1676.8006 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.0089911 109.83 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 761820 152600 161830 103290 143230 38271 50997 50358 0 0 0 0 0 0 0 0 0 0 0 0 0 61246 0 0 0 0 0 0 0 0 0 0 0 0 0 0 386 181 391 4160 2138 2138 NQPCNSMEPRVMDDDMLK 0 1 2 3 1 1 1 0 0 0 1 1 3 0 2 1 0 0 0 1 0 18 1 2178.9166 Q9H069 Q9H069 LRRC48 Leucine-rich repeat-containing protein 48 yes yes 4 0.083286 1.5716 1 0 1 1 0 1 1 1 46997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 46997 0 387 106 392 4161;4162;4163;4164;4165;4166;4167;4168;4169;4170;4171;4172;4173;4174;4175;4176;4177;4178;4179;4180;4181 2139;2140;2141;2142;2143;2144;2145;2146;2147;2148;2149;2150;2151;2152;2153;2154 2153 NQQIFLR 0 1 1 0 0 2 0 0 0 1 1 0 0 1 0 0 0 0 0 0 0 7 0 917.5083 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 0.0018818 131.04 1 0 21 1 0 21 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16150000 251340 226670 256910 288380 0 0 0 0 0 0 0 0 2063600 2268400 3226500 2780900 76431 71517 97013 108640 76005 82048 71875 62592 0 0 0 0 1283600 1381400 1384200 0 40646 51082 0 388 67 393 4182;4183;4184;4185 2155;2156;2157 2156 NSPPYILDLLPDTYQHLR 0 1 1 2 0 1 0 0 1 1 4 0 0 0 3 1 1 0 2 0 0 18 0 2154.111 P22681 P22681 CBL;CBL2;RNF55 Casitas B-lineage lymphoma proto-oncogene;E3 ubiquitin-protein ligase CBL;Proto-oncogene c-Cbl;RING finger protein 55;Signal transduction protein CBL yes yes 3 0.084555 60.209 1 0 4 1 0 4 1 1 1 1 1 1 1 1 1404500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 355040 321050 0 50936 677470 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 389 186 394 4186;4187;4188;4189;4190;4191;4192;4193;4194;4195;4196;4197;4198;4199;4200;4201;4202 2158;2159;2160;2161;2162;2163;2164;2165;2166;2167;2168;2169;2170 2159 NSPSLFPCAPLCER 1 1 1 0 2 0 1 0 0 0 2 0 0 1 3 2 0 0 0 0 0 14 0 1646.7545 Q9UJM3 Q9UJM3 ERRFI1;MIG6 ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein yes yes 2 0.0002897 153.81 1 0 17 1 0 17 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 7831900 282790 324580 451250 469450 0 0 0 0 0 0 0 0 1087300 1144600 1130500 1162200 47019 67909 73309 60962 273350 218950 0 0 0 0 0 0 339140 328770 369720 0 0 0 0 390 46;125 395 4203;4204;4205;4206;4207;4208;4209;4210 2171;2172 2171 NSSYFVEWIPNNVK 0 0 3 0 0 0 1 0 0 1 0 1 0 1 1 2 0 1 1 2 0 14 0 1695.8257 P07437;P68371;P04350;Q13885;Q9BVA1;Q13509 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B;TUBB3;TUBB4 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain;Tubulin beta-3 chain;Tubulin beta-III no no 2 0.010332 101.62 1 0 8 NaN NaN 1 1 1 1 1 1 1 1 1014700 0 0 266680 270580 0 0 71724 62082 0 0 0 0 0 0 0 137490 48649 53821 0 0 103650 0 0 0 0 0 0 0 0 0 0 0 0 0 0 391 97 396 4211;4212;4213 2173;2174 2174 NVFDEAILAALEPPEPK 3 0 1 1 0 0 3 0 0 1 2 1 0 1 3 0 0 0 0 1 0 17 0 1851.9618 P60953 P60953 CDC42 Cell division control protein 42 homolog;G25K GTP-binding protein yes yes 3 0.019274 73.834 1 0 3 1 0 3 1 1 1 1 1 1 254740 105690 103560 0 0 0 0 0 0 0 0 0 0 0 0 45487 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 392 114 397 4214;4215;4216;4217;4218 2175 2175 NVFNALIR 1 1 2 0 0 0 0 0 0 1 1 0 0 1 0 0 0 0 0 1 0 8 0 945.5396 Q02978 Q02978 SLC20A4;SLC25A11 Mitochondrial 2-oxoglutarate/malate carrier protein;Solute carrier family 25 member 11 yes yes 2 0.065911 88.942 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 345850 73339 0 72008 75507 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 53842 71151 0 0 0 0 0 0 0 0 0 0 0 0 0 393 193 398 4219;4220;4221;4222;4223;4224;4225;4226;4227;4228;4229;4230;4231;4232;4233;4234;4235;4236;4237;4238;4239;4240;4241;4242;4243;4244;4245;4246;4247;4248;4249;4250;4251;4252;4253;4254;4255;4256;4257;4258;4259;4260;4261;4262;4263;4264;4265 2176;2177;2178;2179;2180;2181;2182;2183 2176 NVLFEDLAMWGGGRVVMVTR 1 2 1 1 0 0 1 3 0 0 2 0 2 1 0 0 1 1 0 4 0 20 1 2249.1449 REV__Q03001;REV__Q9UPN3 REV__Q03001 yes no 3 0.088848 46.121 1 0 47 1 0 47 2 2 2 2 2 2 2 2 1 1 1 2 2 2 2 2 2 1 1 2 1 1 2 1 2 1 1 2 1 2 2 2 2 2 2 2 2 1 1 1 2 2 2 2 2 2 1 1 2 1 1 2 1 2 1 1 2 1 116540000 5187000 4659600 8249400 7126200 273870 530730 10029000 7295700 0 1260700 0 181520 1884900 2227500 6886200 874020 7450200 7206600 112220 10815000 1533400 5626500 0 0 0 30432 4179600 9117700 0 42319 6017800 1481100 2119100 4114100 29346 + 394 16 399 4266;4267;4268;4269;4270;4271;4272 2184;2185;2186;2187 2186 NVQALEIELQSQLALK 2 0 1 0 0 3 2 0 0 1 4 1 0 0 0 1 0 0 0 1 0 16 0 1796.0044 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2,3 5.2654E-05 159 1 0 7 1 0 7 1 2 2 2 1 2 2 2 931620 0 0 0 0 0 0 0 0 0 0 0 0 0 0 43809 0 0 0 0 0 223970 156730 0 0 0 0 0 0 0 0 507110 0 0 0 0 + 395 86 400 4273;4274;4275;4276;4277;4278;4279;4280;4281;4282;4283;4284;4285 2188;2189;2190;2191;2192;2193;2194 2189 NVQGIIEILK 0 0 1 0 0 1 1 1 0 3 1 1 0 0 0 0 0 0 0 1 0 10 0 1125.6758 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2 8.9475E-05 119.68 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1944100 404860 418940 316310 267270 0 36596 46358 49902 0 0 0 0 0 0 59075 53901 0 0 0 0 151410 139470 0 0 0 0 0 0 0 0 0 0 0 0 0 396 16 401;402 4286;4287;4288;4289;4290;4291;4292;4293;4294;4295;4296;4297;4298;4299;4300;4301;4302;4303;4304;4305;4306;4307;4308 2195;2196;2197;2198;2199;2200;2201;2202;2203;2204;2205;2206;2207 2203 1 NVSTGDVNVEMNAAPGVDLTQLLNNMR 2 1 5 2 0 1 1 2 0 0 3 0 2 0 1 1 2 0 0 4 0 27 0 2871.3855 CON__P13645;P13645;CON__P02535-1 CON__P13645 KPP;KRT10;KPP;KRT10;Krt10;Krt1-10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa yes no 3 2.2462E-27 168.64 1 0 23 1 0 23 1 1 1 1 1 1 1 1 1 2 1 1 1 1 2 2 1 1 2 1 1 1 1 1 1 1 1 1 2 1 1 1 1 2 2 1 1 2 9467200 132220 192920 105030 112790 0 0 119710 0 325670 384220 0 0 61087 0 412000 1137600 339420 290510 462620 400240 1789500 1703600 0 0 0 0 106170 117940 0 0 1274100 0 0 0 0 + 397 38 403 4309;4310;4311;4312;4313;4314;4315;4316;4317;4318;4319;4320;4321;4322;4323;4324;4325;4326;4327;4328;4329;4330;4331 2208;2209;2210;2211;2212;2213;2214;2215;2216;2217 2210 NYDLSFLK 0 0 1 1 0 0 0 0 0 0 2 1 0 1 0 1 0 0 1 0 0 8 0 998.5073 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.01596 114.5 1 0 23 1 0 23 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23386000 3241800 2953400 3420000 3737800 52231 0 65612 58079 0 0 0 0 896060 808040 1570700 1513700 129740 153770 106970 85443 2113300 1811500 36434 53308 0 0 0 0 192380 130850 254710 0 0 0 0 398 19 404 4332;4333;4334 2218 2218 NYSPYYNTIDDLKDQIVDLTVGNNK 0 0 4 4 0 1 0 1 0 2 2 2 0 0 1 1 2 0 3 2 0 25 1 2901.4032 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 0.015048 73.448 1 0 3 1 0 3 1 1 1 1 1 1 477480 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 104650 101860 0 0 0 0 0 0 0 0 270960 0 0 0 0 + 399 38 405 4335;4336;4337;4338;4339;4340;4341;4342;4343;4344;4345;4346;4347;4348;4349;4350;4351;4352;4353;4354;4355;4356;4357;4358;4359;4360;4361;4362;4363 2219;2220;2221;2222;2223;2224;2225;2226;2227;2228;2229;2230;2231;2232;2233;2234;2235 2224 NYVVTDHGSCVR 0 1 1 1 1 0 0 1 1 0 0 0 0 0 0 1 1 0 1 3 0 12 0 1405.6408 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 1.4821E-35 244 1 0 29 1 0 29 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 10922000 2097100 1901000 1672100 1708500 0 0 0 0 0 0 0 0 229780 234920 364890 385360 0 0 0 0 527100 509300 528550 572280 0 0 0 0 35393 71681 84365 0 0 0 0 400 106 406 4364;4365;4366;4367;4368;4369;4370;4371;4372;4373;4374;4375 2236 2236 PHPWFFGK 0 0 0 0 0 0 0 1 1 0 0 1 0 2 2 0 0 1 0 0 0 8 0 1014.5076 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 0.070977 88.029 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5264900 65178 61041 72508 53563 0 0 0 0 0 0 0 0 711720 842380 949440 1012700 42494 0 0 0 0 0 0 0 0 0 0 0 379450 377460 697000 0 0 0 0 401 196 407 4376;4377;4378 2237;2238 2237 PLEENIIK 0 0 1 0 0 0 2 0 0 2 1 1 0 0 1 0 0 0 0 0 0 8 0 954.5386 REV__Q5VZP5 REV__Q5VZP5 yes yes 2 0.024218 106.04 1 0 3 1 0 3 1 1 1 1 1 1 1162900 0 0 0 710370 0 0 0 0 0 0 0 0 0 0 0 185300 0 0 0 0 267190 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 402 190 408 4379;4380;4381;4382;4383;4384;4385;4386;4387 2239 2239 PLGDGGIVVLR 0 1 0 1 0 0 0 3 0 1 2 0 0 0 1 0 0 0 0 2 0 11 0 1094.6448 REV__A6NCF5 REV__A6NCF5 yes yes 2 0.088848 69.275 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1122200 197550 397870 99573 66966 0 0 0 0 0 0 0 0 0 33440 46944 43966 0 0 0 0 141250 94692 0 0 0 0 0 0 0 0 0 0 0 0 0 + 403 38 409 4388;4389;4390;4391;4392;4393 2240;2241 2241 PYDGIPASEISSILEK 1 0 0 1 0 0 2 1 0 3 1 1 0 0 2 3 0 0 1 0 0 16 0 1717.8774 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.070958 69.258 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 1530700 503070 50242 405030 362540 0 0 0 0 0 0 0 0 0 0 57874 0 0 0 0 0 151990 0 0 0 0 0 0 0 0 0 0 0 0 0 0 404 3 410 4394 2242 2242 QDLGKAIENIR 1 1 1 1 0 1 1 1 0 2 1 1 0 0 0 0 0 0 0 0 0 11 1 1255.6884 A6NMZ7 A6NMZ7 COL6A6 Collagen alpha-6(VI) chain yes yes 2 0.0050451 58.676 1 0 1 1 0 1 1 1 951220 951220 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 405 40 411 4395;4396;4397;4398;4399;4400;4401;4402;4403;4404;4405;4406;4407;4408;4409;4410 2243;2244 2243 QISNLQQSISDAEQR 1 1 1 1 0 4 1 0 0 2 1 0 0 0 0 3 0 0 0 0 0 15 0 1715.8438 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 0.020912 88.075 1 0 16 1 0 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 840400 0 0 31348 30893 39878 33979 0 0 43257 62434 39301 51735 39387 37553 33925 47379 116760 95159 0 0 53452 0 0 0 0 0 0 0 0 0 83970 0 0 0 0 + 406 5;150;109 412 4411;4412;4413;4414;4415;4416;4417 2245 2245 QLFHPEQLITGK 0 0 0 0 0 2 1 1 1 1 2 1 0 1 1 0 1 0 0 0 0 12 0 1409.7667 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65;P68366 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha no no 3 0.13395 62.466 1 0 7 NaN NaN 1 1 1 1 1 1 1 824980 199570 194070 153260 155720 0 69704 0 0 0 0 0 0 30689 0 21967 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 407 19 413 4418;4419;4420;4421;4422;4423;4424;4425;4426;4427;4428;4429;4430;4431;4432;4433;4434;4435;4436;4437;4438 2246;2247;2248;2249;2250;2251;2252;2253 2252 2 QVLDNLTMEK 0 0 1 1 0 1 1 0 0 0 2 1 1 0 0 0 1 0 0 1 0 10 0 1189.6013 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 2 0.0099291 93.649 1 0 21 1 0 21 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1400700 0 0 32034 0 45984 53079 0 0 64073 45117 70636 72506 94637 75866 0 0 80011 82425 0 0 121820 92322 0 0 84754 81998 0 0 38555 50091 72307 0 0 65928 76561 + 408 77 414 4439 2254 2254 QWWNLR 0 1 1 0 0 1 0 0 0 0 1 0 0 0 0 0 0 2 0 0 0 6 0 901.45587 P35498 P35498 NAC1;SCN1;SCN1A Sodium channel protein brain I subunit alpha;Sodium channel protein type 1 subunit alpha;Sodium channel protein type I subunit alpha;Voltage-gated sodium channel subunit alpha Nav1.1 yes yes 2 3.7286E-18 106.75 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 409 26 415 4440;4441;4442;4443;4444;4445;4446;4447 2255 2255 RDGTFLIR 0 2 0 1 0 0 0 1 0 1 1 0 0 1 0 0 1 0 0 0 0 8 1 976.54541 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.16009 90.657 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 951410 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 124640 126880 202930 225830 0 0 0 0 0 0 0 0 0 0 0 74015 64794 57850 74465 410 177 416 4448 2256 2256 RHTVGGGEMAR 1 2 0 0 0 0 1 3 1 0 0 0 1 0 0 0 1 0 0 1 0 11 1 1169.5724 Q9BWN1 Q9BWN1 PRR14 Proline-rich protein 14 yes yes 2 0.059219 47.559 1 0 1 1 0 1 1 1 113500 113500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 411 154 417 4449 2257 2257 RIAHGADAVAAR 5 2 0 1 0 0 0 1 1 1 0 0 0 0 0 0 0 0 0 1 0 12 1 1206.6582 Q8IWK6 Q8IWK6 GPR125;UNQ556/PRO1113 Probable G-protein coupled receptor 125 yes yes 2 0.062524 51.998 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 412 38 418 4450;4451;4452;4453;4454;4455;4456;4457;4458;4459;4460;4461;4462;4463;4464;4465 2258;2259;2260;2261;2262;2263;2264 2261 RPAGSVQNPVYHNQPLNPAPSR 2 2 3 0 0 2 0 1 1 0 1 0 0 0 5 2 0 0 1 2 0 22 1 2398.2254 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3,4 2.03E-10 161.19 1 0 16 1 0 16 2 2 2 2 1 1 1 1 2 2 2 2 2 2 1 1 1 1 2 2 4686600 881900 843800 817590 928810 0 0 0 0 0 0 0 0 64578 70598 88452 112740 0 0 0 0 438040 440140 0 0 0 0 0 0 0 0 0 0 0 0 0 413 26;167 419 4466;4467;4468;4469;4470;4471;4472;4473;4474;4475;4476;4477;4478;4479;4480;4481;4482;4483;4484;4485 2265;2266;2267;2268;2269;2270;2271;2272;2273;2274;2275;2276;2277;2278 2270 RTAIEAFNETIK 2 1 1 0 0 0 2 0 0 2 0 1 0 1 0 0 2 0 0 0 0 12 1 1391.7409 O00459;P27986;Q92569 O00459 PIK3R2;GRB1;PIK3R1;PIK3R3 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta;Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;Phosphatidylinositol 3-kinase regulatory subunit alpha;p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma no no 2,3 0.0023733 141.08 1 0 20 NaN NaN 1 1 2 2 2 2 2 2 2 2 2 4325200 0 0 0 0 33862 0 28148 78940 0 0 0 0 0 0 0 0 617890 579200 740190 953110 0 0 0 0 0 0 0 0 0 0 0 235560 229550 425900 402840 414 16 420 4486;4487;4488;4489;4490;4491;4492;4493;4494;4495;4496;4497;4498;4499;4500;4501;4502;4503;4504;4505;4506;4507;4508;4509;4510;4511;4512;4513;4514;4515;4516 2279;2280;2281;2282;2283;2284;2285;2286;2287;2288;2289;2290;2291;2292;2293;2294;2295 2289 RVLDELTLTK 0 1 0 1 0 0 1 0 0 0 3 1 0 0 0 0 2 0 0 1 0 10 1 1186.6921 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 4.374E-05 142.83 1 0 31 1 0 31 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4558500 0 34727 119130 171510 189330 170230 114500 102070 86878 105180 125610 126620 114230 140030 133110 102900 399450 453800 89146 109010 247530 263090 0 0 90940 127430 32838 0 89885 75557 308060 47250 42268 175390 170800 + 415 144 421 4517 2296 2296 RVTAPYKYPR 1 2 0 0 0 0 0 0 0 0 0 1 0 0 2 0 1 0 2 1 0 10 2 1249.6931 Q6NUN0 Q6NUN0 ACSM5;MACS3 Acyl-coenzyme A synthetase ACSM5, mitochondrial yes yes 2 0.086627 34.721 1 0 1 1 0 1 1 1 75817 75817 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 416 110 422 4518 2297 2297 SAVTALWGK 2 0 0 0 0 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 0 9 0 931.51272 P68871 P68871 HBB Beta-globin;Hemoglobin beta chain;Hemoglobin subunit beta;LVV-hemorphin-7 yes yes 2 0.049347 58.981 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 417 7 423 4519;4520;4521;4522;4523;4524;4525;4526;4527;4528;4529;4530 2298;2299 2299 SCAAAGTECLISGWGNTK 3 0 1 0 2 0 1 3 0 1 1 1 0 0 0 2 2 1 0 0 0 18 0 1881.8349 CON__P00761 CON__P00761 yes yes 2 0.00019702 134.25 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 792220 0 34425 88843 154640 0 0 0 0 0 0 0 0 0 35937 71140 58314 0 0 81280 61577 0 40253 0 0 0 0 38008 0 0 0 0 52202 75602 0 0 + 418 84 424 4531;4532;4533;4534 2300;2301;2302 2301 SCAGYCVATFILGIGDR 2 1 0 1 2 0 0 3 0 2 1 0 0 1 0 1 1 0 1 1 0 17 0 1858.8706 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2,3 0.0002726 136.17 1 0 4 1 0 4 2 2 2 2 2328500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1225700 1102800 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 419 164 425 4535;4536;4537;4538;4539 2303;2304;2305 2304 SDGLLQLWK 0 0 0 1 0 1 0 1 0 0 3 1 0 0 0 1 0 1 0 0 0 9 0 1058.576 Q8WV24 Q8WV24 PHLDA1;PHRIP;TDAG51 Apoptosis-associated nuclear protein;Pleckstrin homology-like domain family A member 1;Proline- and glutamine-rich protein;Proline- and histidine-rich protein;T-cell death-associated gene 51 protein yes yes 2 0.015082 93.178 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 186340 57972 50385 0 37860 0 0 40128 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 420 19 426 4540;4541;4542;4543;4544;4545;4546;4547;4548;4549;4550;4551 2306;2307;2308 2307 3;4 SDLEMQYETLQEELMALKK 1 0 0 1 0 2 4 0 0 0 4 2 2 0 0 1 1 0 1 0 0 19 1 2298.1123 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 0.0010654 87.566 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3316100 142100 161990 0 0 0 0 0 0 226970 182410 0 0 0 0 200800 225730 54778 0 126740 162480 707770 545730 0 0 0 0 0 0 0 0 578590 0 0 0 0 + 421 139 427 4552;4553;4554;4555;4556;4557;4558 2309;2310;2311;2312;2313;2314 2309 SDSLFQLWK 0 0 0 1 0 1 0 0 0 0 2 1 0 1 0 2 0 1 0 0 0 9 0 1122.571 Q53GA4 Q53GA4 BWR1C;HLDA2;IPL;PHLDA2;TSSC3 Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein;Imprinted in placenta and liver protein;p17-Beckwith-Wiedemann region 1 C;Pleckstrin homology-like domain family A member 2;Tumor-suppressing STF cDNA 3 protein;Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein yes yes 2 3.6562E-05 137.14 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 344870 94396 76280 35860 0 0 0 60364 77970 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 422 121 428 4559;4560 2315 2315 SFCKPQELLSLLIER 0 1 0 0 1 1 2 0 0 1 4 1 0 1 1 2 0 0 0 0 0 15 1 1831.9866 Q07890 Q07890 SOS2 Son of sevenless homolog 2 yes yes 3 0.025129 85.554 1 0 2 1 0 2 1 1 1 1 144550 0 0 0 0 0 0 0 0 0 0 0 0 0 0 80923 63631 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 423 49 429 4561;4562;4563;4564 2316;2317 2317 SFISGGSTITGVGK 0 0 0 0 0 0 0 4 0 2 0 1 0 1 0 3 2 0 0 1 0 14 0 1309.6878 P08581 P08581 MET Hepatocyte growth factor receptor;HGF/SF receptor;Proto-oncogene c-Met;Scatter factor receptor;Tyrosine-protein kinase Met yes yes 2 0.0080296 125.54 1 0 4 1 0 4 1 1 1 1 1 1 1 1 257140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 58238 60642 0 0 0 0 0 0 63525 74737 0 0 0 0 0 424 122 430 4565;4566;4567;4568;4569 2318;2319;2320;2321;2322 2321 SFLILPFQR 0 1 0 0 0 1 0 0 0 1 2 0 0 2 1 1 0 0 0 0 0 9 0 1119.6441 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 4.1643E-05 135.79 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1169900 0 0 0 0 0 0 0 0 0 0 0 0 99670 98730 460840 444230 0 0 0 0 0 0 0 0 0 0 0 0 0 0 66392 0 0 0 0 425 26 431 4570;4571;4572;4573;4574;4575;4576;4577;4578;4579;4580;4581;4582;4583;4584;4585;4586;4587;4588;4589;4590;4591;4592;4593;4594 2323;2324;2325;2326;2327;2328;2329;2330;2331;2332;2333;2334;2335;2336;2337;2338;2339;2340;2341;2342 2328 SFLLALPAPLVTPEASAEAR 5 1 0 0 0 0 2 0 0 0 4 0 0 1 3 2 1 0 0 1 0 20 0 2052.1255 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 1.2377E-09 147.24 1 0 25 1 0 25 2 2 2 2 3 2 4 3 1 1 1 1 1 2 2 2 2 3 2 4 3 1 1 1 1 1 83029000 0 0 0 0 0 0 254290 259790 0 0 0 0 0 0 239160 247460 4401000 4104800 36778000 36197000 0 0 0 0 0 0 93688 96898 0 0 57786 0 0 159870 139260 426 182 432 4595 2343 2343 SFWELIGEAAK 2 0 0 0 0 0 2 1 0 1 1 1 0 1 0 1 0 1 0 0 0 11 0 1249.6343 Q9HCY8 Q9HCY8 S100A14;S100A15 Protein S100-A14;S100 calcium-binding protein A14 yes yes 2 0.045413 55.353 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 427 122 433 4596;4597;4598;4599;4600;4601 2344;2345;2346 2344 SGELTALEFSASPGLR 2 1 0 0 0 0 2 2 0 0 3 0 0 1 1 3 1 0 0 0 0 16 0 1633.8312 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2 0.0045824 103.85 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 953240 0 0 0 0 0 0 0 0 29365 0 0 0 135900 156350 288360 299340 0 0 0 43930 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 428 19 434 4602;4603;4604;4605;4606;4607;4608;4609;4610;4611;4612;4613;4614;4615;4616 2347;2348;2349;2350;2351;2352;2353;2354;2355 2353 SGGGGGGGLGSGGSIR 0 1 0 0 0 0 0 10 0 1 1 0 0 0 0 3 0 0 0 0 0 16 0 1231.5905 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 2 0.0045799 107.46 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 819000 0 0 63524 54130 0 0 0 0 0 0 64679 60264 62274 67441 0 0 37355 42949 0 0 56138 44535 0 0 55939 63484 0 0 0 0 53973 0 0 51413 40898 + 429 86 435 4617;4618;4619;4620;4621;4622;4623;4624;4625;4626;4627;4628;4629;4630;4631;4632;4633 2356;2357;2358;2359;2360;2361 2359 SGGLGGSHALLLLR 1 1 0 0 0 0 0 4 1 0 5 0 0 0 0 2 0 0 0 0 0 14 0 1349.7779 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2,3 0.006134 132.79 1 0 17 1 0 17 2 2 2 2 1 2 2 1 2 1 2 2 2 2 1 2 2 1 2 1 1816700 340690 377050 311240 322060 0 0 0 0 0 0 0 0 0 43429 85909 91554 0 0 0 0 83444 146340 0 0 0 0 0 0 0 14988 0 0 0 0 0 430 189 436 4634;4635;4636;4637;4638;4639 2362 2362 SGLDVMPNISDVLLRK 0 1 1 2 0 0 0 1 0 1 3 1 1 0 1 2 0 0 0 2 0 16 1 1755.9553 Q9Y6F6 Q9Y6F6 IRAG;JAW1L;MRVI1 Inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate;JAW1-related protein MRVI1;Protein MRVI1 yes yes 3 0.13623 72.891 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 946130 0 618430 0 0 0 0 0 114580 0 0 0 0 0 0 0 0 49761 0 0 49954 0 0 0 0 0 0 81235 32167 0 0 0 0 0 0 0 431 46 437 4640;4641;4642;4643;4644;4645;4646 2363;2364;2365 2363 SGPFGQIFRPDNFVFGQSGAGNNWAK 2 1 3 1 0 2 0 5 0 1 0 1 0 4 2 2 0 1 0 1 0 26 1 2797.3361 P07437;P68371;P04350;Q13885;Q9BVA1 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5;TUBB2;TUBB2A;TUBB2B Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain;Tubulin beta-2A chain;Tubulin beta-2B chain yes no 3 3.4229E-15 149.44 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2270900 805230 837070 0 0 0 0 0 0 0 0 0 0 0 0 145270 150770 0 0 74879 0 161400 96310 0 0 0 0 0 0 0 0 0 0 0 0 0 432 186 438 4647;4648;4649;4650;4651;4652;4653;4654;4655;4656;4657;4658;4659;4660;4661 2366;2367;2368;2369;2370;2371;2372;2373 2372 SIAGVAAQEIR 3 1 0 0 0 1 1 1 0 2 0 0 0 0 0 1 0 0 0 1 0 11 0 1113.6142 Q9UJM3 Q9UJM3 ERRFI1;MIG6 ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein yes yes 2 9.5049E-05 149.96 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2588100 66125 69113 113410 125640 0 0 0 0 0 0 0 0 275890 391530 500120 417240 0 0 54161 46053 65414 63496 0 0 0 0 0 0 119640 138950 141280 0 0 0 0 433 70 439 4662;4663;4664;4665;4666;4667;4668;4669 2374;2375;2376 2374 SICTTVLELLDK 0 0 0 1 1 0 1 0 0 1 3 1 0 0 0 1 2 0 0 1 0 12 0 1390.7378 P27348 P27348 YWHAQ 14-3-3 protein tau;14-3-3 protein T-cell;14-3-3 protein theta;Protein HS1 yes yes 2 0.0028082 110.66 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 926340 49989 68355 0 0 0 0 0 0 0 0 0 0 0 0 155910 143540 44298 29027 231470 203760 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 434 14 440 4670;4671;4672;4673;4674;4675;4676;4677;4678;4679;4680;4681;4682;4683;4684;4685 2377 2377 SIHFSSPVFTSR 0 1 0 0 0 0 0 0 1 1 0 0 0 2 1 4 1 0 0 1 0 12 0 1363.6884 CON__P08729;CON__Q3KNV1;P08729 CON__P08729 KRT7;SCL;KRT7;KRT7;SCL Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Sarcolectin;Type-II keratin Kb7;KRT7 protein;Putative uncharacterized protein yes no 2 0.034903 79.659 1 0 16 1 0 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1504500 181660 209180 150460 180780 0 0 0 0 31744 33951 0 0 50249 50518 74011 109210 0 0 49822 0 139020 83148 0 0 0 0 0 0 45438 54248 61041 0 0 0 0 + 435 55 441 4686;4687;4688;4689 2378;2379;2380 2379 SINPDEAVAYGAAVQAAILSGDK 6 0 1 2 0 1 1 2 0 2 1 1 0 0 1 2 0 0 1 2 0 23 0 2259.1383 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 3 1.0112E-06 107.02 1 0 4 1 0 4 1 1 1 1 1 1 1 1 1099900 353390 343700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 219400 183370 0 0 0 0 0 0 0 0 0 0 0 0 0 436 180 442 4690;4691;4692;4693;4694 2381;2382;2383 2381 SINQPVAFVR 1 1 1 0 0 1 0 0 0 1 0 0 0 1 1 1 0 0 0 2 0 10 0 1129.6244 Q9GZT3 Q9GZT3 C14orf156;DC23;DC50;PD04872;SLIRP SRA stem-loop-interacting RNA-binding protein, mitochondrial yes yes 2 0.0024097 108.47 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 303850 87832 73366 57480 63650 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 21519 0 0 0 0 0 0 0 0 0 0 0 0 0 437 5;109 443 4695;4696;4697;4698;4699;4700;4701;4702;4703;4704;4705;4706;4707;4708;4709;4710;4711;4712 2384;2385;2386;2387;2388;2389;2390;2391;2392;2393 2384 SIQFVDWCPTGFK 0 0 0 1 1 1 0 1 0 1 0 1 0 2 1 1 1 1 0 1 0 13 0 1583.7442 CON__ENSEMBL:ENSBTAP00000016242;P68363;P68366 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1;TUBA4A Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha no no 2 3.4515E-07 174.73 1 0 18 NaN NaN 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3751600 825040 740330 486290 408140 0 0 109370 98103 0 0 0 0 0 0 164350 166210 55131 62642 90479 41424 212080 192530 0 0 0 0 37905 34100 0 0 27502 0 0 0 0 + 438 147 444 4713;4714;4715;4716;4717;4718;4719;4720;4721;4722;4723;4724;4725;4726;4727;4728;4729;4730;4731;4732;4733;4734;4735;4736;4737;4738;4739;4740;4741;4742;4743 2394;2395;2396;2397;2398;2399;2400 2400 SISLPR 0 1 0 0 0 0 0 0 0 1 1 0 0 0 1 2 0 0 0 0 0 6 0 671.39662 Q6PKX4 Q6PKX4 DOK5L;DOK6 Docking protein 6;Downstream of tyrosine kinase 6 yes yes 1 0.032677 96.337 1 0 31 1 0 31 1 2 2 2 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5609000 576270 807400 265530 284730 153830 165000 143930 0 143460 158360 213230 219650 276520 117420 143310 0 150930 149800 125110 136590 449290 0 122060 122580 0 0 124010 0 0 157050 161890 0 157730 83347 0 439 48 445 4744;4745;4746 2401;2402 2402 SIYYITGESK 0 0 0 0 0 0 1 1 0 2 0 1 0 0 0 2 1 0 2 0 0 10 0 1159.5761 P08238;Q58FF8 P08238 HSP90AB1;HSP90B;HSPC2;HSPCB;HSP90AB2P;HSP90BB Heat shock 84 kDa;Heat shock protein HSP 90-beta;Heat shock protein 90-beta b;Putative heat shock protein HSP 90-beta 2 yes no 2 0.0059431 100.02 1 0 3 1 0 3 1 1 1 1 1 1 154020 54339 56247 43430 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 440 16 446 4747;4748;4749;4750;4751;4752;4753;4754;4755;4756;4757;4758;4759 2403 2403 SKELTTEIDNNIEQISSYK 0 0 2 1 0 1 3 0 0 3 1 2 0 0 0 3 2 0 1 0 0 19 1 2211.0907 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 3 0.15744 55.546 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2380700 0 0 152510 0 0 0 112120 32612 103930 67915 0 0 0 0 162740 206710 273310 339530 78310 0 260410 213690 0 0 0 0 0 0 0 0 376900 0 0 0 0 + 441 192 447 4760;4761;4762;4763;4764;4765;4766;4767;4768;4769;4770;4771;4772;4773;4774;4775;4776;4777;4778;4779;4780;4781;4782;4783;4784;4785;4786;4787;4788;4789;4790;4791;4792;4793;4794;4795;4796;4797;4798;4799;4800;4801;4802;4803;4804;4805;4806;4807 2404;2405;2406;2407;2408;2409;2410;2411 2411 SLDALGIDSR 1 1 0 2 0 0 0 1 0 1 2 0 0 0 0 2 0 0 0 0 0 10 0 1045.5404 REV__O15440 REV__O15440 yes yes 2 0.010896 93.178 1 0 48 1 0 48 1 1 1 2 1 1 2 1 1 1 1 1 2 2 1 2 1 1 1 2 1 1 1 1 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 1 2 1 1 1 1 1 2 2 1 2 1 1 1 2 1 1 1 1 1 2 1 1 2 2 2 2 1 2 2 11301000 144210 120430 122090 613670 354920 310220 529560 419580 386370 93278 112870 353690 415030 405200 270440 360010 284460 280620 444090 631810 127610 116780 81906 85260 397080 439210 112980 347110 417000 456940 437080 471550 369900 393000 395420 + 442 14 448 4808;4809;4810;4811;4812;4813;4814;4815;4816 2412;2413 2412 SLDLDGIIAEVK 1 0 0 2 0 0 1 1 0 2 2 1 0 0 0 1 0 0 0 1 0 12 0 1271.6973 CON__P08729;CON__Q3KNV1;P08729 CON__P08729 KRT7;SCL;KRT7;KRT7;SCL Cytokeratin-7;Keratin, type II cytoskeletal 7;Keratin-7;Sarcolectin;Type-II keratin Kb7;KRT7 protein;Putative uncharacterized protein yes no 2 1.3688E-08 73.632 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 632760 136330 139110 77894 69324 0 0 0 0 0 0 0 0 0 0 38025 0 0 0 32471 0 70439 69175 0 0 0 0 0 0 0 0 0 0 0 0 0 + 443 40 449 4817;4818;4819;4820;4821;4822;4823;4824;4825;4826;4827;4828;4829;4830;4831;4832;4833;4834;4835;4836;4837;4838;4839;4840;4841;4842;4843;4844;4845;4846;4847;4848;4849;4850;4851;4852;4853;4854;4855;4856;4857;4858;4859;4860;4861;4862;4863;4864;4865;4866 2414;2415;2416;2417;2418;2419;2420;2421;2422;2423;2424;2425;2426;2427;2428;2429;2430;2431;2432;2433;2434;2435;2436;2437;2438;2439;2440;2441;2442;2443;2444;2445;2446;2447;2448;2449;2450;2451;2452;2453;2454 2431 SLDLDSIIAEVK 1 0 0 2 0 0 1 0 0 2 2 1 0 0 0 2 0 0 0 1 0 12 0 1301.7078 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 no no 2 7.235E-18 208.46 1 0 50 NaN NaN 1 3 1 1 1 1 1 1 1 1 1 1 1 2 3 3 3 3 2 1 2 3 1 1 1 1 5 1 1 1 1 109090000 2376100 2399400 2975300 2526700 265190 412080 2952200 2502200 4009900 3822700 71563 86710 925560 949720 7289100 6862700 8359000 7524900 3749800 3977600 10200000 10211000 0 0 0 0 1484900 1376900 121720 150450 17519000 218410 252050 1759500 1756800 + 444 38 450 4867;4868;4869;4870;4871;4872;4873;4874;4875;4876;4877;4878;4879;4880;4881;4882;4883;4884 2455;2456;2457;2458;2459;2460;2461;2462;2463;2464 2462 SLKEISDGDVIISGNK 0 0 1 2 0 0 1 2 0 3 1 2 0 0 0 3 0 0 0 1 0 16 1 1673.8836 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 0.00011717 152.34 1 0 18 1 0 18 2 2 2 2 1 2 2 1 2 2 2 2 2 2 1 2 2 1 2 2 2385500 493280 493060 346400 381510 0 0 0 0 0 0 0 0 61965 138600 95049 48328 0 0 0 0 183610 143740 0 0 0 0 0 0 0 0 0 0 0 0 0 445 16 451 4885;4886;4887;4888;4889;4890;4891;4892;4893 2465;2466;2467;2468;2469;2470;2471 2468 SLLEGEGSSGGGGR 0 1 0 0 0 0 2 6 0 0 2 0 0 0 0 3 0 0 0 0 0 14 0 1261.5899 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 2.8417E-124 158.42 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 368800 0 0 0 0 38375 49205 0 0 0 0 0 0 0 0 0 0 96288 82517 0 0 0 0 0 0 0 59107 0 0 0 0 0 0 0 0 43310 + 446 40 452 4894;4895;4896;4897;4898;4899;4900;4901;4902;4903;4904;4905;4906;4907;4908;4909;4910;4911;4912;4913;4914;4915;4916;4917;4918;4919;4920;4921;4922;4923;4924;4925;4926;4927;4928 2472;2473;2474;2475;2476;2477;2478;2479;2480;2481;2482;2483;2484;2485;2486;2487;2488;2489;2490;2491;2492;2493;2494;2495;2496;2497;2498;2499;2500;2501;2502;2503 2486 SLNNQFASFIDK 1 0 2 1 0 1 0 0 0 1 1 1 0 2 0 2 0 0 0 0 0 12 0 1382.683 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 no no 2 2.1723E-26 231.92 1 0 35 NaN NaN 1 1 1 1 1 1 1 1 1 1 2 2 2 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 60450000 0 0 1542500 1818400 1617800 1969900 1431500 1514900 1522400 1469800 1427100 1598500 2699300 3053400 1796300 1596200 5919000 5392400 1261300 836140 3034500 2800100 0 0 0 61351 652310 606480 460330 497340 5671500 502790 638950 3444000 3613300 + 447 40 453 4929;4930;4931;4932;4933;4934;4935;4936;4937;4938;4939;4940;4941;4942;4943;4944;4945;4946;4947;4948;4949;4950;4951;4952;4953;4954;4955;4956;4957;4958;4959;4960;4961;4962;4963;4964;4965;4966;4967;4968;4969;4970;4971;4972;4973;4974 2504;2505;2506;2507;2508;2509;2510;2511;2512;2513 2510 SLNNQFASFIDKVR 1 1 2 1 0 1 0 0 0 1 1 1 0 2 0 2 0 0 0 1 0 14 1 1637.8526 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 no no 2,3 0.00034126 151.7 1 0 46 NaN NaN 2 2 3 2 1 2 2 2 2 1 1 2 2 2 2 1 1 2 2 1 2 4 2 3 13460000 385660 420800 458800 505710 0 17145 706000 748250 266860 251400 0 0 61201 63679 306260 324140 1433200 1531500 178800 123290 758800 664680 0 0 0 0 243550 264240 0 0 3239900 0 0 219630 286140 + 448 84 454 4975;4976;4977;4978;4979;4980;4981;4982;4983;4984;4985;4986;4987 2514;2515;2516;2517;2518;2519;2520;2521;2522;2523;2524 2519 SLWVINSALR 1 1 1 0 0 0 0 0 0 1 2 0 0 0 0 2 0 1 0 1 0 10 0 1157.6557 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 3.2548E-18 215.06 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4572600 0 0 0 0 33972 28723 72363 67249 0 0 0 0 0 0 0 0 1270700 1156500 680740 531580 0 0 0 0 0 0 0 0 0 0 0 136610 127600 235150 231380 449 45 455 4988;4989;4990;4991 2525;2526;2527;2528 2526 SLYYYIQQDTK 0 0 0 1 0 2 0 0 0 1 1 1 0 0 0 1 1 0 3 0 0 11 0 1420.6874 P07355;A6NMY6 P07355 ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein yes no 2 7.4309E-25 137.89 1 0 4 1 0 4 1 1 1 1 1 1 1 1 277170 0 0 0 0 0 0 0 0 0 0 0 0 59155 69164 73639 75214 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 450 33 456 4992 2529 2529 SMMCPPGMHK 0 0 0 0 1 0 0 1 1 0 0 1 3 0 2 1 0 0 0 0 0 10 0 1174.4756 O75592 O75592 KIAA0916;MYCBP2;PAM Myc-binding protein 2;Pam/highwire/rpm-1 protein;Probable E3 ubiquitin-protein ligase MYCBP2;Protein associated with Myc yes yes 2 0.10335 6.8882 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 451 33 457 4993;4994;4995;4996;4997;4998;4999;5000 2530 2530 SMMCPPGMHKWK 0 0 0 0 1 0 0 1 1 0 0 2 3 0 2 1 0 1 0 0 0 12 1 1488.6498 O75592 O75592 KIAA0916;MYCBP2;PAM Myc-binding protein 2;Pam/highwire/rpm-1 protein;Probable E3 ubiquitin-protein ligase MYCBP2;Protein associated with Myc yes yes 2 0.10301 5.1538 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2660400 0 0 0 0 0 0 0 0 262840 267940 0 0 0 239570 0 0 0 0 419470 0 568490 576860 0 0 0 0 0 0 63383 0 261850 0 0 0 0 452 86 458 5001;5002;5003;5004;5005;5006;5007;5008;5009;5010;5011;5012;5013;5014;5015 2531;2532 2532 SNTLPISLQSIR 0 1 1 0 0 1 0 0 0 2 2 0 0 0 1 3 1 0 0 0 0 12 0 1327.746 P42704 P42704 LRP130;LRPPRC 130 kDa leucine-rich protein;GP130;Leucine-rich PPR motif-containing protein, mitochondrial yes yes 2 0.0009181 140.14 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1620300 245660 211790 248050 274980 0 30930 45669 43364 0 0 0 0 40174 39192 53607 60411 0 0 0 0 127160 138700 0 0 0 0 27996 32628 0 0 0 0 0 0 0 453 38 459 5016;5017;5018;5019 2533 2533 SPSDCCHNQCAAGCTGPR 2 1 1 1 4 1 0 2 1 0 0 0 0 0 2 2 1 0 0 0 0 18 0 2033.756 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.063956 64.52 1 0 4 1 0 4 1 1 1 1 1 1 1 1 501020 217330 206560 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 46896 0 0 30232 0 0 0 0 0 0 0 0 0 0 0 454 66 460 5020;5021;5022;5023;5024;5025;5026;5027;5028;5029;5030 2534;2535;2536;2537;2538;2539;2540 2540 SPSQVQVADFGVADLLPPDDK 2 0 0 4 0 2 0 1 0 0 2 1 0 1 3 2 0 0 0 3 0 21 0 2197.0903 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 1.2984E-10 161.51 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 7931100 0 0 0 0 33643 0 1594700 1623800 0 0 0 0 0 0 0 0 401070 347210 910970 680910 0 0 0 0 0 0 1077200 1129400 0 0 0 0 0 65506 66677 455 54 461 5031;5032;5033;5034;5035;5036;5037;5038;5039;5040;5041;5042;5043;5044;5045;5046;5047;5048 2541;2542;2543;2544;2545;2546;2547;2548;2549 2548 SQIFSTASDNQPTVTIK 1 0 1 1 0 2 0 0 0 2 0 1 0 1 1 3 3 0 0 1 0 17 0 1835.9265 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2,3 9.7877E-16 184 1 0 18 1 0 18 2 2 2 1 1 1 1 2 2 2 1 1 2 2 2 1 1 1 1 2 2 2 1 1 2331100 341870 334370 295020 270900 94914 98262 101310 151070 0 0 0 0 0 0 0 0 0 0 0 0 264300 253290 0 0 0 0 54515 71294 0 0 0 0 0 0 0 456 55 462 5049;5050;5051;5052;5053;5054;5055;5056;5057;5058;5059;5060;5061;5062;5063;5064;5065;5066;5067;5068;5069;5070;5071;5072;5073;5074;5075;5076;5077;5078;5079;5080;5081;5082;5083;5084;5085;5086;5087;5088;5089;5090;5091;5092;5093;5094;5095;5096;5097;5098;5099 2550;2551;2552;2553;2554;2555;2556;2557;2558;2559;2560;2561;2562;2563;2564;2565;2566;2567;2568 2554 SQIHDIVLVGGSTR 0 1 0 1 0 1 0 2 1 2 1 0 0 0 0 2 1 0 0 2 0 14 0 1480.7998 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 2,3 7.3291E-06 163.99 1 0 51 1 0 51 2 2 3 2 2 2 2 2 2 2 2 2 1 2 2 2 1 1 2 2 2 2 1 2 2 1 1 2 2 2 3 2 2 2 2 2 2 2 2 2 1 2 2 2 1 1 2 2 2 2 1 2 2 1 1 2 9060300 1083400 913790 1221000 1204700 210870 245460 317460 298310 97385 86108 103050 79663 50074 100670 128800 122010 0 25670 0 42822 976360 888280 138260 178450 0 28850 168700 179990 0 0 24446 0 0 61640 83971 457 7 463 5100;5101;5102;5103;5104;5105;5106;5107;5108;5109;5110;5111;5112;5113;5114;5115;5116;5117;5118;5119;5120;5121;5122;5123;5124;5125;5126;5127;5128;5129;5130;5131;5132;5133 2569;2570;2571;2572;2573;2574;2575;2576;2577;2578;2579;2580;2581;2582;2583;2584;2585;2586;2587;2588;2589;2590;2591 2580 SSGSSYPSLLQCLK 0 0 0 0 1 1 0 1 0 0 3 1 0 0 1 5 0 0 1 0 0 14 0 1525.7446 CON__P00761 CON__P00761 yes yes 2 0.0079928 125.82 1 0 34 1 0 34 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 21440000 728970 748750 953980 958660 313510 401210 693130 728730 633960 563480 455850 519530 726560 733220 588220 588840 833950 880170 1066700 895910 563120 526960 0 0 0 32010 815180 848610 364310 364020 654430 730110 795900 889470 842520 + 458 186 464 5134;5135;5136;5137;5138;5139;5140;5141;5142;5143;5144;5145 2592;2593;2594;2595;2596 2594 SSLPPLLIPPSENLGPHEEDQVVCGFK 0 0 1 1 1 1 3 2 1 1 4 1 0 1 5 3 0 0 0 2 0 27 0 2958.4797 Q9UJM3 Q9UJM3 ERRFI1;MIG6 ERBB receptor feedback inhibitor 1;Mitogen-inducible gene 6 protein yes yes 3 3.5486E-08 100.59 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 14260000 1132700 987460 207420 219760 0 0 0 0 0 0 0 0 0 0 3722300 3698600 65244 0 385660 298090 1008600 918400 0 0 0 0 0 0 0 0 1615600 0 0 0 0 459 98 465 5146;5147;5148 2597;2598 2598 STDYGIFQINSR 0 1 1 1 0 1 0 1 0 2 0 0 0 1 0 2 1 0 1 0 0 12 0 1399.6732 P61626 P61626 LYZ;LZM 1,4-beta-N-acetylmuramidase C;Lysozyme C yes yes 2 2.1279E-11 186.46 1 0 3 1 0 3 1 1 1 1 1 1 358690 0 0 0 0 0 0 0 0 0 0 145780 125550 0 0 0 0 0 0 0 0 0 87369 0 0 0 0 0 0 0 0 0 0 0 0 0 460 56 466 5149;5150;5151;5152;5153;5154;5155;5156 2599;2600;2601;2602;2603;2604;2605 2600 STLVLHDLLK 0 0 0 1 0 0 0 0 1 0 4 1 0 0 0 1 1 0 0 1 0 10 0 1137.6758 P11274;Q12979 P11274 BCR;BCR1;D22S11;ABR Breakpoint cluster region protein;Renal carcinoma antigen NY-REN-26;Active breakpoint cluster region-related protein yes no 2 2.5211E-05 132.01 1 0 8 1 0 8 1 1 1 1 1 1 2 1 1 1 1 1 1 2 465810 0 0 0 0 0 0 0 0 0 0 0 0 68340 56861 66810 73946 0 0 0 0 0 0 0 0 0 0 0 0 58361 50503 90990 0 0 0 0 461 79 467 5157 2606 2606 STSSFSCLSR 0 1 0 0 1 0 0 0 0 0 1 0 0 1 0 5 1 0 0 0 0 10 0 1130.5026 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes no 2 0.096517 46.819 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 462 45 468 5158;5159;5160;5161;5162;5163;5164;5165;5166;5167;5168;5169 2607;2608;2609;2610;2611;2612;2613;2614 2609 STVHEILCK 0 0 0 0 1 0 1 0 1 1 1 1 0 0 0 1 1 0 0 1 0 9 0 1085.5539 P07355;A6NMY6 P07355 ANX2;ANX2L4;ANXA2;CAL1H;LPC2D;ANX2L2;ANX2P2;ANXA2P2;LPC2B Annexin A2;Annexin II;Annexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8;Lipocortin II;p36;Placental anticoagulant protein IV;Protein I;Annexin A2 pseudogene 2;Lipocortin II pseudogene;Putative annexin A2-like protein yes no 2 0.0032667 111.95 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 999870 114920 145350 116110 128740 21470 0 0 0 0 0 0 0 72878 87264 83896 75987 0 0 0 0 65769 48548 38946 0 0 0 0 0 0 0 0 0 0 0 0 463 171 469 5170;5171 2615 2615 SVAAFTADPLSLLR 3 1 0 1 0 0 0 0 0 0 3 0 0 1 1 2 1 0 0 1 0 14 0 1459.8035 Q96P48 Q96P48 ARAP1;CENTD2;KIAA0782 Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1;Centaurin-delta-2 yes yes 2 0.12078 69.602 1 0 2 1 0 2 1 1 1 1 125040 0 0 0 0 0 0 0 0 0 0 0 0 0 0 67723 57319 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 464 201 470 5172 2616 2616 SVQNWLR 0 1 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 7 0 901.477 REV__Q8IW35 REV__Q8IW35 yes yes 2 0.063346 91.906 1 0 1 1 0 1 1 1 100710 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 100710 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 465 78 471 5173;5174;5175;5176;5177;5178;5179;5180 2617;2618;2619;2620;2621;2622;2623;2624 2618 SVSAPQQIINPIR 1 1 1 0 0 2 0 0 0 3 0 0 0 0 2 2 0 0 0 1 0 13 0 1421.7991 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 2 4.7499E-07 172.11 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2898000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 270900 289590 416820 401570 0 0 0 0 0 0 0 0 0 0 0 317620 305320 452850 443370 466 22 472 5181;5182;5183;5184;5185;5186;5187;5188;5189;5190;5191;5192;5193;5194;5195;5196;5197;5198 2625;2626;2627;2628;2629 2625 SVVTVIDVFYK 0 0 0 1 0 0 0 0 0 1 0 1 0 1 0 1 1 0 1 4 0 11 0 1268.7016 CON__Q5D862;Q5D862 CON__Q5D862 FLG2;IFPS;FLG2;IFPS Filaggrin-2;Intermediate filament-associated and psoriasis-susceptibility protein yes no 2 0.00035771 134.57 1 0 18 1 0 18 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1749000 0 0 0 0 0 0 26921 32660 74017 73392 0 0 0 0 91707 78677 184980 187670 50320 37833 307620 261430 0 0 0 0 16076 0 0 0 246420 0 0 44944 34320 + 467 79 473 5199 2630 2630 TAAENDFVTLK 2 0 1 1 0 0 1 0 0 0 1 1 0 1 0 0 2 0 0 1 0 11 0 1207.6085 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes no 2 2.8774E-27 106.4 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 468 26;167 474 5200;5201;5202;5203;5204;5205;5206;5207;5208;5209;5210;5211;5212;5213;5214 2631;2632;2633;2634;2635;2636;2637;2638;2639;2640;2641;2642;2643;2644;2645 2631 TAIEAFNETIK 2 0 1 0 0 0 2 0 0 2 0 1 0 1 0 0 2 0 0 0 0 11 0 1235.6398 O00459;P27986;Q92569 O00459 PIK3R2;GRB1;PIK3R1;PIK3R3 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta;Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;Phosphatidylinositol 3-kinase regulatory subunit alpha;p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma no no 2 1.8174E-07 175.15 1 0 15 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 18029000 0 0 0 0 199550 197470 295800 322800 0 0 0 0 0 17150 0 0 2513600 2383000 3771900 3649200 0 0 0 0 0 0 62933 54856 0 0 0 965800 826600 1360700 1407800 469 89 475 5215;5216;5217;5218 2646;2647;2648;2649 2646 TALALEVGDIVK 2 0 0 1 0 0 1 1 0 1 2 1 0 0 0 0 1 0 0 2 0 12 0 1227.7075 P46109 P46109 CRKL Crk-like protein yes yes 2 4.0348E-59 156.58 1 0 4 1 0 4 1 1 1 1 1 1 1 1 864150 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 257870 247210 0 307230 0 0 0 0 0 0 0 0 0 0 0 51843 0 0 0 470 26 476 5219;5220;5221;5222;5223;5224;5225;5226;5227;5228;5229;5230;5231;5232;5233;5234 2650;2651;2652;2653;2654;2655;2656;2657 2654 TATGFGFAEPYNLYGSLK 2 0 1 0 0 0 1 3 0 0 2 1 0 2 1 1 2 0 2 0 0 18 0 1934.9414 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 2.9203E-10 169.92 1 0 16 1 0 16 1 1 1 1 2 1 3 3 1 1 1 1 1 1 1 2 1 3 3 1 1 1 29634000 0 0 0 0 0 0 55449 80786 0 0 0 0 0 0 34463 37418 3448500 3390500 11999000 10118000 0 0 0 0 0 0 0 30967 0 0 0 0 0 219530 219830 471 90 477 5235;5236;5237;5238 2658;2659 2658 TAVETAVLLLR 2 1 0 0 0 0 1 0 0 0 3 0 0 0 0 0 2 0 0 2 0 11 0 1184.7129 P49368 P49368 CCT3;CCTG;TRIC5 CCT-gamma;hTRiC5;T-complex protein 1 subunit gamma yes yes 2 0.034969 77.744 1 0 4 1 0 4 1 1 1 1 1 1 1 1 242550 70623 78266 46217 47448 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 472 128 478 5239;5240;5241;5242;5243;5244;5245;5246;5247;5248;5249;5250;5251 2660;2661;2662;2663;2664;2665;2666;2667;2668;2669 2669 TCWLAAFR 2 1 0 0 1 0 0 0 0 0 1 0 0 1 0 0 1 1 0 0 0 8 0 1023.496 Q14451 Q14451 GRB7 B47;Epidermal growth factor receptor GRB-7;GRB7 adapter protein;Growth factor receptor-bound protein 7 yes yes 2 0.00068554 132.57 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1241600 0 0 0 0 84833 113880 154040 165970 0 0 0 0 0 0 0 0 76252 93122 121170 84606 0 0 0 0 0 0 57079 0 0 0 0 49501 59911 92742 88532 473 38 479 5252;5253;5254;5255;5256;5257;5258;5259;5260;5261;5262;5263;5264;5265;5266;5267;5268;5269;5270;5271;5272;5273;5274;5275;5276;5277;5278;5279;5280;5281;5282;5283;5284;5285;5286;5287;5288;5289;5290;5291;5292;5293;5294;5295;5296;5297;5298;5299;5300;5301;5302;5303;5304;5305;5306;5307;5308;5309;5310;5311;5312;5313;5314;5315;5316;5317;5318;5319;5320;5321;5322;5323;5324;5325;5326;5327;5328;5329;5330;5331 2670;2671;2672;2673;2674;2675;2676;2677;2678;2679;2680;2681;2682;2683;2684;2685;2686;2687;2688;2689;2690;2691;2692;2693;2694;2695;2696;2697;2698;2699;2700;2701;2702;2703;2704;2705;2706;2707;2708;2709;2710;2711;2712;2713;2714;2715;2716;2717;2718;2719;2720;2721;2722 2670 TDLHAFENLEIIR 1 1 1 1 0 0 2 0 1 2 2 0 0 1 0 0 1 0 0 0 0 13 0 1569.8151 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 2.0609E-81 178.71 1 0 80 1 0 80 10 6 4 7 1 2 2 2 2 5 6 2 2 2 2 5 8 2 1 2 2 2 1 1 1 10 6 4 7 1 2 2 2 2 5 6 2 2 2 2 5 8 2 1 2 2 2 1 1 1 174640000 39614000 28011000 8123400 8463700 26090 0 361290 381990 0 0 0 0 884710 943390 16583000 16063000 515680 546520 2290400 1796100 22828000 22353000 0 0 0 0 258040 183880 129270 177800 3962200 26026 0 46212 68593 474 26 480 5332;5333;5334;5335 2723;2724;2725;2726 2723 TDWSLSDVDQWDTAALADGIK 3 0 0 5 0 1 0 1 0 1 2 1 0 0 0 2 2 2 0 1 0 21 0 2306.0703 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2,3 1.9277E-22 198.42 1 0 4 1 0 4 2 2 2 2 4994200 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2443200 2551000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 475 54 481 5336;5337;5338;5339;5340;5341;5342;5343;5344;5345;5346 2727;2728;2729;2730;2731;2732;2733;2734 2732 TFAPEEISAMVLTK 2 0 0 0 0 0 2 0 0 1 1 1 1 1 1 1 2 0 0 1 0 14 0 1535.7905 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2,3 0.0007759 146.07 1 0 11 1 0 11 2 2 1 1 1 1 2 1 2 2 1 1 1 1 2 1 2056100 525330 441040 205580 180170 0 0 89266 59046 0 0 0 0 0 0 0 0 0 0 0 0 332200 223460 0 0 0 0 0 0 0 0 0 0 0 0 0 476 140 482 5347;5348;5349;5350 2735 2735 TFVDFFSQCLHEEYR 0 1 0 1 1 1 2 0 1 0 1 0 0 3 0 1 1 0 1 1 0 15 0 1976.8727 Q53GQ0 Q53GQ0 HSD17B12 17-beta-hydroxysteroid dehydrogenase 12;3-ketoacyl-CoA reductase;Estradiol 17-beta-dehydrogenase 12 yes yes 3 0.064142 74.46 1 0 4 1 0 4 1 1 1 1 1 1 1 1 447120 144320 132610 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 103610 66588 0 0 0 0 0 0 0 0 0 0 0 0 0 477 69 483 5351;5352;5353;5354;5355;5356;5357;5358;5359 2736;2737 2736 TGAIVDVPVGEELLGR 1 1 0 1 0 0 2 3 0 1 2 0 0 0 1 0 1 0 0 3 0 16 0 1623.8832 P25705 P25705 ATP5A;ATP5A1;ATP5AL2;ATPM ATP synthase subunit alpha, mitochondrial yes yes 2 0.036702 74.678 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 667440 97747 82630 100090 119750 0 0 50357 48430 0 0 0 0 0 0 0 0 0 0 0 0 80791 62721 0 0 0 0 24924 0 0 0 0 0 0 0 0 478 130 484 5360;5361;5362;5363;5364;5365;5366;5367 2738;2739;2740;2741 2740 TGEAIVDAALSALR 4 1 0 1 0 0 1 1 0 1 2 0 0 0 0 1 1 0 0 1 0 14 0 1385.7514 Q15084 Q15084 PDIA6;TXNDC7 Protein disulfide isomerase P5;Protein disulfide-isomerase A6;Thioredoxin domain-containing protein 7 yes yes 2,3 0.010459 98.942 1 0 8 1 0 8 2 2 3 1 2 2 3 1 702110 241150 220420 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 189340 51199 0 0 0 0 0 0 0 0 0 0 0 0 0 479 78 485 5368;5369;5370;5371;5372;5373;5374 2742;2743;2744;2745 2743 TGIAAEEVSLPR 2 1 0 0 0 0 2 1 0 1 1 0 0 0 1 1 1 0 0 1 0 12 0 1241.6616 P35568 P35568 IRS1 Insulin receptor substrate 1 yes yes 2 0.005675 100.72 1 0 7 1 0 7 2 1 1 1 1 1 2 1 1 1 1 1 311060 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 61026 0 48568 66652 0 0 0 0 0 0 0 0 0 0 0 35964 0 46474 52376 480 26 486 5375;5376;5377;5378;5379;5380;5381 2746;2747;2748;2749;2750 2747 TGLDSESHYRPELPAPR 1 2 0 1 0 0 2 1 1 0 2 0 0 0 3 2 1 0 1 0 0 17 1 1923.9439 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 0.00088797 101.32 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1963900 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 280390 256760 529200 464340 0 0 0 0 0 0 0 0 0 0 0 0 112340 156470 164390 481 25 487 5382;5383;5384;5385 2751;2752;2753;2754 2751 TGLIEVVLR 0 1 0 0 0 0 1 1 0 1 2 0 0 0 0 0 1 0 0 2 0 9 0 998.61243 O00329 O00329 PIK3CD Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform yes yes 2 0.00088014 124.92 1 0 4 1 0 4 1 1 1 1 1 1 1 1 217460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 61736 55318 50814 49595 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 482 85 488 5386;5387 2755 2755 TGQLFHIDFGHILGNFK 0 0 1 1 0 1 0 3 2 2 2 1 0 3 0 0 1 0 0 0 0 17 0 1943.0054 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 3 0.0037571 83.692 1 0 2 1 0 2 1 1 1 1 215270 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 101130 114140 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 483 65 489 5388;5389;5390;5391;5392;5393;5394 2756;2757;2758;2759;2760;2761 2756 TGTFCALSTVLER 1 1 0 0 1 0 1 1 0 0 2 0 0 1 0 1 3 0 0 1 0 13 0 1453.7235 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 2 0.0015108 142.08 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2585900 0 0 0 0 0 0 0 0 0 0 0 0 313330 387020 619600 608150 0 0 0 0 0 0 0 0 0 0 0 0 154960 140810 362080 0 0 0 0 484 35 490 5395;5396;5397;5398;5399;5400;5401;5402 2762;2763;2764 2764 THIDTVINALK 1 0 1 1 0 0 0 0 1 2 1 1 0 0 0 0 2 0 0 1 0 11 0 1223.6874 O95782 O95782 ADTAA;AP2A1;CLAPA1 100 kDa coated vesicle protein A;Adapter-related protein complex 2 alpha-1 subunit;Adaptor protein complex AP-2 subunit alpha-1;Alpha1-adaptin;Alpha-adaptin A;AP-2 complex subunit alpha-1;Clathrin assembly protein complex 2 alpha-A large chain;Plasma membrane adaptor HA2/AP2 adaptin alpha A subunit yes yes 2 0.0068122 96.229 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 475630 53394 61261 41137 0 0 0 0 0 0 0 0 0 66476 69589 80573 74788 0 0 0 0 0 0 0 0 0 0 0 0 28410 0 0 0 0 0 0 485 40 491 5403;5404;5405;5406;5407;5408;5409;5410;5411;5412;5413;5414;5415 2765;2766;2767;2768;2769;2770;2771;2772;2773;2774;2775;2776 2775 THNLEPYFESFINNLR 0 1 3 0 0 0 2 0 1 1 2 0 0 2 1 1 1 0 1 0 0 16 0 1992.9694 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2,3 2.1038E-08 178.15 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 13029000 398250 412090 0 0 0 0 0 0 511580 444570 0 0 0 0 1096600 1054300 39389 0 514350 383320 1989500 1830800 0 0 0 0 0 0 0 0 4354300 0 0 0 0 + 486 40 492 5416;5417;5418;5419;5420;5421;5422;5423;5424;5425;5426 2777;2778 2777 THNLEPYFESFINNLRR 0 2 3 0 0 0 2 0 1 1 2 0 0 2 1 1 1 0 1 0 0 17 1 2149.0705 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 3 0.0098668 84.753 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2582100 129350 115330 0 0 0 0 0 0 158190 115850 0 0 0 0 315980 297830 0 0 109590 106250 355630 299850 0 0 0 0 0 0 0 0 578260 0 0 0 0 + 487 5;150 493 5427;5428 2779 2779 TIGGGDDSFNTFFSETGAGK 1 0 1 2 0 0 1 5 0 1 0 1 0 3 0 2 3 0 0 0 0 20 0 2006.8858 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain no no 2 2.116E-07 138.66 1 0 2 NaN NaN 1 1 804240 0 0 411350 392890 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 488 38 494 5429;5430;5431;5432;5433;5434;5435 2780;2781;2782 2781 TIQEVAGYVLIALNTVER 2 1 1 0 0 1 2 1 0 2 2 0 0 0 0 0 2 0 1 3 0 18 0 1988.0942 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 3 0.00039181 121.99 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1114400 154130 120010 0 0 0 0 0 0 0 0 0 0 0 0 207900 170930 0 0 0 0 231240 197520 0 0 0 0 0 0 0 0 32658 0 0 0 0 489 150 495 5436;5437;5438;5439;5440;5441;5442;5443;5444;5445 2783;2784;2785 2783 TIQFVDWCPTGFK 0 0 0 1 1 1 0 1 0 1 0 1 0 2 1 0 2 1 0 1 0 13 0 1597.7599 Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65 Q71U36 TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2 Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain yes no 2 0.00017078 157.56 1 0 10 1 0 10 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1617500 385040 375110 228310 167730 0 0 39249 50252 0 0 0 0 0 0 79381 84470 0 0 0 0 121200 86784 0 0 0 0 0 0 0 0 0 0 0 0 0 490 51 496 5446 2786 2786 TITLEVEPSDTIENVK 0 0 1 1 0 0 3 0 0 2 1 1 0 0 1 1 3 0 0 2 0 16 0 1786.92 P0CG48;P0CG47;P62979;P62987 P0CG48 RPS27A;UBA80;UBCEP1;UBA52;UBCEP2 40S ribosomal protein S27a;60S ribosomal protein L40;CEP52 yes no 2 0.077503 50.843 1 0 1 1 0 1 1 1 67380 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 67380 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 491 26 497 5447;5448;5449;5450;5451;5452;5453 2787;2788;2789;2790;2791 2787 TKLEQQLR 0 1 0 0 0 2 1 0 0 0 2 1 0 0 0 0 1 0 0 0 0 8 1 1014.5822 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 2 0.00032688 139.88 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 812070 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 125250 127580 184830 185130 0 0 0 0 0 0 0 0 0 0 0 0 43729 72190 73354 492 54 498 5454;5455;5456;5457;5458;5459;5460;5461;5462 2792;2793 2793 TKPYIQVDIGGGQTK 0 0 0 1 0 2 0 3 0 2 0 2 0 0 1 0 2 0 1 1 0 15 1 1603.857 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 3 0.0087674 95.273 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 479190 62468 91005 69266 54821 47101 28550 38348 0 0 0 0 0 0 0 0 0 0 0 0 0 53427 34202 0 0 0 0 0 0 0 0 0 0 0 0 0 493 158 499 5463;5464;5465;5466;5467 2794;2795;2796 2796 TLDTIQLAFK 1 0 0 1 0 1 0 0 0 1 2 1 0 1 0 0 2 0 0 0 0 10 0 1148.6441 Q8NF37 Q8NF37 AYTL2;LPCAT1;PFAAP3 1-acylglycerophosphocholine O-acyltransferase;1-alkylglycerophosphocholine O-acetyltransferase;Acetyl-CoA:lyso-platelet-activating factor acetyltransferase;Acyltransferase-like 2;Lysophosphatidylcholine acyltransferase 1;Phosphonoformate immuno-associated protein 3 yes yes 2 0.043728 77.192 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 317160 77938 80560 47089 69757 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 41811 0 0 0 0 0 0 0 0 0 0 0 0 0 494 19 500 5468;5469;5470;5471;5472;5473;5474;5475;5476;5477;5478;5479;5480;5481;5482;5483;5484;5485;5486;5487;5488;5489;5490;5491;5492;5493;5494;5495;5496;5497;5498;5499;5500;5501 2797;2798;2799;2800;2801;2802;2803;2804;2805;2806;2807;2808;2809;2810;2811;2812;2813;2814;2815;2816;2817;2818;2819;2820;2821;2822 2815 TLLDIDNTR 0 1 1 2 0 0 0 0 0 1 2 0 0 0 0 0 2 0 0 0 0 9 0 1059.556 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 2 3.8711E-05 136.57 1 0 34 1 0 34 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 8775400 66800 60062 202890 166840 205490 174600 144310 149490 252390 261630 330440 285640 393380 472230 92715 79075 591990 515090 227870 209800 370420 387120 0 0 422640 368640 107820 92723 196350 208340 493250 149900 148000 476770 470700 + 495 40 501 5502;5503;5504;5505;5506;5507;5508;5509;5510;5511;5512;5513;5514;5515;5516;5517;5518;5519;5520;5521;5522;5523;5524;5525;5526;5527;5528 2823;2824;2825;2826;2827;2828;2829;2830 2829 TLLEGEESR 0 1 0 0 0 0 3 1 0 0 2 0 0 0 0 1 1 0 0 0 0 9 0 1032.5088 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 no no 2 5.3569E-08 147.19 1 0 27 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3235200 0 0 93293 105160 135240 142800 62684 50936 85583 77304 97631 121320 100940 111730 80209 101700 253590 229140 71406 68199 229480 199160 0 0 137460 135550 0 34273 95082 97929 202900 0 0 0 114490 + 496 191 502 5529;5530;5531;5532;5533;5534;5535;5536 2831 2831 TLNDDASPPLPYLR 1 1 1 2 0 0 0 0 0 0 3 0 0 0 3 1 1 0 1 0 0 14 0 1570.7991 REV__E9PKD4 REV__E9PKD4 yes yes 3 0.057161 76.326 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 925580 163070 144160 169280 163600 0 0 0 0 0 0 0 0 0 0 52859 74395 0 0 0 0 58578 99638 0 0 0 0 0 0 0 0 0 0 0 0 0 + 497 19 503 5537;5538;5539;5540;5541;5542;5543;5544;5545;5546;5547;5548;5549 2832;2833 2833 5 TLNDMRQEYEQLIAK 1 1 1 1 0 2 2 0 0 1 2 1 1 0 0 0 1 0 1 0 0 15 1 1850.9196 CON__P35527;P35527 CON__P35527 KRT9;KRT9 Cytokeratin-9;Keratin, type I cytoskeletal 9;Keratin-9 yes no 3 0.032706 81.431 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 755190 0 0 35815 41120 0 0 0 22252 0 0 0 0 92253 80568 0 0 73246 63034 0 0 0 45348 0 0 0 0 0 0 48720 38962 27141 0 0 95884 90844 + 498 40 504 5550;5551;5552;5553;5554;5555;5556;5557;5558;5559;5560;5561;5562;5563;5564;5565;5566;5567;5568;5569;5570 2834;2835;2836;2837;2838;2839;2840;2841;2842;2843;2844;2845;2846;2847;2848;2849;2850 2843 TNAENEFVTIK 1 0 2 0 0 0 2 0 0 1 0 1 0 1 0 0 2 0 0 1 0 11 0 1264.6299 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 4.842E-08 156.58 1 0 21 1 0 21 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1429100 0 0 0 0 66376 55820 0 0 47920 0 82565 79817 59321 63903 34703 0 145850 137880 31745 0 101310 89320 0 0 47019 51943 0 0 28683 28720 124490 0 0 70505 81206 + 499 40 505 5571 2851 2851 TNAENEFVTIKK 1 0 2 0 0 0 2 0 0 1 0 2 0 1 0 0 2 0 0 1 0 12 1 1392.7249 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 0.00013366 67.385 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 500 38 506 5572;5573;5574;5575;5576;5577;5578;5579;5580;5581;5582;5583;5584;5585;5586;5587;5588;5589;5590;5591;5592;5593;5594;5595;5596;5597;5598;5599;5600;5601;5602;5603;5604;5605;5606;5607;5608;5609;5610;5611;5612 2852;2853;2854;2855;2856;2857;2858;2859;2860;2861;2862;2863;2864;2865;2866;2867;2868;2869;2870;2871 2862 TPLLSSLSATSNNSTVACIDR 2 1 2 1 1 0 0 0 0 1 3 0 0 0 1 5 3 0 0 1 0 21 0 2206.09 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2,3 2.1008E-67 260.96 1 0 41 1 0 41 4 4 3 2 2 2 2 2 2 2 2 2 1 2 2 3 2 2 4 4 3 2 2 2 2 2 2 2 2 2 1 2 2 3 2 2 160830000 34030000 63481000 6208200 4292100 0 0 208070 221990 0 0 0 0 413860 345410 7986100 8199800 227530 205500 400850 684700 18066000 13812000 0 0 0 0 0 164920 0 0 1881900 0 0 0 0 501 82 507 5613;5614 2872 2872 TQIQSVEPYTK 0 0 0 0 0 2 1 0 0 1 0 1 0 0 1 1 2 0 1 1 0 11 0 1292.6612 P40763 P40763 APRF;STAT3 Acute-phase response factor;Signal transducer and activator of transcription 3 yes yes 2 0.14904 60.434 1 0 2 1 0 2 1 1 1 1 372600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 202930 169670 502 122 508 5615;5616;5617;5618;5619;5620;5621 2873;2874;2875 2875 TRPACQDWTVPLPASAGR 3 2 0 1 1 1 0 1 0 0 1 0 0 0 3 1 2 1 0 1 0 18 1 1981.9792 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 3 0.026172 72.315 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1628900 0 0 0 0 0 0 0 0 0 0 0 0 369130 340230 386330 365600 0 0 0 0 0 0 0 0 0 0 0 0 33360 40022 94211 0 0 0 0 503 55;52;64 509 5622;5623;5624;5625;5626;5627;5628;5629;5630;5631 2876;2877;2878;2879;2880 2876 TTPSYVAFTDTER 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 1 4 0 1 1 0 13 0 1486.694 P0DMV8;P0DMV9;P11142;P54652;P17066;P48741 P11142 HSC70;HSP73;HSPA10;HSPA8;HSPA2;HSP70B;HSPA6;HSP70B;HSPA7 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein;Heat shock-related 70 kDa protein 2;Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7 no no 2 0.0051653 119.39 1 0 10 NaN NaN 1 1 1 1 1 1 1 1 1 1 1593900 317340 308720 254850 258530 0 35799 61291 45836 0 0 0 0 0 0 0 0 0 0 0 0 147640 132080 0 0 0 0 0 31816 0 0 0 0 0 0 0 504 55 510 5632;5633;5634;5635;5636;5637;5638;5639;5640;5641;5642;5643;5644;5645;5646;5647;5648;5649;5650;5651;5652;5653;5654;5655;5656;5657;5658;5659;5660;5661;5662;5663;5664;5665;5666 2881;2882;2883;2884;2885;2886;2887;2888;2889;2890;2891;2892;2893;2894;2895;2896;2897;2898;2899 2896 TVTNAVVTVPAYFNDSQR 2 1 2 1 0 1 0 0 0 0 0 0 0 1 1 1 3 0 1 4 0 18 0 1980.9905 P11142 P11142 HSC70;HSP73;HSPA10;HSPA8 Heat shock 70 kDa protein 8;Heat shock cognate 71 kDa protein yes yes 2,3 2.433E-07 162.81 1 0 35 1 0 35 2 2 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 2 2 2 10438000 1782400 1785800 1378900 1604400 139930 163700 279400 339290 0 103810 0 0 42301 42462 168050 95735 43207 0 0 26102 972170 922470 0 0 0 0 239570 203500 0 0 0 0 0 0 104620 505 117 511 5667;5668;5669;5670;5671;5672 2900 2900 TVWQYHFR 0 1 0 0 0 1 0 0 1 0 0 0 0 1 0 0 1 1 1 1 0 8 0 1135.5563 Q06124 Q06124 PTP2C;PTPN11;SHPTP2 Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11 yes yes 2 0.036183 94.302 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 301020 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 57852 37105 70334 60924 0 0 0 0 0 0 0 0 0 0 0 0 26183 0 48622 506 126 512 5673 2901 2901 TWELSKQWSEK 0 0 0 0 0 1 2 0 0 0 1 2 0 0 0 2 1 2 0 0 0 11 1 1420.6987 Q13946 Q13946 PDE7A HCP1;High affinity cAMP-specific 3,5-cyclic phosphodiesterase 7A;TM22 yes yes 2 0.081067 56.404 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 507 167 513 5674;5675;5676;5677 2902;2903 2902 TWFVEDINR 0 1 1 1 0 0 1 0 0 1 0 0 0 1 0 0 1 1 0 1 0 9 0 1178.572 Q92569 Q92569 PIK3R3 p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma yes yes 2 0.010688 95.502 1 0 4 1 0 4 1 1 1 1 1 1 1 1 374350 0 0 0 0 70211 62214 187200 0 0 0 0 0 0 0 0 0 0 0 0 54721 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 508 54 514 5678;5679;5680;5681;5682;5683;5684 2904;2905;2906 2906 TWNDPSVQQDIK 0 0 1 2 0 2 0 0 0 1 0 1 0 0 1 1 1 1 0 1 0 12 0 1429.6838 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.0021398 121.02 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 491040 106670 100390 64345 73920 0 37250 0 0 0 0 0 0 0 0 0 0 0 0 0 0 60074 48384 0 0 0 0 0 0 0 0 0 0 0 0 0 509 68 515 5685;5686;5687 2907;2908 2907 VALLDVFR 1 1 0 1 0 0 0 0 0 0 2 0 0 1 0 0 0 0 0 2 0 8 0 931.5491 P25205 P25205 MCM3 DNA polymerase alpha holoenzyme-associated protein P1;DNA replication licensing factor MCM3;p102;P1-MCM3;RLF subunit beta yes yes 2 0.0082011 91.906 1 0 3 1 0 3 1 1 1 1 1 1 73961 0 34911 0 0 0 0 0 0 0 0 0 0 0 0 39050 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 510 188 516 5688;5689;5690;5691;5692;5693;5694;5695 2909;2910 2910 VALLPAGGALQHSR 3 1 0 0 0 1 0 2 1 0 3 0 0 0 1 1 0 0 0 1 0 14 0 1388.7888 Q9Y4H2 Q9Y4H2 IRS2 Insulin receptor substrate 2 yes yes 3 0.047612 78.342 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1266800 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 125310 96905 191670 180600 0 0 0 0 0 0 0 0 0 0 0 125640 125230 191760 229720 511 102 517 5696;5697;5698;5699;5700;5701;5702 2911;2912;2913 2911 VANVSLLALYK 2 0 1 0 0 0 0 0 0 0 3 1 0 0 0 1 0 0 1 2 0 11 0 1189.7071 P62266 P62266 RPS23 40S ribosomal protein S23 yes yes 2 0.00075827 119.27 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 350830 48213 61472 52534 46212 0 0 0 0 0 0 0 0 0 0 34052 0 0 0 0 0 47762 60583 0 0 0 0 0 0 0 0 0 0 0 0 0 512 38 518 5703;5704;5705;5706;5707;5708;5709;5710;5711;5712;5713;5714 2914;2915;2916;2917;2918;2919;2920;2921 2917 VAPQSSEFIGA 2 0 0 0 0 1 1 1 0 1 0 0 0 1 1 2 0 0 0 1 0 11 0 1104.5451 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.019915 86.898 1 0 12 1 0 12 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1427500 127260 105900 101480 92234 0 0 0 0 0 0 0 0 157120 183260 255610 219030 0 0 27030 0 0 0 0 0 0 0 0 0 48820 50715 59037 0 0 0 0 513 7 519 5715;5716;5717;5718;5719;5720;5721;5722;5723;5724;5725;5726;5727;5728;5729;5730;5731;5732;5733 2922 2922 VATVSLPR 1 1 0 0 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 2 0 8 0 841.50215 CON__P00761 CON__P00761 yes yes 1 0.091971 84.244 1 0 19 1 0 19 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 17396000 1140000 1123800 1381000 1381100 691210 680220 0 0 780580 996240 1091400 0 0 748530 846990 0 564750 0 0 835800 839630 836290 0 673320 0 0 0 0 683080 642860 1459100 0 0 0 0 + 514 66 520 5734;5735;5736;5737;5738;5739 2923 2923 VCDPLCSSGGCWGPGPGQCLSCR 0 1 0 1 5 1 0 5 0 0 2 0 0 0 3 3 0 1 0 1 0 23 0 2566.028 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 3 5.0544E-17 175.51 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 1204200 0 0 0 0 0 0 297310 352960 0 0 0 0 0 0 0 0 0 63072 100110 0 0 0 0 0 0 0 205510 185270 0 0 0 0 0 0 0 515 38 521 5740;5741;5742;5743;5744 2924;2925 2925 VCNGIGIGEFK 0 0 1 0 1 0 1 3 0 2 0 1 0 1 0 0 0 0 0 1 0 11 0 1192.591 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.00044575 134.57 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 507440 142420 136800 90926 99729 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 37556 0 0 0 0 0 0 0 0 0 0 0 0 0 0 516 7 522 5745;5746;5747;5748;5749;5750;5751;5752;5753;5754;5755 2926;2927;2928;2929;2930;2931;2932;2933;2934;2935;2936 2934 VCNYVNWIQQTIAAN 2 0 3 0 1 2 0 0 0 2 0 0 0 0 0 0 1 1 1 2 0 15 0 1792.8567 CON__P00761 CON__P00761 yes yes 2 1.7513E-40 248.64 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 20143000 2031800 1689800 0 0 0 0 0 0 304000 303940 0 0 0 0 3100200 3091300 0 0 1881200 1728100 2511900 2226800 0 0 0 0 0 0 0 0 1274100 0 0 0 0 + 517 79 523 5756;5757;5758;5759;5760;5761;5762;5763;5764;5765;5766;5767;5768;5769;5770;5771;5772;5773;5774;5775;5776;5777;5778;5779;5780;5781;5782;5783 2937;2938;2939;2940;2941;2942;2943;2944;2945;2946;2947;2948;2949;2950;2951;2952;2953;2954;2955;2956;2957;2958 2953 VDLLNQEIEFLK 0 0 1 1 0 1 2 0 0 1 3 1 0 1 0 0 0 0 0 1 0 12 0 1459.7922 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes no 2 2.7689E-35 237.53 1 0 28 1 0 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3 1 1 1 1 1 1 1 2 1 1 22339000 375230 352960 733640 717040 47442 112230 359270 329880 530590 548920 0 0 148650 146670 1209400 1064800 2314000 1986400 824210 821240 2200100 1967600 0 0 0 0 347690 297620 0 0 4205500 0 0 336260 361880 + 518 198 524 5784;5785 2959 2959 VDQLSGMEEKR 0 1 0 1 0 1 2 1 0 0 1 1 1 0 0 1 0 0 0 1 0 11 1 1290.6238 REV__Q6ZU80 REV__Q6ZU80 yes yes 2 0.088848 79.974 1 0 2 1 0 2 1 1 1 1 1025200 0 0 446400 578790 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 519 119 525 5786;5787;5788;5789 2960;2961;2962 2961 VEEQEPELTSTPNFVVEVIK 0 0 1 0 0 1 5 0 0 1 1 1 0 1 2 1 2 0 0 4 0 20 0 2286.1631 Q07021 Q07021 C1QBP;GC1QBP;HABP1;SF2P32 Complement component 1 Q subcomponent-binding protein, mitochondrial;GC1q-R protein;Glycoprotein gC1qBP;Hyaluronan-binding protein 1;Mitochondrial matrix protein p32;p33 yes yes 2,3 3.7208E-06 109.04 1 0 4 1 0 4 2 2 2 2 8298800 0 0 0 0 0 0 0 0 4150000 4148700 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 520 64 526 5790;5791;5792;5793;5794;5795;5796;5797;5798 2963;2964;2965;2966;2967 2963 VEILANDQGNR 1 1 2 1 0 1 1 1 0 1 1 0 0 0 0 0 0 0 0 1 0 11 0 1227.6208 P17066;P48741 P17066 HSP70B;HSPA6;HSP70B;HSPA7 Heat shock 70 kDa protein 6;Heat shock 70 kDa protein B;Heat shock 70 kDa protein B;Putative heat shock 70 kDa protein 7 yes no 2 0.00013774 145.99 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 817460 125750 108350 101550 122220 30258 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 62951 77743 110560 78075 0 0 0 0 0 0 0 0 0 0 0 521 168 527 5799;5800;5801;5802 2968 2968 VETQPEVQLPGPAPNLR 1 1 1 0 0 2 2 1 0 0 2 0 0 0 4 0 1 0 0 2 0 17 0 1843.9792 Q92859 Q92859 IGDCC2;NEO1;NGN Immunoglobulin superfamily DCC subclass member 2;Neogenin yes yes 3 0.055442 65.472 1 0 4 1 0 4 1 1 1 1 1 1 1 1 492810 0 0 0 0 0 0 0 0 0 0 0 0 0 0 169600 195980 0 0 54551 0 0 0 0 0 0 0 0 0 0 0 72677 0 0 0 0 522 85 528 5803;5804 2969;2970 2970 VEYVFGDHPLIQFQYIR 0 1 0 1 0 2 1 1 1 2 1 0 0 2 1 0 0 0 2 2 0 17 0 2123.084 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 3 0.00090246 111.12 1 0 2 1 0 2 1 1 1 1 657850 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 356920 300920 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 523 85 529 5805;5806;5807;5808;5809;5810;5811;5812;5813;5814;5815;5816;5817 2971;2972;2973;2974;2975;2976;2977;2978;2979;2980;2981;2982 2977 VFGEDSVGVIFK 0 0 0 1 0 0 1 2 0 1 0 1 0 2 0 1 0 0 0 3 0 12 0 1295.6762 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2 1.8235E-11 188.28 1 0 13 1 0 13 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3538500 0 0 0 0 0 49157 83959 94229 0 0 0 0 0 0 0 0 506940 408620 583100 444210 0 0 0 0 0 0 49611 0 0 0 0 163390 155050 467180 533030 524 104 530 5818;5819;5820;5821;5822;5823;5824;5825;5826 2983 2983 VFLENVIR 0 1 1 0 0 0 1 0 0 1 1 0 0 1 0 0 0 0 0 2 0 8 0 988.57057 P62805 P62805 H4/A;H4/B;H4/C;H4/D;H4/E;H4/G;H4/H;H4/I;H4/J;H4/K;H4/M;H4/N;H4/O;H4F2;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4FO;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4 Histone H4 yes yes 2 0.065911 88.942 1 0 9 1 0 9 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 472350 26310 0 0 0 0 0 0 0 0 0 0 26437 77177 105550 0 0 41589 0 0 0 36270 0 0 0 0 0 0 0 52692 63848 42483 0 0 0 0 525 59 531 5827 2984 2984 VFSGLVSTGLK 0 0 0 0 0 0 0 2 0 0 2 1 0 1 0 2 1 0 0 2 0 11 0 1106.6336 P13639 P13639 EEF2;EF2 Elongation factor 2 yes yes 2 6.7146E-06 68.893 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 526 5;150;109 532 5828;5829;5830;5831;5832;5833;5834 2985;2986;2987 2986 VGINYQPPTVVPGGDLAK 1 0 1 1 0 1 0 3 0 1 1 1 0 0 3 0 1 0 1 3 0 18 0 1823.9781 CON__ENSEMBL:ENSBTAP00000016242;P68363;Q71U36;Q9BQE3;Q13748;Q6PEY2;Q9NY65;P68366 CON__ENSEMBL:ENSBTAP00000016242 TUBA1B;TUBA1A;TUBA3;TUBA1C;TUBA6;TUBA2;TUBA3C;TUBA3D;TUBA3E;TUBA8;TUBAL2;TUBA1;TUBA4A Alpha-tubulin ubiquitous;Tubulin alpha-1B chain;Tubulin alpha-ubiquitous chain;Tubulin K-alpha-1;Alpha-tubulin 3;Tubulin alpha-1A chain;Tubulin alpha-3 chain;Tubulin B-alpha-1;Alpha-tubulin 6;Tubulin alpha-1C chain;Tubulin alpha-6 chain;Alpha-tubulin 2;Alpha-tubulin 3C/D;Tubulin alpha-2 chain;Tubulin alpha-3C/D chain;Alpha-tubulin 3E;Tubulin alpha-3E chain;Alpha-tubulin 8;Tubulin alpha chain-like 2;Tubulin alpha-8 chain;Alpha-tubulin 1;Testis-specific alpha-tubulin;Tubulin alpha-1 chain;Tubulin alpha-4A chain;Tubulin H2-alpha no no 2 0.0012176 91.355 1 0 7 NaN NaN 1 1 1 1 1 1 1 837370 129870 121010 228800 231240 0 0 34710 0 0 0 0 0 44660 0 0 47084 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 527 88 533 5835;5836;5837;5838;5839 2988 2988 VIFFLPWQK 0 0 0 0 0 1 0 0 0 1 1 1 0 2 1 0 0 1 0 1 0 9 0 1176.6696 P43304 P43304 GPD2 Glycerol-3-phosphate dehydrogenase, mitochondrial;mtGPD yes yes 2 0.034641 86.794 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 375620 142120 131110 0 0 0 0 0 0 0 0 0 0 0 0 38905 43579 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19896 0 0 0 0 528 47;48 534 5840;5841;5842 2989 2989 VILHLKEDQTEYLEER 0 1 0 1 0 1 4 0 1 1 3 1 0 0 0 0 1 0 1 1 0 16 1 2014.0371 P07900;Q58FF7;Q58FF6;P08238 P07900 HSP90A;HSP90AA1;HSPC1;HSPCA;HSP90AB3P;HSP90BC;HSP90AB4P;HSP90AB1;HSP90B;HSPC2;HSPCB Heat shock 86 kDa;Heat shock protein HSP 90-alpha;Renal carcinoma antigen NY-REN-38;Heat shock protein 90-beta c;Putative heat shock protein HSP 90-beta-3;Putative heat shock protein HSP 90-beta 4;Heat shock 84 kDa;Heat shock protein HSP 90-beta no no 3 0.026164 76.262 1 0 3 NaN NaN 1 1 1 227870 105560 98810 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 23492 0 0 0 0 0 0 0 0 529 65 535 5843;5844;5845 2990 2990 VKAEGILDVFQTVK 1 0 0 1 0 1 1 1 0 1 1 2 0 1 0 0 1 0 0 3 0 14 1 1545.8766 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 3 0.0163 91.858 1 0 3 1 0 3 1 1 1 1 1 1 189200 0 0 0 0 0 0 0 0 0 0 0 0 0 0 54231 66189 0 0 0 0 0 0 0 0 0 0 0 0 0 0 68781 0 0 0 0 530 204 536 5846;5847;5848;5849;5850;5851;5852;5853;5854;5855;5856 2991;2992;2993;2994;2995;2996;2997 2995 VKTEAPVR 1 1 0 0 0 0 1 0 0 0 0 1 0 0 1 0 1 0 0 2 0 8 1 898.52362 REV__Q8WXI4 REV__Q8WXI4 yes yes 2 0.084877 85.212 1 0 11 1 0 11 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 2 1 1 111250000 0 0 17570000 0 0 11691000 0 0 0 0 0 0 0 15158000 0 0 11988000 0 0 13067000 17342000 0 12670000 0 0 0 0 0 0 11606000 80891 77825 0 0 0 + 531 8;15;13 537 5857;5858;5859;5860;5861;5862;5863;5864;5865;5866;5867;5868;5869;5870;5871;5872;5873;5874;5875;5876;5877;5878;5879;5880;5881;5882;5883;5884;5885 2998;2999;3000;3001;3002;3003;3004;3005;3006;3007;3008;3009;3010;3011;3012 3001 VLDELTLAR 1 1 0 1 0 0 1 0 0 0 3 0 0 0 0 0 1 0 0 1 0 9 0 1028.5866 CON__P19001;CON__P08727;P08727;CON__P19012;P19012;CON__Q9QWL7;CON__Q04695;Q04695;CON__P02533;P02533;CON__A2A4G1;CON__Q6IFX2;CON__P08779;P08779 CON__P02533 Krt1-19;Krt19;KRT19;KRT19;KRT15;KRTB;KRT15;KRTB;Krt1-17;Krt17;KRT17;KRT17;KRT14;KRT14;Ka22;Krt42;KRT16;KRT16A;KRT16;KRT16A Cytokeratin-19;Keratin, type I cytoskeletal 19;Keratin-19;Cytokeratin-15;Keratin, type I cytoskeletal 15;Keratin-15;Cytokeratin-17;Keratin, type I cytoskeletal 17;Keratin-17;39.1;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14;Cytokeratin-42;Keratin, type I cytoskeletal 42;Keratin-17n;Keratin-42;Type I keratin Ka22;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16 no no 2 1.4963E-09 168.27 1 0 29 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4287000 91710 79807 270190 302470 134430 146330 36203 0 139470 126740 276630 272710 158430 148050 110320 116510 172580 150710 39064 0 184570 222270 0 0 100530 97572 44463 0 110570 104920 320100 30033 0 175000 124670 + 532 16 538 5886;5887;5888;5889;5890;5891;5892;5893;5894;5895;5896;5897;5898;5899;5900;5901;5902;5903;5904;5905;5906;5907;5908;5909;5910;5911;5912;5913;5914;5915;5916;5917;5918;5919 3013;3014;3015;3016;3017;3018;3019;3020;3021;3022;3023;3024;3025;3026;3027;3028;3029;3030;3031;3032;3033;3034;3035;3036;3037;3038;3039;3040;3041;3042;3043;3044 3024 VLDELTLTK 0 0 0 1 0 0 1 0 0 0 3 1 0 0 0 0 2 0 0 1 0 9 0 1030.591 CON__P13645;P13645 CON__P13645 KPP;KRT10;KPP;KRT10 Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10 yes no 2 1.0567E-09 172.21 1 0 34 1 0 34 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 30523000 263740 304120 1019900 1084500 1594100 1521300 483030 473650 660090 647050 0 1054000 984000 1057700 957570 961030 2285600 2098200 493880 490260 1714100 1818200 226280 224490 20913 872110 240010 320610 580210 508720 2909800 252120 252320 979450 1170300 + 533 75 539 5920;5921;5922 3045 3045 VLEGNEQFINAAK 2 0 2 0 0 1 2 1 0 1 1 1 0 1 0 0 0 0 0 1 0 13 0 1431.7358 P35030 P35030 PRSS3;PRSS4;TRY3;TRY4 Brain trypsinogen;Mesotrypsinogen;Serine protease 3;Serine protease 4;Trypsin III;Trypsin IV;Trypsin-3 yes yes 2 0.043716 77.593 1 0 3 1 0 3 1 1 1 1 1 1 149780 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 64783 51734 0 0 0 0 0 0 33266 0 0 0 0 0 0 0 0 534 38;41 540 5923;5924;5925;5926;5927;5928;5929;5930;5931;5932;5933;5934;5935;5936;5937;5938;5939;5940;5941;5942;5943;5944;5945;5946;5947;5948;5949;5950;5951;5952;5953;5954;5955;5956;5957;5958;5959;5960;5961;5962;5963 3046;3047;3048;3049;3050;3051;3052;3053;3054;3055;3056;3057;3058;3059;3060;3061;3062;3063;3064;3065;3066;3067;3068;3069;3070;3071;3072;3073;3074;3075;3076;3077;3078;3079;3080;3081;3082;3083 3056 VLGSGAFGTVYK 1 0 0 0 0 0 0 3 0 0 1 1 0 1 0 1 1 0 1 2 0 12 0 1197.6394 P00533;Q15303;P04626 P00533 EGFR;ERBB1;ERBB4;HER4;ERBB2;HER2;MLN19;NEU;NGL Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1;p180erbB4;Proto-oncogene-like protein c-ErbB-4;Receptor tyrosine-protein kinase erbB-4;Tyrosine kinase-type cell surface receptor HER4;Metastatic lymph node gene 19 protein;p185erbB2;Proto-oncogene c-ErbB-2;Proto-oncogene Neu;Receptor tyrosine-protein kinase erbB-2;Tyrosine kinase-type cell surface receptor HER2 no no 2 1.2283E-47 265.01 1 0 41 NaN NaN 3 4 3 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 152460000 26113000 28282000 21419000 20992000 499190 395880 167580 189120 0 0 46623 45317 5459600 5464000 7628900 7059300 268470 269230 299980 309430 9452400 9592700 1195900 1450700 0 38893 167640 173040 1294000 1324400 2565700 0 30327 135680 131520 535 66 541 5964;5965;5966;5967;5968;5969;5970;5971;5972;5973;5974;5975;5976;5977;5978 3084;3085;3086;3087;3088;3089;3090;3091 3091 VLGSGVFGTVHK 0 0 0 0 0 0 0 3 1 0 1 1 0 1 0 1 1 0 0 3 0 12 0 1199.6663 P21860 P21860 ERBB3;HER3 Proto-oncogene-like protein c-ErbB-3;Receptor tyrosine-protein kinase erbB-3;Tyrosine kinase-type cell surface receptor HER3 yes yes 2 0.0023913 113.63 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 12363000 0 0 0 0 2420900 2407800 1706800 1532800 0 0 0 0 0 0 0 0 341580 287870 419890 371010 0 0 0 0 350430 345030 1325800 0 0 0 0 109570 149000 289630 305500 536 106 542 5979;5980;5981;5982;5983;5984;5985;5986;5987;5988;5989;5990 3092;3093;3094;3095;3096;3097;3098;3099 3096 VLNEECDQNWYK 0 0 2 1 1 1 2 0 0 0 1 1 0 0 0 0 0 1 1 1 0 12 0 1596.6879 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 2 1.6415E-07 178.71 1 0 12 1 0 12 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1980700 43943 52406 48731 35698 0 0 0 0 0 0 0 0 266830 281590 384100 375690 0 0 0 0 0 0 0 0 0 0 0 0 134940 143980 212770 0 0 0 0 537 65 543 5991;5992;5993;5994;5995;5996;5997 3100;3101;3102;3103;3104;3105;3106 3101 VLQIIPYEFNR 0 1 1 0 0 1 1 0 0 2 1 0 0 1 1 0 0 0 1 1 0 11 0 1390.7609 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 2 0.00061927 127.42 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 3806300 0 0 0 0 0 0 0 0 0 0 0 0 494380 466560 900060 942530 0 0 0 0 0 0 0 0 0 0 0 0 160090 215330 627380 0 0 0 0 538 69 544 5998 3107 3107 VLSIGDGIAR 1 1 0 1 0 0 0 2 0 2 1 0 0 0 0 1 0 0 0 1 0 10 0 999.57129 P25705 P25705 ATP5A;ATP5A1;ATP5AL2;ATPM ATP synthase subunit alpha, mitochondrial yes yes 2 0.044601 55.549 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 539 54 545 5999;6000;6001;6002;6003;6004;6005 3108;3109 3108 VMEHFIK 0 0 0 0 0 0 1 0 1 1 0 1 1 1 0 0 0 0 0 1 0 7 0 902.46841 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2 0.050055 100.74 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 313030 57332 31817 54656 59320 30642 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 42003 37258 0 0 0 0 0 0 0 0 0 0 0 0 0 540 71 546 6006;6007;6008 3110 3110 VMGPGVSYLVR 0 1 0 0 0 0 0 2 0 0 1 0 1 0 1 1 0 0 1 3 0 11 0 1176.6325 P29353 P29353 SHC;SHC1;SHCA SHC-transforming protein 1;SHC-transforming protein 3;SHC-transforming protein A;Src homology 2 domain-containing-transforming protein C1 yes yes 2 0.020366 86.624 1 0 3 1 0 3 1 1 1 1 1 1 119690 0 0 0 0 0 0 0 0 0 0 0 0 45077 34010 0 40601 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 541 85 547 6009;6010 3111;3112 3111 VPFILTYDFIHVIQQGK 0 0 0 1 0 2 0 1 1 3 1 1 0 2 1 0 1 0 1 2 0 17 0 2017.1037 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 3 0.00329 85.457 1 0 2 1 0 2 1 1 1 1 297750 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 170870 126880 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 542 167 548 6011;6012;6013;6014;6015;6016;6017;6018;6019;6020;6021 3113;3114;3115;3116 3114 VQAEDLLYGKPDGAFLIR 2 1 0 2 0 1 1 2 0 1 3 1 0 1 1 0 0 0 1 1 0 18 1 2004.068 Q92569 Q92569 PIK3R3 p55PIK;Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;Phosphatidylinositol 3-kinase regulatory subunit gamma yes yes 3 0.00054787 98.694 1 0 11 1 0 11 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2027300 0 0 0 0 0 86909 514270 514270 0 0 0 0 0 0 0 0 138390 121870 159070 153100 0 0 0 0 0 0 119710 133880 0 0 0 0 0 44474 41354 543 159 549 6022;6023;6024;6025;6026;6027;6028;6029;6030;6031;6032;6033;6034;6035;6036;6037;6038;6039;6040;6041;6042;6043;6044;6045 3117;3118;3119;3120;3121;3122;3123;3124 3119 VQEAILAR 2 1 0 0 0 1 1 0 0 1 1 0 0 0 0 0 0 0 0 1 0 8 0 898.52362 Q8NF91 Q8NF91 C6orf98;KIAA0796;KIAA1262;KIAA1756;MYNE1;SYNE1 Enaptin;Myocyte nuclear envelope protein 1;Nesprin-1;Nuclear envelope spectrin repeat protein 1;Synaptic nuclear envelope protein 1 yes yes 2 0.027599 102.51 1 0 24 1 0 24 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 272960000 0 124770 0 0 11678000 0 0 0 94220 11523000 15053000 15574000 14905000 0 12795000 0 0 11866000 12611000 0 0 14588000 97237 13040000 16090000 15717000 16667000 0 12502000 83820 14106000 15495000 15792000 16224000 16335000 544 136 550 6046;6047 3125;3126 3126 VQKSSSPREMQK 0 1 0 0 0 2 1 0 0 0 0 2 1 0 1 3 0 0 0 1 0 12 2 1403.7191 Q3BBV2;Q86T75 Q3BBV2 NBPF8;NBPF11 Neuroblastoma breakpoint family member 8;Neuroblastoma breakpoint family member 11 yes no 2 0.059985 44.543 1 0 2 1 0 2 1 1 1 1 9725300 0 0 0 0 0 0 0 0 5414900 0 0 0 0 0 0 0 0 0 0 4310400 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 545 81 551 6048;6049;6050;6051;6052;6053;6054;6055;6056;6057;6058;6059;6060;6061 3127;3128 3127 VQQTVQDLFGR 0 1 0 1 0 3 0 1 0 0 1 0 0 1 0 0 1 0 0 2 0 11 0 1289.6728 P38646 P38646 GRP75;HSPA9;HSPA9B 75 kDa glucose-regulated protein;Heat shock 70 kDa protein 9;Mortalin;Peptide-binding protein 74;Stress-70 protein, mitochondrial yes yes 2 0.00051032 132.17 1 0 14 1 0 14 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1177500 219310 265350 107190 122340 42486 37573 0 0 0 0 0 0 38067 41187 62810 50750 0 0 0 0 57225 47848 0 0 0 0 0 0 0 46181 39182 0 0 0 0 546 61 552 6062 3129 3129 VSVELTNSLFK 0 0 1 0 0 0 1 0 0 0 2 1 0 1 0 2 1 0 0 2 0 11 0 1235.6762 P14923 P14923 CTNNG;DP3;JUP Catenin gamma;Desmoplakin III;Desmoplakin-3;Junction plakoglobin yes yes 2 0.077597 50.284 1 0 1 1 0 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 547 54 553 6063;6064;6065;6066;6067;6068;6069;6070;6071;6072;6073;6074;6075;6076;6077;6078;6079;6080;6081;6082;6083;6084;6085 3130;3131;3132;3133;3134;3135;3136;3137;3138;3139;3140;3141;3142;3143;3144;3145 3133 VTHAVVTVPAYFNDAQR 3 1 1 1 0 1 0 0 1 0 0 0 0 1 1 0 2 0 1 4 0 17 0 1886.9639 P11021 P11021 GRP78;HSPA5 78 kDa glucose-regulated protein;Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78;Heat shock 70 kDa protein 5;Immunoglobulin heavy chain-binding protein yes yes 2,3 6.0974E-10 166.62 1 0 23 1 0 23 2 2 2 2 2 2 1 1 2 2 2 1 1 1 2 2 2 2 2 2 1 1 2 2 2 1 1 1 14269000 2602400 2510100 1848700 2047600 506760 545940 428090 0 0 0 0 0 0 0 0 65664 0 0 0 0 1482000 1412000 0 0 0 0 357840 369220 16752 0 76153 0 0 0 0 548 57 554 6086;6087;6088;6089;6090 3146;3147 3146 VTLVFEHVDQDLR 0 1 0 2 0 1 1 0 1 0 2 0 0 1 0 0 1 0 0 3 0 13 0 1569.8151 P11802 P11802 CDK4 Cell division protein kinase 4;Cyclin-dependent kinase 4;PSK-J3 yes yes 3 0.10574 69.01 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 378670 103760 96448 101820 0 0 0 0 0 0 0 0 0 0 0 0 27078 0 0 0 0 0 49558 0 0 0 0 0 0 0 0 0 0 0 0 0 549 16;8;15 555 6091;6092;6093;6094;6095;6096;6097 3148;3149;3150;3151 3150 VTMQNLNDR 0 1 2 1 0 1 0 0 0 0 1 0 1 0 0 0 1 0 0 1 0 9 0 1089.5237 CON__P13645;P13645;CON__P02535-1;CON__Q7Z3Y7;CON__Q148H6;Q7Z3Y7;CON__Q7Z3Y8;Q7Z3Y8;CON__Q7Z3Z0;Q7Z3Z0;CON__Q3ZAW8;CON__Q9Z2K1;CON__Q7Z3Y9;Q7Z3Y9;CON__P02533;P02533;CON__A2A4G1;CON__P08779;P08779 CON__P13645 KPP;KRT10;KPP;KRT10;Krt10;Krt1-10;KRT25D;KRT28;KRT25D;KRT28;KRT25C;KRT27;KRT25C;KRT27;KRT25;KRT25A;KRT25;KRT25A;Krt1-16;Krt16;K16;Krt1-16;Krt16;KRT25B;KRT26;KRT25B;KRT26;KRT14;KRT14;KRT16;KRT16A;KRT16;KRT16A Cytokeratin-10;Keratin, type I cytoskeletal 10;Keratin-10;56 kDa cytokeratin;Keratin, type I cytoskeletal 59 kDa;Cytokeratin-28;Keratin, type I cytoskeletal 28;Keratin-25D;Keratin-28;Type I inner root sheath-specific keratin-K25irs4;Cytokeratin-27;Keratin, type I cytoskeletal 27;Keratin-25C;Keratin-27;Type I inner root sheath-specific keratin-K25irs3;Cytokeratin-25;Keratin, type I cytoskeletal 25;Keratin-25;Keratin-25A;Type I inner root sheath-specific keratin-K25irs1;Keratin 16;Putative uncharacterized protein;Keratin intermediate filament 16a;Keratin intermediate filament 16b;Cytokeratin-16;Keratin, type I cytoskeletal 16;Keratin-16;Cytokeratin-26;Keratin, type I cytoskeletal 26;Keratin-25B;Keratin-26;Type I inner root sheath-specific keratin-K25irs2;Cytokeratin-14;Keratin, type I cytoskeletal 14;Keratin-14 no no 2 1.4266E-05 143.03 1 0 7 NaN NaN 1 1 1 1 1 1 1 135940 0 0 20907 0 0 0 0 0 0 0 0 0 0 0 0 0 34239 0 0 0 0 0 0 0 0 0 0 0 0 0 53320 0 0 0 27472 + 550 110 556 6098;6099 3152;3153 3152 VVAGVANALAHK 4 0 1 0 0 0 0 1 1 0 1 1 0 0 0 0 0 0 0 3 0 12 0 1148.6666 P68871;P02042 P68871 HBB;HBD Beta-globin;Hemoglobin beta chain;Hemoglobin subunit beta;LVV-hemorphin-7;Delta-globin;Hemoglobin delta chain;Hemoglobin subunit delta yes no 2 0.0051554 102.52 1 0 2 1 0 2 1 1 1 1 87864 0 0 0 0 0 0 0 0 0 0 42543 45320 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 551 122 557 6100;6101;6102;6103;6104;6105;6106;6107;6108;6109 3154;3155;3156;3157;3158;3159;3160;3161 3158 VYLPYVTNQTYQER 0 1 1 0 0 2 1 0 0 0 1 0 0 0 1 0 2 0 3 2 0 14 0 1772.8733 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 2,3 5.4155E-08 179.67 1 0 10 1 0 10 2 2 2 2 2 2 2 2 2 2 2104100 0 0 0 0 0 0 0 0 0 0 0 0 401340 465930 578420 503340 0 0 0 0 0 0 0 0 0 0 0 0 0 0 155060 0 0 0 0 552 40 558 6110;6111;6112;6113;6114;6115;6116;6117;6118;6119;6120;6121;6122;6123;6124;6125;6126;6127;6128;6129;6130;6131;6132;6133;6134;6135;6136;6137;6138;6139;6140;6141 3162;3163;3164;3165;3166;3167;3168;3169;3170;3171;3172;3173;3174;3175;3176;3177;3178;3179;3180;3181;3182;3183;3184 3173 WELLQQVDTSTR 0 1 0 1 0 2 1 0 0 0 2 0 0 0 0 1 2 1 0 1 0 12 0 1474.7416 P04264;CON__P04264 P04264 KRT1;KRTA;KRT1;KRTA 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1 yes no 2 2.2625E-26 231.83 1 0 32 1 0 32 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 34758000 396280 346050 698040 738920 455970 447530 336650 375860 1699400 1916900 402050 377480 1607100 1548600 1933800 2077200 2455900 2397900 674680 600390 2886300 2202600 0 0 0 0 224560 219550 312880 275600 5864500 192560 214030 409070 469470 + 553 117 559 6142;6143;6144;6145;6146 3185;3186;3187;3188;3189 3187 WFHPNITGVEAENLLLTR 1 1 2 0 0 0 2 1 1 1 3 0 0 1 1 0 2 1 0 1 0 18 0 2109.1007 Q06124 Q06124 PTP2C;PTPN11;SHPTP2 Protein-tyrosine phosphatase 1D;Protein-tyrosine phosphatase 2C;SH-PTP2;SH-PTP3;Tyrosine-protein phosphatase non-receptor type 11 yes yes 3 0.00055956 96.993 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 1225500 0 0 0 0 0 0 0 0 0 0 0 0 0 0 229360 205720 0 0 374560 277440 0 0 0 0 0 0 0 0 0 0 138370 0 0 0 0 554 38 560;561 6147;6148;6149;6150;6151;6152;6153;6154;6155;6156;6157;6158;6159;6160;6161;6162;6163;6164 3190;3191;3192;3193;3194;3195;3196;3197;3198;3199;3200;3201;3202 3197 7 WMALESILHR 1 1 0 0 0 0 1 0 1 1 2 0 1 0 0 1 0 1 0 0 0 10 0 1254.6543 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 0.0041944 104.2 1 0 18 1 0 18 2 2 2 3 2 2 2 3 2 2 2 3 2 2 2 3 2744000 654020 585020 265800 363610 0 0 0 0 0 0 0 0 0 0 204500 174590 0 0 0 0 213960 282510 0 0 0 0 0 0 0 0 0 0 0 0 0 555 39;17 562 6165;6166;6167;6168;6169;6170;6171;6172;6173;6174;6175;6176;6177;6178;6179;6180;6181 3203;3204;3205;3206 3203 WTLLQEQGTK 0 0 0 0 0 2 1 1 0 0 2 1 0 0 0 0 2 1 0 0 0 10 0 1202.6295 P04259;CON__P02538;CON__P04259;CON__P48668;P02538;P48668;CON__P13647;P13647 P04259 K6B;KRT6B;KRTL1;K6A;KRT6A;KRT6D;K6B;KRT6B;KRTL1;KRT6C;KRT6E;K6A;KRT6A;KRT6D;KRT6C;KRT6E;KRT5;KRT5 Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10;Cytokeratin-6A;Cytokeratin-6D;Keratin, type II cytoskeletal 6A;Keratin-6A;Type-II keratin Kb6;Cytokeratin-6C;Cytokeratin-6E;Keratin K6h;Keratin, type II cytoskeletal 6C;Keratin-6C;Type-II keratin Kb12;58 kDa cytokeratin;Cytokeratin-5;Keratin, type II cytoskeletal 5;Keratin-5;Type-II keratin Kb5 no no 2 0.0074793 96.342 1 0 17 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1095300 0 0 55579 62402 31796 27636 0 0 42590 0 94233 94843 69237 53943 60672 69077 52500 63832 0 0 45849 48847 0 0 0 0 0 0 0 46989 175290 0 0 0 0 + 556 40;39 563 6182;6183;6184;6185;6186;6187;6188;6189;6190;6191;6192;6193;6194;6195;6196;6197;6198;6199;6200;6201;6202;6203;6204;6205;6206;6207;6208;6209;6210;6211;6212;6213;6214 3207;3208;3209;3210;3211;3212;3213;3214;3215;3216;3217;3218;3219;3220;3221;3222;3223;3224;3225;3226;3227;3228;3229;3230;3231;3232;3233;3234;3235;3236;3237 3210 YEELQITAGR 1 1 0 0 0 1 2 1 0 1 1 0 0 0 0 0 1 0 1 0 0 10 0 1178.5932 P04264;CON__P04264;P04259 P04264 KRT1;KRTA;KRT1;KRTA;K6B;KRT6B;KRTL1 67 kDa cytokeratin;Cytokeratin-1;Hair alpha protein;Keratin, type II cytoskeletal 1;Keratin-1;Type-II keratin Kb1;Cytokeratin-6B;Keratin, type II cytoskeletal 6B;Keratin-6B;Type-II keratin Kb10 no no 2 1.6297E-08 180.07 1 0 33 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 5053800 50297 79186 103370 124970 172590 169670 128050 106320 117060 109790 203120 202270 170750 170810 128460 144870 281950 287540 85860 64748 295010 264600 0 29284 162350 214380 44318 0 111450 114230 371600 57253 56310 190900 240390 + 557 79 564 6215;6216;6217;6218 3238 3238 YEELQVTVGR 0 1 0 0 0 1 2 1 0 0 1 0 0 0 0 0 1 0 1 2 0 10 0 1192.6088 P35908;CON__P35908 P35908 KRT2;KRT2A;KRT2E;KRT2;KRT2A;KRT2E Cytokeratin-2e;Epithelial keratin-2e;Keratin, type II cytoskeletal 2 epidermal;Keratin-2 epidermis;Keratin-2e;Type-II keratin Kb2 yes no 2 0.014241 91.549 1 0 4 1 0 4 1 1 1 1 1 1 1 1 152160 0 0 0 0 27493 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 39618 0 0 0 0 0 0 0 0 0 53257 0 0 0 31793 + 558 85 565 6219;6220;6221;6222;6223;6224;6225;6226 3239;3240;3241;3242 3240 YEPFLDCALSR 1 1 0 1 1 0 1 0 0 0 2 0 0 1 1 1 0 0 1 0 0 11 0 1369.6336 P42338 P42338 PIK3C1;PIK3CB Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform yes yes 2 0.00087624 112.36 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 924730 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 98528 99396 183760 167260 0 0 0 0 0 0 0 0 0 0 0 59382 56140 131320 128950 559 84 566 6227;6228;6229;6230;6231;6232 3243;3244;3245;3246 3244 YEQYLDNLLVR 0 1 1 1 0 1 1 0 0 0 3 0 0 0 0 0 0 0 2 1 0 11 0 1424.73 P42336 P42336 PIK3CA Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha;Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform yes yes 2 0.0003464 138.25 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 1193100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 292170 259620 269730 228340 0 0 0 0 0 0 0 0 0 0 0 76212 67018 0 0 560 106 567 6233;6234;6235;6236;6237;6238;6239;6240;6241;6242;6243;6244;6245;6246;6247;6248;6249;6250;6251;6252;6253;6254;6255;6256;6257;6258;6259;6260;6261;6262;6263;6264;6265;6266 3247;3248;3249;3250;3251;3252;3253;3254;3255;3256;3257;3258;3259;3260;3261;3262;3263;3264;3265;3266;3267;3268;3269 3254 YFLWVVK 0 0 0 0 0 0 0 0 0 0 1 1 0 1 0 0 0 1 1 2 0 7 0 953.53747 P62993 P62993 ASH;GRB2 Adapter protein GRB2;Growth factor receptor-bound protein 2;Protein Ash;SH2/SH3 adapter GRB2 yes yes 1,2 0.0019817 121.68 1 0 34 1 0 34 1 2 1 1 1 1 2 2 5 2 1 1 1 1 1 1 2 2 2 1 1 1 1 1 2 1 1 1 1 2 2 5 2 1 1 1 1 1 1 2 2 2 1 1 1 1 65460000 1014700 1026900 637600 550200 0 0 51050 54333 0 0 0 0 7240200 8146700 15151000 14937000 620950 587240 556970 362480 337900 326390 0 0 0 0 0 0 2750600 2499800 8071600 108470 135200 0 293020 561 43;58 568 6267;6268;6269;6270;6271;6272;6273;6274;6275;6276;6277;6278;6279 3270;3271;3272;3273;3274;3275;3276;3277 3277 YFPTQALNFAFK 2 0 1 0 0 1 0 0 0 0 1 1 0 3 1 0 1 0 1 0 0 12 0 1445.7343 P05141;P12235;Q9H0C2;P12236 P05141 ANT2;SLC25A5;ANT1;SLC25A4;AAC4;ANT4;SFEC;SLC25A31;ANT3;CDABP0051;SLC25A6 Adenine nucleotide translocator 2;ADP,ATP carrier protein 2;ADP,ATP carrier protein, fibroblast isoform;ADP/ATP translocase 2;Solute carrier family 25 member 5;Adenine nucleotide translocator 1;ADP,ATP carrier protein 1;ADP,ATP carrier protein, heart/skeletal muscle isoform T1;ADP/ATP translocase 1;Solute carrier family 25 member 4;Adenine nucleotide translocator 4;ADP,ATP carrier protein 4;ADP/ATP translocase 4;Solute carrier family 25 member 31;Sperm flagellar energy carrier protein;Adenine nucleotide translocator 3;ADP,ATP carrier protein 3;ADP,ATP carrier protein, isoform T2;ADP/ATP translocase 3;Solute carrier family 25 member 6 no no 2 0.005675 100.72 1 0 13 NaN NaN 1 1 1 1 1 1 1 1 1 1 1 1 1 1910900 451910 443750 158250 128460 0 0 45307 19560 0 0 0 0 0 0 121700 116380 26865 0 0 0 169740 135040 0 0 0 0 0 26100 0 0 67828 0 0 0 0 562 62 569 6280;6281;6282;6283;6284;6285;6286;6287 3278;3279;3280;3281 3280 YIELLTR 0 1 0 0 0 0 1 0 0 1 2 0 0 0 0 0 1 0 1 0 0 7 0 906.51747 P15924 P15924 DSP 250/210 kDa paraneoplastic pemphigus antigen;Desmoplakin yes yes 2 0.057295 94.407 1 0 8 1 0 8 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 563580 0 0 102300 120160 0 0 0 0 0 0 0 0 0 43033 0 159770 0 0 0 0 0 32618 0 0 0 0 0 0 0 0 0 0 0 44026 61672 563 94 570 6288;6289;6290;6291;6292;6293;6294 3282;3283 3282 YLFLFDK 0 0 0 1 0 0 0 0 0 0 2 1 0 2 0 0 0 0 1 0 0 7 0 944.50076 P52735 P52735 VAV2 Guanine nucleotide exchange factor VAV2 yes yes 2 0.093144 69.432 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 297840 39460 38610 54213 0 0 0 0 0 0 0 0 0 54307 63341 0 47904 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 564 9 571 6295;6296;6297 3284 3284 YLGYLEQLLR 0 1 0 0 0 1 1 1 0 0 4 0 0 0 0 0 0 0 2 0 0 10 0 1266.6972 CON__P02662 CON__P02662 yes yes 2 7.6447E-06 153.05 1 0 3 1 0 3 1 1 1 1 1 1 587290 293010 260250 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 34029 0 0 0 0 0 0 0 0 0 0 0 0 0 0 + 565 188 572 6298;6299;6300;6301;6302;6303;6304 3285;3286 3286 YLIALYTK 1 0 0 0 0 0 0 0 0 1 2 1 0 0 0 0 1 0 2 0 0 8 0 983.56917 Q9Y4H2 Q9Y4H2 IRS2 Insulin receptor substrate 2 yes yes 2 0.10832 81.297 1 0 7 1 0 7 1 1 1 1 1 1 1 1 1 1 1 1 1 1 585290 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 76047 68542 74424 58009 0 0 0 0 0 0 0 0 0 0 0 37936 0 149340 120990 566 46 573 6305;6306;6307;6308;6309;6310;6311;6312;6313;6314;6315;6316;6317;6318;6319;6320;6321;6322;6323;6324;6325;6326;6327;6328 3287;3288;3289;3290;3291;3292;3293;3294;3295;3296;3297;3298;3299;3300 3289 YLTVAAVFR 2 1 0 0 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 2 0 9 0 1038.5862 P07437;P68371;P04350 P07437 OK/SW-cl.56;TUBB;TUBB5;TUBB2C;TUBB4;TUBB5 Tubulin beta chain;Tubulin beta-5 chain;Tubulin beta-2 chain;Tubulin beta-2C chain;Tubulin 5 beta;Tubulin beta-4 chain yes no 2 1.9524E-12 182.53 1 0 24 1 0 24 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 10260000 1589800 1622600 1264600 1329700 279900 269770 383040 345530 62537 51054 0 0 250630 273730 418810 414290 95230 119930 151530 114550 379040 363840 0 0 0 0 173500 135360 0 0 0 0 0 80725 89890 567 125 574 6329;6330;6331;6332;6333;6334;6335 3301 3301 YLTVATVFR 1 1 0 0 0 0 0 0 0 0 1 0 0 1 0 0 2 0 1 2 0 9 0 1068.5968 Q13509 Q13509 TUBB3;TUBB4 Tubulin beta-3 chain;Tubulin beta-4 chain;Tubulin beta-III no no 2 0.022807 90.657 1 0 7 NaN NaN 1 1 1 1 1 1 1 777910 223360 170920 135270 140570 0 0 0 0 0 0 0 0 0 0 42694 38423 0 0 0 0 26674 0 0 0 0 0 0 0 0 0 0 0 0 0 0 568 38 575 6336;6337;6338;6339;6340;6341;6342;6343;6344;6345;6346;6347;6348;6349;6350;6351;6352;6353;6354;6355;6356;6357;6358;6359 3302;3303;3304;3305;3306;3307;3308;3309;3310;3311;3312;3313;3314;3315;3316;3317;3318;3319;3320;3321;3322;3323;3324;3325 3302 YLVIQGDER 0 1 0 1 0 1 1 1 0 1 1 0 0 0 0 0 0 0 1 1 0 9 0 1091.5611 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 2.0138E-05 141.48 1 0 24 1 0 24 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 32392000 5018100 5695200 4607600 4571800 30063 0 36962 50585 0 0 0 0 818280 821420 1090600 1127900 56584 52371 118980 70117 2184800 1768600 1774200 1787900 0 0 0 0 241390 232830 235430 0 0 0 0 569 107 576 6360;6361;6362;6363;6364;6365 3326 3326 YLYTLVITDKEK 0 0 0 1 0 0 1 0 0 1 2 2 0 0 0 0 2 0 2 1 0 12 1 1484.8126 P63173 P63173 RPL38 60S ribosomal protein L38 yes yes 3 0.0613 73.499 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 390990 115330 86638 69980 39359 0 0 0 0 0 0 0 0 0 0 37910 0 0 0 0 0 0 41774 0 0 0 0 0 0 0 0 0 0 0 0 0 570 122 577 6366;6367 3327 3327 YNKPLPPTPDLPQPHLPPISAPGSSR 1 1 1 1 0 1 0 1 1 1 3 1 0 0 9 3 1 0 1 0 0 26 1 2775.4708 Q12774 Q12774 ARHGEF5;TIM Guanine nucleotide regulatory protein TIM;Oncogene TIM;p60 TIM;Rho guanine nucleotide exchange factor 5;Transforming immortalized mammary oncogene yes yes 3 0.028867 67.864 1 0 2 1 0 2 1 1 1 1 489100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 258500 230600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 571 26 578 6368;6369;6370;6371;6372 3328;3329 3329 YQQDQIVKEDSVEAVGAQLK 2 0 0 2 0 4 2 1 0 1 1 2 0 0 0 1 0 0 1 3 0 20 1 2247.1383 O00459 O00459 PIK3R2 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta;Phosphatidylinositol 3-kinase regulatory subunit beta yes yes 3 3.3406E-07 133.66 1 0 5 1 0 5 1 1 1 1 1 1 1 1 1 1 724070 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 104200 141790 233370 207900 0 0 0 0 0 0 0 0 0 0 0 0 0 0 36823 572 38 579 6373;6374;6375;6376;6377;6378;6379;6380;6381;6382;6383;6384;6385;6386;6387 3330;3331;3332;3333;3334;3335;3336;3337;3338;3339;3340;3341;3342 3330 YSFGATCVK 1 0 0 0 1 0 0 1 0 0 0 1 0 1 0 1 1 0 1 1 0 9 0 1031.4746 P00533 P00533 EGFR;ERBB1 Epidermal growth factor receptor;Proto-oncogene c-ErbB-1;Receptor tyrosine-protein kinase erbB-1 yes yes 2 2.1213E-05 141.2 1 0 15 1 0 15 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 6491300 1250600 1204500 889280 992760 0 0 0 0 0 0 0 0 171370 192640 209850 227230 0 0 0 0 326160 312160 258120 275490 0 0 0 0 51485 61876 67776 0 0 0 0 573 65 580 6388;6389;6390;6391;6392;6393 3343;3344 3344 YVNILPYDHSR 0 1 1 1 0 0 0 0 1 1 1 0 0 0 1 1 0 0 2 1 0 11 0 1375.6884 P18433 P18433 PTPA;PTPRA;PTPRL2 Receptor-type tyrosine-protein phosphatase alpha yes yes 3 0.013779 90.629 1 0 6 1 0 6 1 1 1 1 1 1 1 1 1 1 1 1 384240 0 0 0 0 0 0 0 0 0 0 0 0 50857 50062 102220 78680 0 0 0 0 0 0 0 0 0 0 0 0 51008 0 51412 0 0 0 0