Mercurial > repos > devteam > emboss_5
view test-data/emboss_sixpack_out.fasta @ 13:8992d258e42f draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/emboss_5 commit 9844cae766e7471d9fa6b2e8356e5194e77f6753
author | iuc |
---|---|
date | Fri, 22 Jun 2018 03:24:47 -0400 |
parents | |
children |
line wrap: on
line source
>Sequence_1_ORF1 Translation of Sequence in frame 1, ORF 1, threshold 1, 17aa VRCLKYLLLSLHRPQFS >Sequence_1_ORF2 Translation of Sequence in frame 1, ORF 2, threshold 1, 5aa WLYTD >Sequence_1_ORF3 Translation of Sequence in frame 1, ORF 3, threshold 1, 6aa KFLCKH >Sequence_1_ORF4 Translation of Sequence in frame 1, ORF 4, threshold 1, 12aa LKAVGLECYRFV >Sequence_1_ORF5 Translation of Sequence in frame 1, ORF 5, threshold 1, 33aa LSASLALIKGSFSLLWKTLWKNTTSTSLSPLVC >Sequence_1_ORF6 Translation of Sequence in frame 1, ORF 6, threshold 1, 25aa LLDTVVIPFATPRNYLYELFSLYYM >Sequence_1_ORF7 Translation of Sequence in frame 1, ORF 7, threshold 1, 3aa VRL >Sequence_1_ORF8 Translation of Sequence in frame 1, ORF 8, threshold 1, 40aa SSFSKSFTVFDLNVHVLRLFWIICGQFNLRCFFLKYLFMV >Sequence_1_ORF9 Translation of Sequence in frame 1, ORF 9, threshold 1, 29aa FLVCTCSGASSLFTLFVYSSSFIFSMILI >Sequence_2_ORF1 Translation of Sequence in frame 2, ORF 1, threshold 1, 3aa FDA >Sequence_2_ORF2 Translation of Sequence in frame 2, ORF 2, threshold 1, 27aa NTFFCPYTDHSFPNGFTPTRNSCASTN >Sequence_2_ORF3 Translation of Sequence in frame 2, ORF 3, threshold 1, 4aa KRLA >Sequence_2_ORF4 Translation of Sequence in frame 2, ORF 4, threshold 1, 7aa SVTGLYS >Sequence_2_ORF5 Translation of Sequence in frame 2, ORF 5, threshold 1, 5aa ARLLP >Sequence_2_ORF6 Translation of Sequence in frame 2, ORF 6, threshold 1, 32aa SKVHFLYFGRRCGRIQQVRVSPPWFADYWIQL >Sequence_2_ORF7 Translation of Sequence in frame 2, ORF 7, threshold 1, 46aa YPSQHRVTIYMNYFPFIICSRFVFNLPLASLLLFSTSMFMFLGCFG >Sequence_2_ORF8 Translation of Sequence in frame 2, ORF 8, threshold 1, 11aa YAVSLIFVVSS >Sequence_2_ORF9 Translation of Sequence in frame 2, ORF 9, threshold 1, 32aa NIYSWFNFWFVLVQGPVHYLLCLYTAVLLFLV >Sequence_2_ORF10 Translation of Sequence in frame 2, ORF 10, threshold 1, 1aa F >Sequence_3_ORF1 Translation of Sequence in frame 3, ORF 1, threshold 1, 90aa SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAERVSCPDQRFIFSTLE DVVEEYNKYESLPPGLLITGYSCNTLRNTA >Sequence_3_ORF2 Translation of Sequence in frame 3, ORF 2, threshold 1, 3aa LSI >Sequence_3_ORF3 Translation of Sequence in frame 3, ORF 3, threshold 1, 16aa IIFPLLYVVGSSLIFL >Sequence_3_ORF4 Translation of Sequence in frame 3, ORF 4, threshold 1, 13aa QVFYCFRPQCSCS >Sequence_3_ORF5 Translation of Sequence in frame 3, ORF 5, threshold 1, 9aa VVLDNMRSV >Sequence_3_ORF6 Translation of Sequence in frame 3, ORF 6, threshold 1, 37aa SSLFLLKIFIHGLIFGLYLFRGQFIIYSVCIQQFFYF >Sequence_3_ORF7 Translation of Sequence in frame 3, ORF 7, threshold 1, 8aa YDFNLKQF