# HG changeset patch # User iuc # Date 1500400576 14400 # Node ID 2aa02d2a6af366bd8449d5e2d62aa65bf8f86e99 # Parent 15197951a75698d833f7e44bb119ca2503f17865 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/abricate/ commit 0ccab47582f8bc88f9ebc836c4c70d4ce495960c diff -r 15197951a756 -r 2aa02d2a6af3 abricate.xml --- a/abricate.xml Fri Mar 03 14:56:09 2017 -0500 +++ b/abricate.xml Tue Jul 18 13:56:16 2017 -0400 @@ -1,39 +1,34 @@ - + - abricate + abricate abricate --version '$report' ]]> - - - - - + +
+ + + + + + + - - - - - - - - + + +
@@ -41,49 +36,51 @@ - + - - + - + - - + - + - - + - + - - - - + + + - + - - + + + + + + + + diff -r 15197951a756 -r 2aa02d2a6af3 abricate_list.xml --- a/abricate_list.xml Fri Mar 03 14:56:09 2017 -0500 +++ b/abricate_list.xml Tue Jul 18 13:56:16 2017 -0400 @@ -1,6 +1,6 @@ - + - abricate + abricate abricate --version @@ -18,7 +18,7 @@ - + diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_cull100.txt --- a/test-data/output_cull100.txt Fri Mar 03 14:56:09 2017 -0500 +++ /dev/null Thu Jan 01 00:00:00 1970 +0000 @@ -1,12 +0,0 @@ -#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY -gi|49482253|ref|NC_002952.2| 40786 41556 aadD 1-771/771 =============== 0 100.00 99.74 -gi|49482253|ref|NC_002952.2| 1913827 1914672 blaZ 1-846/846 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 55890 56621 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 1796513 1797244 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 55983 56576 erm(A) 1-594/594 =============== 0 100.00 85.52 -gi|49482253|ref|NC_002952.2| 1796606 1797199 erm(A) 1-594/594 =============== 0 100.00 85.52 -gi|49482253|ref|NC_002952.2| 44919 46928 mecA 1-2010/2010 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 44919 46925 mecA 1-2007/2007 =============== 0 100.00 99.95 -gi|49482253|ref|NC_002952.2| 782414 783580 norA 1-1167/1167 =============== 0 100.00 91.69 -gi|49482253|ref|NC_002952.2| 1797370 1798152 spc 1-783/783 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 56747 57529 spc 1-783/783 =============== 0 100.00 100.00 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_db-card.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/output_db-card.txt Tue Jul 18 13:56:16 2017 -0400 @@ -0,0 +1,17 @@ +#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY DATABASE ACCESSION +NC_002952.2 40786 41547 ANT(4')-Ib 1-762/762 =============== 0/0 100.00 100.00 card NC_013342.1:26738-27500 +NC_002952.2 44918 46925 mecA 1-2008/2008 =============== 0/0 100.00 99.90 card KC243783:1-2008 +NC_002952.2 47025 48783 mecR1 1-1759/1759 =============== 0/0 100.00 99.94 card NC_009487:40849-42607 +NC_002952.2 48782 49154 mecI 1-373/373 =============== 0/0 100.00 99.73 card NC_002745:48894-49266 +NC_002952.2 55890 56622 ErmA 1-733/733 =============== 0/0 100.00 100.00 card NC_009632:49745-50477 +NC_002952.2 152865 154217 tet(38) 1-1353/1353 =============== 0/0 100.00 98.52 card AY825285:1-1354 +NC_002952.2 376045 376465 mepR 1-421/421 =============== 0/0 100.00 99.05 card NC_009782:379935-380355 +NC_002952.2 376571 377926 mepA 1-1356/1356 =============== 0/0 100.00 98.53 card AY661734.1:840-2196 +NC_002952.2 774312 774756 mgrA 1-445/445 =============== 0/0 100.00 99.78 card NC_013450:694853-695297 +NC_002952.2 782414 783543 norA 1-1130/1165 ========/====== 7/14 96.39 76.08 card AY566250:392-1556 +NC_002952.2 1486310 1487666 arlS 1-1357/1357 =============== 0/0 100.00 98.38 card NC_007795:1360281-1361637 +NC_002952.2 1487662 1488322 arlR 1-661/661 =============== 0/0 100.00 99.09 card NC_009641:1461589-1462249 +NC_002952.2 1796513 1797245 ErmA 1-733/733 =============== 0/0 100.00 100.00 card NC_009632:49745-50477 +NC_002952.2 1913826 1914672 PC1_beta-lactamase_(blaZ) 1-847/847 =============== 0/0 100.00 97.17 card NC_010066:9683-10529 +NC_002952.2 2047036 2048773 sav1866 1-1738/1738 =============== 0/0 100.00 99.19 card NC_002951:1987720-1989457 +NC_002952.2 2488459 2488878 FosB 1-420/420 =============== 0/0 100.00 79.05 card NC_010419.1:17043-17463 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_gbk.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/output_gbk.txt Tue Jul 18 13:56:16 2017 -0400 @@ -0,0 +1,2 @@ +#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY DATABASE ACCESSION +STANORAX 246 1412 norA_1 1-1167/1167 =============== 0/0 100.00 100.00 resfinder M97169 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_list.txt --- a/test-data/output_list.txt Fri Mar 03 14:56:09 2017 -0500 +++ b/test-data/output_list.txt Tue Jul 18 13:56:16 2017 -0400 @@ -1,16 +1,7 @@ -aminoglycoside 169 -beta-lactamase 1305 -colistin 1 -fosfomycin 21 -fusidicacid 2 -macrolide 131 -nitroimidazole 14 -oxazolidinone 3 -phenicol 36 -quinolone 103 -rifampicin 9 -sulphonamide 49 -tetracycline 104 -trimethoprim 53 -vancomycin 123 -TOTAL 2123 +abricate: corrupt database? - +argannot: 1749 sequences - Jul 8, 2017 +card: 2124 sequences - Jul 8, 2017 +ncbibetalactamase: 1557 sequences - Mar 17, 2017 +plasmidfinder: 263 sequences - Mar 19, 2017 +resfinder: 2228 sequences - Jul 8, 2017 +vfdb: 2597 sequences - Mar 17, 2017 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_minid100.txt --- a/test-data/output_minid100.txt Fri Mar 03 14:56:09 2017 -0500 +++ b/test-data/output_minid100.txt Tue Jul 18 13:56:16 2017 -0400 @@ -1,7 +1,7 @@ -#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY -gi|49482253|ref|NC_002952.2| 1913827 1914672 blaZ 1-846/846 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 55890 56621 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 1796513 1797244 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 44919 46928 mecA 1-2010/2010 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 1797370 1798152 spc 1-783/783 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 56747 57529 spc 1-783/783 =============== 0 100.00 100.00 +#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY DATABASE ACCESSION +NC_002952.2 44919 46928 mecA_15 1-2010/2010 =============== 0/0 100.00 100.00 resfinder AB505628 +NC_002952.2 55890 56621 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 56747 57529 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 1796513 1797244 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 1797370 1798152 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 1913827 1914672 blaZ_36 1-846/846 =============== 0/0 100.00 100.00 resfinder AJ400722 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_mrsa.txt --- a/test-data/output_mrsa.txt Fri Mar 03 14:56:09 2017 -0500 +++ b/test-data/output_mrsa.txt Tue Jul 18 13:56:16 2017 -0400 @@ -1,9 +1,9 @@ -#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY -gi|49482253|ref|NC_002952.2| 40786 41556 aadD 1-771/771 =============== 0 100.00 99.74 -gi|49482253|ref|NC_002952.2| 1913827 1914672 blaZ 1-846/846 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 55890 56621 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 1796513 1797244 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 44919 46928 mecA 1-2010/2010 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 782414 783580 norA 1-1167/1167 =============== 0 100.00 91.69 -gi|49482253|ref|NC_002952.2| 1797370 1798152 spc 1-783/783 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 56747 57529 spc 1-783/783 =============== 0 100.00 100.00 +#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY DATABASE ACCESSION +NC_002952.2 40786 41556 aadD_1 1-771/771 =============== 0/0 100.00 99.74 resfinder AF181950 +NC_002952.2 44919 46928 mecA_15 1-2010/2010 =============== 0/0 100.00 100.00 resfinder AB505628 +NC_002952.2 55890 56621 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 56747 57529 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 782414 783580 norA_1 1-1167/1167 =============== 0/0 100.00 91.69 resfinder M97169 +NC_002952.2 1796513 1797244 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 1797370 1798152 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 1913827 1914672 blaZ_36 1-846/846 =============== 0/0 100.00 100.00 resfinder AJ400722 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_noheader.txt --- a/test-data/output_noheader.txt Fri Mar 03 14:56:09 2017 -0500 +++ b/test-data/output_noheader.txt Tue Jul 18 13:56:16 2017 -0400 @@ -1,8 +1,8 @@ -gi|49482253|ref|NC_002952.2| 40786 41556 aadD 1-771/771 =============== 0 100.00 99.74 -gi|49482253|ref|NC_002952.2| 1913827 1914672 blaZ 1-846/846 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 55890 56621 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 1796513 1797244 erm(A) 1-732/732 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 44919 46928 mecA 1-2010/2010 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 782414 783580 norA 1-1167/1167 =============== 0 100.00 91.69 -gi|49482253|ref|NC_002952.2| 1797370 1798152 spc 1-783/783 =============== 0 100.00 100.00 -gi|49482253|ref|NC_002952.2| 56747 57529 spc 1-783/783 =============== 0 100.00 100.00 +NC_002952.2 40786 41556 aadD_1 1-771/771 =============== 0/0 100.00 99.74 resfinder AF181950 +NC_002952.2 44919 46928 mecA_15 1-2010/2010 =============== 0/0 100.00 100.00 resfinder AB505628 +NC_002952.2 55890 56621 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 56747 57529 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 782414 783580 norA_1 1-1167/1167 =============== 0/0 100.00 91.69 resfinder M97169 +NC_002952.2 1796513 1797244 erm(A)_1 1-732/732 =============== 0/0 100.00 100.00 resfinder X03216 +NC_002952.2 1797370 1798152 spc_1 1-783/783 =============== 0/0 100.00 100.00 resfinder X02588 +NC_002952.2 1913827 1914672 blaZ_36 1-846/846 =============== 0/0 100.00 100.00 resfinder AJ400722 diff -r 15197951a756 -r 2aa02d2a6af3 test-data/output_noresults.txt --- a/test-data/output_noresults.txt Fri Mar 03 14:56:09 2017 -0500 +++ b/test-data/output_noresults.txt Tue Jul 18 13:56:16 2017 -0400 @@ -1,1 +1,1 @@ -#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY +#FILE SEQUENCE START END GENE COVERAGE COVERAGE_MAP GAPS %COVERAGE %IDENTITY DATABASE ACCESSION diff -r 15197951a756 -r 2aa02d2a6af3 test-data/test.gbk --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/test.gbk Tue Jul 18 13:56:16 2017 -0400 @@ -0,0 +1,72 @@ +LOCUS STANORAX 1601 bp DNA linear BCT 27-MAY-1993 +DEFINITION Staphylococcus aureus fluoroquinolone resistance protein (norA) + gene, complete cds. +ACCESSION M97169 +VERSION M97169.1 +KEYWORDS fluoroquinolone resistance protein; norA gene. +SOURCE Staphylococcus aureus + ORGANISM Staphylococcus aureus + Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; + Staphylococcus. +REFERENCE 1 (bases 1 to 1601) + AUTHORS Kaatz,G.W., Seo,S.M. and Ruble,C.A. + TITLE Efflux-mediated fluoroquinolone resistance in Staphylococcus aureus + JOURNAL Antimicrob. Agents Chemother. 37 (5), 1086-1094 (1993) + PUBMED 8517696 +FEATURES Location/Qualifiers + source 1..1601 + /organism="Staphylococcus aureus" + /mol_type="genomic DNA" + /db_xref="taxon:1280" + gene 117..1412 + /gene="norA" + regulatory 117..122 + /regulatory_class="minus_35_signal" + /gene="norA" + /note="putative" + regulatory 141..146 + /regulatory_class="minus_10_signal" + /gene="norA" + CDS 246..1412 + /gene="norA" + /function="fluoroquinolone efflux" + /standard_name="NORA1199 wild-type gene" + /codon_start=1 + /transl_table=11 + /protein_id="AAA26658.1" + /translation="MNKQILVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLV + AAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAIGQNFLILMLSRVIGG + MSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFY + FAGALGILAFIMSIVLIHDPKKVSTNGFQKLEPQLLTKINWKVFITPVILTLVLSFGL + SAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSL + IYSVIVLVLLVIADGYWTIMVISFVVFIGFDMIRPAITNYFSNIAGDRQGFAGGLNST + FTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKQQDL" +ORIGIN + 1 ctagtagtat agtatgatta cttttttgca atttcatatg atcaatcccc tttattttaa + 61 tatgtcatta attatacaat taaatggaaa atagtgataa ttacaaagaa aaaatattgt + 121 caaatgtagc aatattgtaa tacaatatag aaacttttta cgaatattta gcatgaattg + 181 caatctgtcg tggaaaagaa aaataacagc ttgaagagtg acaagtagaa aaaagaggtg + 241 agcaaatgaa taaacagatt ttggtattat attttaatat tttcttaatt tttttaggta + 301 tcggtctagt gataccagtc ttacctgttt atttaaaaga tttggggtta actggtagtg + 361 atttaggatt attagttgct gctttcgcct tatctcaaat gattatatcg ccattcggtg + 421 gtacgttagc tgataaatta ggaaagaaat taattatatg tataggatta attttgtttt + 481 cagtgtcaga atttatgttt gctatcggtc agaatttttt aattttgatg ttatcaaggg + 541 ttatcggtgg tatgagtgct ggtatggtta tgcctggggt gacaggttta atagctgata + 601 tttcaccaag ccatcaaaaa gcaaaaaact ttggctacat gtcagcgatt atcaattcag + 661 gattcatttt aggaccaggg attggtggat ttatggcaga agtttcacat cgtatgccat + 721 tttattttgc aggtgcatta ggtattctag catttataat gtcaattgta ttgattcacg + 781 accctaaaaa agtttcgaca aatggattcc aaaagttgga gccacaattg ctaacgaaaa + 841 ttaactggaa agtgtttatt acaccagtta ttctaacact tgtattatcg tttggtttat + 901 ctgcatttga aacattgtat tcactataca cagctgacaa ggtaaattat tcacctaaag + 961 atatttcgat tgcaattaca ggtggcggta tctttggtgc acttttccaa atttatttct + 1021 ttgataaatt tatgaaatac ttctctgagt taacatttat tgcatggtca ttaatatatt + 1081 cagttattgt attagtgcta ttagttattg ccgatggtta ctggacaatt atggtaataa + 1141 gctttgttgt ctttatcggg ttcgatatga taagacctgc tattacaaat tatttttcaa + 1201 atattgctgg tgatagacag ggatttgcag gtgggttaaa ctcaacattc actagcatgg + 1261 ggaattttat aggtccttta atcgcaggtg cgttatttga tgtgcacatt gaagccccaa + 1321 tttatatggc tataggtgtg tcattagctg gtgttgtcat tgttttaatt gaaaagcaac + 1381 atagagctaa gttaaaacaa caagatttgt aatatcgcac atggttgtca ttcgattaat + 1441 gtttttcgac aactaaagca tttcaaaata agcatcgatt ttcttacaat tatagtgaag + 1501 aaaagtcgat gctttaaatt tataaagatt aaaaactttt aaatgtttta gtctttatat + 1561 ttaaatgtta tatgtaacaa aaaatgattt tgagtaataa a +//