Mercurial > repos > iuc > ete_treeviewer
changeset 0:2d4402c70eed draft default tip
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/ete-toolkit commit d2208e858d6486dd2e832978aca30ca67837cfd6
| author | iuc |
|---|---|
| date | Tue, 10 Dec 2024 09:55:15 +0000 |
| parents | |
| children | |
| files | ete-treeviewer.xml static/images/example-treeview.png test-data/example-alignment.fa test-data/example-tree-ncbi.tree test-data/minimal-tree-out.svg test-data/quicktree_VARL_NCBI.svg test-data/quicktree_alignment_VARL.tre test-data/quicktree_alignment_VARL_NCBI.tre |
| diffstat | 8 files changed, 2685 insertions(+), 0 deletions(-) [+] |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/ete-treeviewer.xml Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,149 @@ +<tool id="ete_treeviewer" name="ETE tree viewer" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="20.01" license="MIT"> + <description>visualize a phylogenetic tree</description> + <macros> + <token name="@TOOL_VERSION@">3.1.3</token> + <token name="@VERSION_SUFFIX@">0</token> + </macros> + <edam_topics> + <edam_topic>topic_3293</edam_topic> <!-- phylogenetics --> + </edam_topics> + <edam_operations> + <edam_operation>operation_0567</edam_operation> <!-- phylogenetic tree visualisation --> + </edam_operations> + <xrefs> + <xref type="bio.tools">ete</xref> + </xrefs> + <requirements> + <!--<requirement type="package" version="@TOOL_VERSION@">ete3</requirement>--> + <requirement type="package" version="8.10.1">curl</requirement> + <requirement type="package" version="1.6.1">xmlstarlet</requirement> + <requirement type="package" version="2.58.4">librsvg</requirement> + </requirements> + <command detect_errors="exit_code"><![CDATA[ + +curl http://etetoolkit.org/get_svg/ + -X POST + --retry 10 +#if $align.align_choice == 'yes' + -d "tree=\$(cat '$input_tree');fasta=\$(cat '$align.input_alignment');alg_type=$align.alg_type;$ncbitaxa" | xml format - > tree.svg +#else + -d "tree=\$(cat '$input_tree');$ncbitaxa" | xml format - > tree.svg +#end if + +#if $output_format == 'png' + && rsvg-convert -o tree.png tree.svg + && mv tree.png '$output_tree_image' +#else + && mv tree.svg '$output_tree_image' +#end if + + ]]></command> + <inputs> + <param name="input_tree" type="data" format="newick" label="Newick Tree to visualise" /> + <conditional name="align"> + <param name="align_choice" type="select" label="Add alignment information to image?" help="Will display alignments in the tree view"> + <option value="yes">yes</option> + <option value="no" selected="true">no</option> + </param> + <when value="yes"> + <param name="input_alignment" type="data" format="fasta" optional="true" label="Multiple Alignment FASTA file" help="If provided, will add alignment visualisation to tree image" /> + <param name="alg_type" type="select" multiple="false" label="Alignment display style" help="Will be ignored if no alignment file provided."> + <option value="block">Aligned blocks</option> + <option value="condensed" selected="true">Condensed format</option> + </param> + </when> + <when value="no"/> + </conditional> + + <param name="ncbitaxa" type="boolean" checked="true" truevalue="ncbitaxa=true;" falsevalue="" label="Resolve Taxonomic IDs?" help="Use NCBI numeric taxids as leaf names (or in the format TaxID.sequenceName) in your tree." /> + <param name="output_format" type="select" multiple="false" label="Format of the output image." help="SVG or PNG"> + <option value="svg" selected="true">SVG</option> + <option value="png">PNG</option> + </param> + </inputs> + <outputs> + <data name="output_tree_image" format="svg" label="${tool.name} on ${on_string}: Tree Image"> + <change_format> + <when input="output_format" value="png" format="png"/> + </change_format> + </data> + </outputs> + <tests> + <test expect_num_outputs="1"><!-- test 1: with NCBI TaxIDs --> + <param name="input_tree" value="quicktree_alignment_VARL_NCBI.tre" ftype="newick"/> + <output name="output_tree_image" file="quicktree_VARL_NCBI.svg" ftype="svg" lines_diff="500" /> + </test> + <test expect_num_outputs="1"><!-- test 2: with alignment file --> + <param name="input_tree" value="example-tree-ncbi.tree" ftype="newick"/> + <param name="align_choice" value="yes" /> + <param name="input_alignment" value="example-alignment.fa" ftype="fasta"/> + <output name="output_tree_image" ftype="svg"> + <assert_contents> + <has_text text="Generated with ETE http://ete.cgenomics.org"/> + <has_text text="Branchiostoma floridae"/> + <has_n_lines min="150000" /> + </assert_contents> + </output> + </test> + <test expect_num_outputs="1"><!-- test 3: with aligment style set --> + <param name="input_tree" value="example-tree-ncbi.tree" ftype="newick"/> + <param name="align_choice" value="yes" /> + <param name="input_alignment" value="example-alignment.fa" ftype="fasta"/> + <param name="alg_type" value="block"/> + <output name="output_tree_image" ftype="svg"> + <assert_contents> + <has_text text="Generated with ETE http://ete.cgenomics.org"/> + <has_text text="Branchiostoma floridae"/> + <has_n_lines min="25000" max="30000" /> + </assert_contents> + </output> + </test> + <test expect_num_outputs="1"><!-- test 4: minimal tree, no taxonomy, no alignment --> + <param name="input_tree" value="quicktree_alignment_VARL.tre" ftype="newick"/> + <param name="align_choice" value="no" /> + <output name="output_tree_image" file="minimal-tree-out.svg" ftype="svg" lines_diff="0"/> + </test> + <test expect_num_outputs="1"><!-- test 5: png output --> + <param name="input_tree" value="quicktree_alignment_VARL.tre" ftype="newick"/> + <param name="output_format" value="png" /> + <output name="output_tree_image" ftype="png" > + <assert_contents> + <has_image_width min="500" /> + <has_image_height min="500" /> + </assert_contents> + </output> + </test> + </tests> + <help><![CDATA[ + +.. class:: infomark + +**What it does** + +This is a tool for phylogenetic tree view (newick format) that allows multiple sequence alignments to be shown together with the trees (fasta format). It uses the tree drawing engine implemented in the ETE toolkit, and offers transparent integration with the NCBI taxonomy database. Currently, alignments can be displayed in condensed or block-based format. + +**Input** + +Input trees should be in Newick format. Optionally a fasta alignment may also be provided. Leaf names in the newick tree should match those in the fasta alignment. + +Tip: Use NCBI numeric taxids as leaf names (or in the format TaxID.sequenceName) to get on-the-fly translation of species names and lineages. + +For example:: + + ((6669.DappuP312785:1.24473,(((7739.JGI126010:4.02e-06,7739.JGI126021:0.168081)0.99985:0.848895, [..] + +where 66969 and 7739 are NCBI TaXIDs. + +**Output** + +The tool will output a tree image in SVG or PNG format. + +.. image:: $PATH_TO_IMAGES/example-treeview.png + :width: 50% + :alt: example tree image + + ]]></help> + <citations> + <citation type="doi">10.1093/molbev/msw046</citation> + </citations> +</tool>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/example-alignment.fa Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,164 @@ +>7029.ACYPI001869-PA +-P----------TKNANE-F-ANDLFETCNLTEIESLQSSLKKDVEKKADQLKSLVSEKYRDLIDAADTISSMAIIVSDI-T------NVTEHILKTNQTN--------------------TA--TD-FDSKDNLLD-KFAAQSKLLIDLTEQIWDCLNSRNYLTATQLFQLASCIKTSLNEDL-----IKGLKKGKPFLDRVWSTISHFQTTISDKTRLEL-SDYISPEKAACCFISLSILEKLDAHSLVKEFIILRSNMLQHSLTEG-------ISVEKNIENNYDLYNS------------------------GMIYLQIKNILCNGPN-VLS--LVDLD-YSLK-FGLIYLPDTVKEFKIDCML-SPNELSKEYITNIVTNWLVWAKPFVCTKVTEILQSVQSFSALRHL-----NHL-----SPQHWTAISEQISF-E---SDLWSELYCPLFAQRTKELLTNHWEDVFPVIISDIDSALIQPEEP--------------NLQDSLFSDTDE---------------------CFETRSIGCSDRTATLCACVERRISLLVDMLSELYSEDEDPW-----------------------------ALRQHQGSCCNNFIIRLGSMVQL---------VEQDTLTEPGILLIARFLWFLPILCTTLKQCLVS------------------------------SYQQFNFWTLSKEEMQNSSIVVWNKWIEIVTKRMFDGLKGNIFPI--TLGEQLSTIPKWDILDIEVEKESGELVVSKLQVPNQPTFPLQNFIHDMIRCLA----LTLPKFVQEKTIALCTEWILIEYRN-------NSEL-ETSLKSRHQLQKLFDLKYINQLFIGIENQ------SLSVICSEQISAVENQIDPINLDVLDEYIVKNVKRAVVATKCIFGTMYPSQ--F----LQ----SE-C------SDEANNLMFS------TYRFKLFLVT------DS---------------------------------------------------------------------------------------------- +>45351.NEMVEDRAFT_v1g217973-PA +M-PRQTHQKTVP---WDAEIDSDALFSSHTIDEIRALENKTRLERQQFSVALLLIVNGVVVDVVLVVDVVL---LIVNGV-VVDVV-VDV---VLLIVNGV-VVVVLL-IVDV-DVV---LLIV-VVD-VVSLIVNGGGVVVDVVILIVNGVVVDVVLLIVNGVVVDVMLLIVNNVVVGVILL----IVNGGVVSSFPILQRQWAAISHFKESILQGSRALLKDATQTDEATADALCSILLLEESSPRQVFSEFLLARKSALQEIFHPS-QH---ATSIKSQICEVVRVIRTSLYQIYTLFMYGLDGNIHEIKDNPSLLFQVLYKVTRRERDDEEAEGLFGPD-FDLV-TSARYLPKTVLGYRPHMR-SFPATIPLRNIQANCEEWINMCLRDVSSGVAKLLKYIGTLKGLATIRDAIWNLLKEAAD-GLTWEDLCRTV-LNK--DMCLWDTFLRPLFSERAKTILRGLFNATVSSSKNMVTKSMDDLSDYH---HTDPMVRWDRDLAGYVWHESANDGPLSILSVGNNATKDK-DGGGLTLKSLACTPSIVSLCSSINDKLSVILEDAQYLIADPKPDNA---SVSSQNEAGHQSPFDRYKDSSKIQTFLQDACFTAFNELLAFIDQLFTEHKKLESDTSLCYDTTCIDRVLFMGRLCRAVPTQCTHLKHVMQGVVTQTESTP---------------------------------------------------------------------------------------------------------------------------------------------------------------------SRG------------------------------------------------------TP---------------------------------------------------------------------------------------------RLT--RSSS--VAR-R-KS--------S----------------LLF------------E-RHG------------------ +>7260.FBpp0240708 +-M----------TASLLN-LNVDTLFEQNNVSEIDAVHKKIQTVVENKREELRTQVGERYRDLLKAADTIAAMQTSAGTL-IEQ--VHHVQENCRKLNEQQL-LGFKDTLS--PTILEGHGTR--SK-NKKLQNYYS--CMVQIKLLTSLPELIWTHIDNEHFYAATELFIFSRHISTGLQLDGQS-----ELMQKLPVAAKQWEILRPFHLTIKQAIMSVLERETINSDVAVDCLQSLLLLDKCDLVSAIKTFLHLRATAFLNSLESKT-G--EPRRVKERILASLGILNDTIELIEKCLL------------ENGLLFSRIKDCNSSAWT-PSI----NRME-SSERQLAYLLPDIIANFKPQFDD---PKLEVHQMSAALQQFLDKIDSLASKQLEQIFALVSNMQTIQDIKSTASATQ----ERL-NFNHLEQYWNL-KASQLDFYGMKYTPLIHKRIREIIRNSWSLAMTKTYEKVLQQVETG---Q-------L-----PVAEQIWREQSEDLPLSLAAALND------QPKRLANRTKGYDSSTIDVCKQFDSYLADIVKEMNVLLQEQTTK---------------------SEDKLELIQFLRETAQEQITQYLGRLK---------------SLKLKERRTLLQALSNTLALVELCPNLKLCFCPPS----------SWRQWSA-----------NSMGLEHWPRLCGLIEDEMFQFWLLVIDNVLSAN--SCKDKMPK-AMNHEVVLRDFPLWQSQTLEQRDEDAERVQSTIRIPIQPRLSLQTYLHDLIHSLNQAVPQTLPPKVLQAFNQKLLSELLSHYES-------LSTSDCAKSSQNISLQLYFDLKFLERLFGIREER------SLYDRFHSLQLSLKDCIDPFDFELFAEHISTHVARSSNRLHGEFGVLTPNSVQNQSIIS----PSNS-SS--LAHEADPNVLCLSSSGSTSLWFPLLPIVVPP-QGTAPTMAAERKTEL----------MES--E---------KTT-------PTRKATT------T--RKS--EGTNKSKSSAASFFGMS-QEWFRSS-- +>7237.FBpp0281462 +-M----------TANLLN-LNVDTLFEQHSVSEIDVVHKKIQTVVENKREELRTHVGERYRDLLKAADTIAAMQTSAATL-IEQ--VHCVQANCRSLNEQQL-LGFKTTA---P-TDAALQQR--NA-SKKLQSYYG--TMVQIKLLTSLPELIWTHIDNEQFFAATELFIFSRHISTGLQLDGNS-----ALMQKLPVARKQWEILRPFHLTIKHAVLAVLEREELCPEIAVDCMQSLLLLDKCDLSSVLQTFLNLRASAFLNCLQSHL----EPRRVKERILASLGILNSTIELLDKCLL------------ENGLLFTRLAECSASTCP-PSI----SRME-SSERQLAHLLPEIIAGFKPQFDV---PKLSPKHLGMSLQQWLDKMNALAATQLQQIFALVSNMQTIQDIKSSARSTG-----RP-SFLHLEQQLHL-EHSELDFYATKYVPLINARVREIIRSSWAHAMEQTYEKVLSLIEAG---V-------S-----TPPHQIWKEQNDDLPLSLAAALSD------QPKRLANRTKGYDSSTIDLCKQFDSQLADIVQELNVLLQEQTTR---------------------TEDKMSLIKFLRETAQEQVAEYLSKLK---------------SLQLRERPALLQALRNSLALVELCPNLKLCFCQPP----------SWRQWNQ-----------SGAGIDHWQRICGLIEDEMLSLWLLIVEDVLTAH--SCEKKLTK-ITSHEAVLKDFALWQMITLEQRDEEEQSVQSTIRIPSQPRLSLQTYLHQLIQALNLAVPQTLPSKVLHAFNQKLLGQLLGHYEG-------LAAAECTKTSQNIALQLYFDLKFLERVFAVREER------PLYDQIHSQQNNLRDCIDPFDFELFAEHISTHVARSTSRLQGELGVLTPYTPA--PGQG----TTAS-SA--LAHEADPNVLCLSTSGSTSLWFPLLPIVMPQAAGGLAG--SERKQKP----------VET--DKTIAT----TATTTTT---PTRKGGS------ATTRKG--D-NSKSKSGAASFFGMS-QEWFR---- +>7217.FBpp0120932 +-M----------TSNLLN-LNVDTLFEQHSVSEIDAIHKRIQSLVENKREELRTHVGERYRDLLQAADTIAAMQTSAGTL-IEQ--VQRVQSNCRSLNEQQL-LGFQSSAAEDA-SEAALQQR--SA-NRKLQNYYG--TLVQIKLLTALPELIWTHLDNERFYAAAELFVFSRHISTGLQLDGQS-----ALMQKLPVARKQWEILRPFHVTIKQAVLAALEREQLPSELAVDCLQSLLLLEKSDLAAVLQTFMSLRSAAFLRCLESRS----EPRRVKERILASLGVLNSTVDLLDKCLL------------GDGLLYSRLDECAASTYP-ATI----SRMD-SSERQLAHLLPDIISGFKPQFQV---VQLAPEQLGVSLQQWLDKMNALAAN-LQQVFALVSSMQIIQDIKSEATASG-----RP-DFGRLEQQLKL-KHSQLDFYARKYMPLINERVREIIRGSWAAAMKQTYEQVLTLIENG---Q-------L-----QPPHQIWQEQSDDLPLSLAAALSD------QPKRLANRTKGYDSSTIDLCRKFDAHLADIVQELNVMLQEQTTR---------------------AEDKLALIKFLRETAREQITEYLSNLK---------------SLQLRERPALLLALRNTLALVELCPSLKLCFCQPP----------AWRQWTG---------NLTGVGIEHWQRICGLIEEEMLSFWLLIVEDVLAGH--SCEDKLPK-IINNEVVLTDFALWQSLTLEQRDEEEQSVQSTIRIPSQPRFSLQMYLHQLIQALNEAVPQTLPPKVLQAFNQRLLGQLLTHYEG-------LARADCTKSSQNIALQLFFDLKFLERVFAIREER------ALYDRIHEQQNQLRDCIDPFDFELFAEHITSHVSRATSRLQGELGVLTPAA----SSQG----ASGN-SS--LAHESDPNVLCLSSSGATSLWFPLLPIVMPQAS-------GENKTLV----------PEP--S---------EKIATTT---PTRKGGS------GS-RKG--D-SGKSKSGASSFFGMS-QEWFR---- +>7245.FBpp0269552 +-M----------TANLLN-LNVDTLFEQHSVSEIDAVHKKIQSVVENKREELRTHVGERYRDLLQAADTIAAMQTSAGTL-MEQ--VQHVQANCRSLNEQQL-LGFQSTAN--S-KDAVLQER--NA-GKKLQTYYG--TMAQIKLLTALPELIWTHLDNDRFYAATELFIFSRHISTGLQLDGQS-----TLMQKLPVARKQWEILRPFHVTIKQAILTALEREELLSEMAVDCLQSLLLLDKSDLSAVLKSFLNLRSSAFLNCLQSGP----EPRRVKDRILASLNVLNSTVDLLDKCLL------------GDSLLFSRLEECASSTCP-PSI----NRME-SSERQLVHLLPDIIAGFRPQFEV---PQLTPEQMGSSLQQWLDKMNALAAAHLQQVFALVSNMQTIQDIKSAARTNG-----RP-EFVRLEQQLHL-KHSQLDFYARKYVPLINARVREIIRSSWSSAMKQTYEQVLLLIESG---Q-------S-----QPPQQIWREQSDDLPLSLAAALSD------QPKRLANRTKGYDGATIELCKRFDSHLTNIVQELNVMLQEPTTR---------------------VEDKVSLIEFLRETAEEQLTEYLTNLK---------------GLQLRERPALLLALRNSLALVELCPNLKLCFCQPS----------SWRQWTD---------NSSGVGIEHWQRICGLIEEEMLSFWLLIVDDVLAGH--NCDEKLPK-VINHEVVLSDFALWQTLTLEQRDEDEQSVQSTIRIPSQPRLSLQTYLHQLIQALNLVVPQTLPPKVLQAFIKRLIEKLLRHYEG-------LAHAECTKASQNIALQLYFDLKFLERVFSIREER------TLYDQIHAQQNQLRDCIDPFDFELFAEHITAHVSRAASRLQGELGVLTPSPAA--PSQA----ATAA-SS--LAHESDPNVLCLSSSGSTSLWFPLLPIVMPQAAGRVNS--TERTSLA----------LEP--V---------EKTATTT---PTRKGGN------GA-RKG--D-SSKSKSSAASFFGMS-QEWFR---- +>7227.FBpp0082093 +-M----------TANLLN-LNVDTLFEQHSVSEIDEVHKKIQSVVENKREELRTHVGERYRDLLQAADTIAAMQTSAGTL-MEQ--VRHVQANCRSLNEQQL-LGFQSTAN--S-KDAALKER--NA-GKKLQTYYG--TMAQIKLLTALPELIWTHLDNDRFYAATELFIFSRHISTGLQLDGQS-----ALMQKLPVARKQWEILRPFHVTIKQAILTALEREELLQEMTVDCLQSLLLLDKSDLSTVLKSFLNLRSSAFLNCLQSGP----EPRRVKDRILASLNVLNSTVELLDKCLL------------GYSLLFSRLEECASSTCP-PSI----NRME-SSERQLVHLLPEIIAGFKPQFDV---PQLTPEQLGSSLQQWLDKMNALAAAHLQQVFALVTNMQTIQDIKSAARTNG-----RP-DFVRLEQQLHL-KRSQLDFYARKYVPLINARVREIIRSSWASAMKLTYEQVLLLIEAG---Q-------S-----QPPLQIWREQSDDLPLSLAAALSD------QPKRLANRTKGYDGATIELCKRFDSHLADIVQELNVMLQEQTTR---------------------AEDKVSLIEFLRETAEEQLTEYLSNLK---------------GLELRERPALLLALRNSLALVELCPNLKLCFCQPS----------SWRQWTD---------NSAGLGIEHWQRICGLIEKEMLSFWLVIVDDVLAGH--NCEEKLPK-VINHEVVLSDFALWQTLTLEQRDEDEQSVQSTIRIPSQPRLSLQTYLHQLIQALNSVVPQTLPPKVLQAFIQRLIGKLLCHYEG-------LAHAECTKASQNIALQLYFDLKFLERVFAIREER------TLYDQIHAQQNQLRDYIDPFDFELFAEHITAHVSRAASRLQGELGVLTPSAAA--PSQG----AAAA-SS--LAHEADPNVLCLSSSGSTSLWFPLLPIVMPQAAGRVTS--AERKSPI----------QEP--V---------EKTATTT---PTRKGGN------GA-RKG--D-SSKSKSSAASFFGMS-QEWFR---- +>7222.FBpp0149372 +-M----------SADLLQ-LDVDTLFEQHGVSEIDAVQKKIQTVVENKREELRTMVGERYRDLLKAADTIAAMQASAGTL-IEQ--VHCVQGNCRSLNEQQL-LGFRTMP---P-TEVLHQQR--TA-SKQLSNYYS--TMVQTKLLSSLPELIWTHIDREQFYAATELFTFSRHISTGLQLDAKN-----ALMQQLPVALKQWEILRPFHLTIKQAVLSVLEREELSAEMAVDCMLSLLLLDKCSLLQVLQTFLQLRATAYVNCLQSPS-SSAKPRRVKERILASVQILSGTIELFDTCLM------------TNGLLFTRLTDCMSPTSP-PSI----SRMD-SGERQLAHLLPDIICGYRPQFQA---PQLTQQMLHDALRQWLAKIDGLAAKQLQQIIALIGSMQTIQDITLEANESG-----KR-HYKALEEQFEI-APEQLDFYRLHYMPLINARVREIIKNSWAAAMQQTYEQVVSLVQSS---R-------E-----PAPLQIWREQSDDLPLSLAAALGD------QPKRLANRTKGYDVATIELCAQFNAQLGAIVHELNATLEDQTSR---------------------IEDKIALTNFLRETAHKQLTEYLTKLK---------------SLGLKERQALLQALRNTLALIELCPNLQLCFSQPS----------NWRQWVG---------NQTSVGAQCWQRLCSLIEQETLQLWLLIVDDVLGAH--SCAEQLPA-VLTHDVVLRDFALWHTQILEQRDEEDQNVQSTIRIPSQPRLSLQTYLHQLIEALNIAVPQTLPPKVLQAFNQKLLTQILCHYEQ-------LAASECTKSSQNIALQLYFDLKFLERVFGVSEDR------AMYEQFHTLQRNLRDCIDPFDFELFAEHIRTHVSRSTARLHSEFGVLTPPPMIVPAATA----AAGG-SA--LSHEADPNVLCLSSSGSTSLWFPLLPIVMPQAATTTTS--ADCKNLA----------LDS--DKA--T----ATTTTTT---PTRKQT----------RKA--D-ANKSKSSAATFFGMS-QDWFR---- +>7244.FBpp0224481 +-M----------SADLLQ-LDVDTLFEQHGVSEIDAVQKKIQTVVENKREELRTMVGERYRDLLKAADTIAAMQTSAGTL-IEQ--VHCVQSNCRSLNEQQL-LGFQTT----T-AEVQLQQR--TA-NKQLSNYYS--TMVQIKLLSSLPELIWTHIDREQFYAATELFIFSRHISTGLQLDAKN-----ALMQRLPVALKQWEILRPFHVTIKQSVLAVLEREQLSAEMAVDCMLSLLLLDKCDLGQVLQTFLQLRATAYVNCLQSQS-SDAKPRRVKERILASLHILNGTIELLDTCLL------------ANGLLFVRLAECIAPTSP-PSI----SRMD-SSERQLAYLLPDIIAGYKPQFET---PKLAPQQLSDALRQWMSQIDRLAAKQLQQIFALVGNMQTIQDIKLAAGATA-----SR-SYAELEQQLKL-PQAQLDFYRIKYMPLINARVREIIRSSWSAALQQTYEQVVKLVENS---T-------P-----PAPLQIWREQSDDLPLSLAAALSD------QPKRLANRTKGYETATIALCGHFDAQLAAIVQELNVLLQEQTTR---------------------AEDKLALIKFLRETAQQQMTEYLRQLK---------------ALRLQERHALLQALRNTLALIELCPHLKLCFCQPS----------SWRQWAG---------NLTAGGVEQWQRLCAQFEEELLQLWLHIVDDILARH--NCAEKLPH-PITHDVVLRDFALWQTQTLEQRDEEDQNVQSTIRIPSQPRLSLQTYLHGLIQALNDAVPQTLPPKVLHAFNQQLLTQLLAHYEQ-------LAAAEGTRCSQNIALQLYFDLKFLESVFGVREER------SLYEQFHALQRSLRDCIDPFDFELFAEHITVQVSRSTTRLHGELGVLTPSQ--D--NTQ----AASG-SA--LSHEADPNVLCLSSTGSTSLWFPLLPIVMPQAAAATAAVQAERKSLA----------SAP--DKG-----------TTT---PTRKLGRDASASASTNSSI--N-NNKSKSSAATFFGMS-QEWFR---- +>43151.ADAR004533-PA +CRQSWCAMA--KSVELLD-IDVDKLFKQHNVAEIDLVHKRLQGEIELKREELRTMVGERYRDLLKAADTIGEMKQTASTI-IEN--IDRITARCQQLNEHNL-IGFRRSG---N-DY--QRLQ--KK-HHSDQGFHG--VIVQIKLLTSLPEMIWSCIDREDYFVATQLFIFARHVSTGLNLDTER-----ETARKFPVAAKQWQVLSQFFYTIQQACLESLGREELSVPVASKSLASWLLLESCPVERVLAVFTERRSKAFLAVLEEHG-PEARYGKVKDKLLASLRVLIGTIRLFYECFLDDGFT--EGEGTVGGGFQRELHQITDDQAV-PTI----ELIR-SEDPMILQMVPEVISKFRPRLQPSFSSELAESEIRRSASGFVKSIEDAISERLRRLVSLVPSIKTLHDIKTQAYAIE-----KPSNWTTITGRLGL-EE-GIDFYVTFYQRLINDRVQYIIKSSWSETVRQTAAELLQLLQQP---P-------S----TELKAFVWRESLEDVPLNLQAALERTN---PAARKLLMKARAYPPAFVTLLNAFNERVLALVRDVASFLATSTR-----------------------TEVDDVLAFFRECCVEGVAELVTTIK------A--------AGFEPTVERYALLARFLIAIAELCPALRECFLPNTTASI--G--SVWSPVARTSLLSPASATVSEEDPERWAKVSGLLEEESLRFWSVWVERFHESW-----PSLPV-EVGYGTLLNDFPSWETVTIEENDENNQPIQSTIRVPSLPSIPLQRFLHHVCDLLNEAIPQTIPRAIVIQIVELLTTDLRRYYEQ-------LAADEFTVQNQSIALQYYLDLRFLQLMFVGREQK------QISEQFTQLTARFKSYVDPFDFDVFYAHLNTNVKRSVGKLQHFLGVLVCQPEQLSTLVGGT-VTGQG-GK--VPFDKNANILALSSNSMNVAWFPLLPIVSKDLTVASGAPLGSDSAILA-KK-PSTESAGTT-DQRNTA----NVTTGKSNKEPSATGAS-ATAGPSTSSAA--T-AQNYAKGAAAFFGLD-KDWFR---- +>7165.AGAP001322-PA +-------MA--KSLDLLN-IDVDQLFKQHNVAEIDLVHKRVLNEIELKREELRTMVGERYRDLLKAADTIGDMKQTAGSI-IGN--VDRITARCQQLNDHNL-IGFRTGT-----DY--QRMQ---K-KHRDHNFHG--VIVQIKLLTSLPEMIWSRIDREDYFVATQLFIFARHISTGLSLDTER-----ETMRKFPVAAKQWQVLSQFFFTIEAACRESLGREELSVAVASKSLASWLLLESCPVEQTLSMFTERRSKAFLDVLDENE-TVY--EKVKDKLLASLKVLIGTVRLFYECFVDDGTA--EADG-VQGGFQRELQHITGDKAA-PTI----GLIR-SEDPMIMQMVPEMIAKFRPRLE---RIDLAEENVRTAVSAFLRSIETTVAGRLKRLVSLVPSIKTLHDIKRQAIALD-----KPSNWSAVTAKLGL-SE-GTDFYATFYQRLINDRMQSIIKSAWTETVQKTRSDLLELLAGN---P------------GDLKAFVWKESLDDVPMNLETALDRSN---PSTRKLLMKAHGYTPALVALIGSLNGRLQTLTRDVRSFLSSSTR-----------------------SEVDEMLAYFRQCCVDGVAELITATK---------------AEFDPTAERYALLARFLTAVRELCPALRECFIPTTIGL---A--DSW---HAGRT---SSSAMPEEDPERWAKVAGLLEDESLQCWTLWVERFQQRW-----PTLSA-DVGYDALLNDFPVWETVTIEENDENNQPIQSTIRVPSQPSFPVQKCLHHVYELLNEAIPQTIPRPTMLDIVERLATMLLKHYDV-------LAGTEFVQQNQSLALQYYLDVRFLQLLLMGREQK------QLNERFNELVGRFKSYIDPFDFDVFYGHLNANVKRSILKLQHFLGALICHSEQLGTIVGPS----GA-GT--EPLDKNPNILTLSSNSLNMVWFPLLPVVCKDTASATAGSSGLTTASLLQKG-SAGGESGKS-TLGSSG----NSAAGTKQST-----KE-ATAGGSSTSAG--T-AQNYAKGAAAFFGLD-KDWFR---- +>7176.CPIJ007948-PA +-------MA--NVTNLLH-INVDKLFEQCGVADIDLVHKRLQSEVELKREELRTMVGERYRDLLKAADTIGDMRTTAGSI-IEN--VDTIQAACRKLNDHQL-IGFRTDH---Q-QR---KLR-----KTTNDNFHA--VIVQIKLLTSLPEMIWSAIDGEDFFVATQLFIFSRHISTGLQLDSNA-----ALMAKFPVAKKQWAVLSQFFYTIKQNCSSCLEREDLQPEVAAKCLASLVLLESCQLDHILSVFVQMRLKAFAGVLAEGS-RH---EKVRDKILASLKLLMNTVELIHTCFVGV-----------DGLLMRELNFITGENAQ-PTI----GLIK-SEDPKIIQTLPDIISRFRPRIQ---LEALGDERVGKHSKIWLQNVEKIATNQLSKLMNLVPSIKVLHDIRKLSLTVA-----KPESWSSTCAELSL-QE-SLDFYSKFYQPLINARVRTIIKQCWLETIAQNGDDVSKLLTMN---A-------SNKQLRDVKSYVWQESSEDVPLNLKDALDCAN---LASHQLLMKSRAFPPPLVELVSSLDNRLESLTKDVTTFLGASTP-----------------------DEAQQLIEFYSDCSSESISQLLTTIK---------------ADYERSPENYVLLARLLVAFKELCPALKKCLTPSQLSNAETL--MPWQSED----------SELDAKKDRWNNAAGLLDEESLAFWKLWLEQFVKKW-----PVLEG-NVGYHTLLTEFPLWDTVTIEENDEQNQPVQSTIRVPAMPSFPLQKLLHVIATLLNSLIPHTIPKRIISQILDLIGNRLLAHYQT-------LTASEFVQRNQNCSLQYYFDLKFIQLLFTADREK--------KQQTDALIATYRAHIDPFDFDVFHAHVNANVKRAVTRMQHFFGVLLVNGEPALGGSA----TTTA-NK--SGQDRNPNILALASNSASETWFPLLPIVTKEATAQGNAGQDA--PKV----------AKN--Q---------A--PPKREPS-----RE-PPTPSSSSSAV--T-AQNYAKGAAAFFGLD-KDWFR---- +>7159.AAEL007141-PA +-------MA--NVGNLLN-INVDKLFEQNSIAEIDQVHKRLQAELELKREELRTMVGERYRDLLKAADTIGDMRTTASSI-IGN--VDNITAACRKLNDHQL-IGFKSAS---D-QL--RPNQ-----KSSNNKFHG--VIVQIKLLTSLPEMIWSAIDEEDYFVATQLFIFSRHISTGLQLDANS-----EMMAKFPVAKKQWAVLSQFFFTIKQNCATCLEREDLTPQVAAKCLASLVLLENCQLDYILSLFVQMRLKAYAGVLSESS-RY---EKVKDKILASLKLLMNTVNLMHECFIGNDRE--------PGLLMKEMMLVTDESAL-PTI----GLIK-SEDPKIIQTLPDIICKFRPRIA---LQPLNKELVLKSSQFWLHNVEKIATGQLSNLMNLVTSIKVLHDVKKLSLKAA-----SPDNWSNICEKLSF-SD-SLDFYAMFYQPLISSRIKAIIRQCWSEIIASNNSDVLSLVSSA---S-------T-----DKHAFVWSESTEDIPLNLKAALDRSQ---PATHYLLMKSKAFPPALVQLASSFDKRIQILTMDVQSFLESFST-----------------------NEAGQLIEFYSDCSVESINELLTAIK---------------NDCNPSSDKLILLARLLTAYKELCPSLKQCLTPSLMNQVEIA--TSWQSEG----------KLT--DGDRWNNISGLLEEESIRFWNLWLEQFVAKW-----PQLDK-QISYQTLLTEFPLWDTVTIEENDERNQPVQSTIHIPALPSFPLQKLLHVITTLLNTLVPQTIPKAIVLQVVERIISYLHDHYRF-------LSQNDFIQKNQNCALQYYFDLKFVQLLFTGRDRK------QLAEPYNQLIGEFKSHIDPFDFDVFYPHVNTNVKRAVQRMQHFFGILLTNSDQLSSLLGTSTGNASQ-VA--PVKDKNPNILALSSNSASETWFPLLPIVTKDAPVTAVVASAA--VSV----------AES--T---------KS-SSKVEVS-----LV----QSLSSSTV--T-AQNYAKGAAAFFGLD-KDWFR---- +>7070.TC009561-PA +-I----------SYNLLE-LDVDKLFEEHKIEEIVEIEKLLDAEIERKRVELRSMVGDRYKDVLAASDAIKNMKTISQQI-VDN--IQNITDICEDLIESKD-DKAAKTL---P--------E--ID--TKCNEERV--LIVQVRLAIFMNEQIWTALDGGDNLTAAQFYLLAQHIHMGLSLTK-----K-EYLDKLPLLKQIRANLATLRDQIFERIKQKLEFVEITAEETSSNLNALLLLRNQSATDLLNIFIEHRKIALNTVINTS--H----ASVRLQISAMVRCLITTIHLLHDCFMCYGNS-------KKGLIWQQLENIVEDESI-PTL----SKVDLPVTPL-IAYIPDVIKQFRPKYKS-FVGESAPENVK--LGEWLASTKESVCKGLESSLKLITSVKGLHIIREEALKIE-----LPSDWERICSESNL-PEN-FNVWYYFFQSLITKRASELISKKVSCIIKDLESEIREVLSGNLGS---------EHGETDLRWYTWVEDPTDVSRI-----E------NKHTGLSMKTLGYSQNVVNLCEKLDGKYLELLIDVSQYLYGKEFTD-----D-VIIYPHLKSDRKKFVDREELENHLRLESTKNSTSLTLFLH-FIK------------SESHKVAKSLLCARFLQAVTNLCPHFNKCC-T------------------------------FNASTEDWSRICGHFTKSSVQFWENWIESCVQETDKQARKLFS-D-VSVCSMISVLLRWDSIEIQEQTDE-KIFKSQIKVPLKPSLTLHRLLSKLNDDLSHVLPHTLPKQVHLQFIEKTTETILNHYKL-------ALD--HNQLNQNQSLQLLFDVKFVTTFSIQRENS------KLVALSQEICDKLRARIDPFDLDVFYSHLQNNVKRAVLQSQAILGCLLPSSAQ--L--AN----LGVGEKFK--EEKEPSVMALSVP---SVSFPLFCTFAHQI--PAQKAPVVDVQEK----------VSS--P-K-------LTK-TTPK--RS----------------DPTA--AI-RSGAAALFGGLTTDWFS---- +>13037.EHJ66433 +-Q----------EQNLLD-IVPDKLFQTHSISEIDNVQKKLQYEIERKREELRAMVGERYRDLIHAADTIEEMLTTTSST-LEH--INDMMATCRNLHDTHL-VGFKINE---K----K-HSQ--NS-QASIDPVHS--ISVQIKLLMEIPEKIWKSLEVNDFVKAAQLFIMARHINTGLQLQIAD-RNTNPGKSLYQLIQQQWNSISHLSDTIVEMCGQKLRDVDISAEVSCSCLIGLYLLDSQSMVELLNTLIDLHSNTLAQILE-DV-K----AQIKKKIINSVKIVMKTVVLVYACFVENQGG----------AVLDKLKDLYRPDSQ-PLI----ELI-QFSDANALKLLPSAITNYRLSLSK-DLSPLAADQVTGSVQRWSVWVKSFILENVTSLLQNITRIRVLHEIREETFKIE-----CPQNWSTMCSSLGI-PE--VHIWCTYFQPLLTARVRNIIETRWQKINDSFKTQILIDLSKVASD----------DREADINWFVWKDLIGDTVIESRNEVVSVME--SLMKGMSRQDRGFTPALQKLCQSLDDELQKLLEDLKDYLYERKDKD---P-------LYDDELDQVYTDKEEIETYLKEASDRNIHSIIQYIRACFDE-T------LQSTELQRKTTAVYTARFTQAITVLMPCLRKCYITLD-------------------------------DTKAWNDICAVLKENCLFCWSKWLDIAEVKI-NELTTGLPQRFTLEDNIDYLMMEWDVMKIEEKDEDGNPVESTIKVPAGPSLKLQEYLYSISRILDEVVPHTLPSEIHARYIDKTISISLAHYNR-------VIRENEQDINQRCALQLLMDVRHLTLLMVARDNK-------AMELSQDICDVLRHKIDPFDYDVFYPYIQTSLKRSVQRVMILLGSTSQPQSL------S----KPVRSGGS--ADSAARILAAADA----PWFSLLPVALPVKKEK----VAKKKP------------STS--P-S-------KTK-PDVT--DNI----------MSASLP-IN-FANARSGAASFFNSMTSDWFSG--- +>34740.HMEL012959-PA +------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MMQLLNTLIDLHSNSLAQILDGDV-K----AQIKKKIVNGVKIVMKTVELVFACFVEM------------------LNDLYEIKSP-PLL----ELV-QFSDAAALKLLPSGVTTY-------------------SVQTWSVWVQSFINDNVQALLQNITRVKALHEIREETFKIE-----SPPKWSIICNSLDI-PA--VHVWCHYFQPLLTSRVKLIIDNRWQRVYDTFKTQLLVDLTKKLLE--------------DLKDYLYQEKKK--------------------------------------------------------------D-------IIVFDDEDSVEQVYIDREIVEEYLRNTSDKNILNMINYIKACFEE-S------LQTTELQKKTLCIYTARFLQAITTLMPNLHKCYINEVT-------------------------SMNDNAIKSWNEMGVVLKENCQFCWIKWLDIVEEK-----------------------IQWDIIKIEEKDEEGKSIESTIKVPCGPSLKLQEYLYSISRILDEVIPHTLPTEIHSMFIERTIAISFAHYNK-------VIRMKEMDITQRCALQLLMDVRHLTLLMVARENK------KSIELSQDICEFLRQKIDPFDYDVFYPYIQTNLKRSVQRVQTLLGSLILHHGQLTGIIGN----KPILSGGS--GDKTASLLASADT----HWFSILPVATPNVNKK-QDKMVKKKP------------QSS--P-N-------KSK-SDI---TDI----------MSNSLP-IN-FANARSGAASFFNSISTDWFRLN-- +>7091.BGIBMGA012450-TA +-S----------KSNLLE-IVPDELFQSHSINEIDQVQKKLQYEIERRREELRAMVGERYRDLIHAADTIEDMRVTTAST-LNH--ISEMMKACQNLHNTHL-VGFKISN---A----PTPTQ--SY-NVNSNQLHS--LSVQLKILMEIPEKIWTCIETEDFVKATQLFIFARHVNTGLQLQIGGQKSQPGVQSFHRMVQQQWNSISNFNQTIIRVCKEKLQNVEISVEIACSCLVSLYLLDSQTMVELLNTLITLHSNNLAKILEGDV-K----AQIKEKIVNGVKNVLKTVVLVYACFVDDAGG----------AVLSKLKELFKKNSQ-PLL----ELV-KFSDPNALKLLPPAISNYRLSTTQ-EPQALEEADIRKSVQVWNVWVKSFIETNVQTLLQNVTRIKVLHEIREEAFKIE-----TPPNWSTICSSLDI-PD--VHVWCHYYQPLLTARVKAIIDTRWGKLYDTFKTQILVDLTKVSCES-------EMEKEADINWFVWKDLIGETVIESRSDVVKVMN--SLMKGMSRQDHGYTPTLEKLCQTLDSELQKLLEDLRTYLYPEKRNA----DGLLFDYEEENGIDQMYIDKEDIDSYLRDVSDTNVESMIHYIKACFEE-T------LQSTELKRKTTAIYSARLTQAITTLIPHLHRCYIPETS----------DSIALC---------NTDEHCIKRWNSLCGKLKENCLYCWGKWVDIVTEKI-EDLTKRLPQEFTLEANIDYLMMQWDVIKIVEKDDEGNSIESTIKVPCGPSLKLQEYLYSVSRVLDEIVPHTLPIETHHTFIDKVTHITFSHYNK-------VIREKETDINQRCALQLLMDVRHMTLLFVARENK------KYVELSQEICEFLRQKIDPFDYDVFYPYIQTNLKRSVQRVQTLLGSLILHHGQLVGIIGS----KPILSGGT--GDKAASLLACGDA----HWYSLLPVATPVAHQKKQDKAVKKKTT-----------SAS--P-T-------KQK-SDI---SDI----------MTSSLP-IN-FANARSGAASFFNSMTSDWFSGQ-- +>6669.DappuP312785 +--------MAQE---LLSS-NIDGLFEKMTLEEIQQVLRKMRLEVEKKREDLRVTVGSRYRDLIEAADTITEMKKTSEE-VSEH--LHTMEDKLGSLKHRQ-LLGFQT---D-YSTE---KQ--KEIL-EAKKECR--ILAAQIRLLMELPEIIWKQIEAGNICPAAQIQQLGYHLHT-LSVESG-VGSAANVQKWFPVINQQKVSLASFNEIIIKESTNHLTEIQLTLEMAVDSCCALILFRGSSSNQMLSDFLKFRSEAVGRIVLQ--------SSIKQQLQSFLQFIISSFATLHALFVEGFPE----SSLPQGLLSEKLKATCQSPA--PT-VQLLSL----TP-GFLRQLPPIITDFRPSTK-EVWTPLPISQIRNEFQNWFQTIRDLVPKELNQMLSCVSNIKTLASLRDLAFTTLQAE-F-ANKWSELSQRL-LGS--DVKLWEELFEPAFVEKVGAIIQGKLDHALDTVKQ-------SIEQN----------YVKFDLKTWLWTESPNDLPQSTT-------APQ-HSSGVYMKTRCYMPTVQQLCSLWDQKLALLREDLGYYQDGKTAE------------GELFIPFDKFDKHAQINEALEKRCVQSVRKFISFFN------------------IKDDNRIIFAMKVVVGLSDLCPQLKLCVDTQQGG-----------------------------EGKSWNSLVDFLRCSSLDLFNLWNADLLATMGKNLEAQLRMN--TIADTLKSTPLWDEITIQEEAESGSAVQSQIRVPMNPSFPLQQSLFKVCQEINNIGPHAIPKKAQLFLMEDTASSVLKCYENYITGH-------STALSQAVALQLLLDVRFVGALLLAR-NR------PMQEKARSLCESLEGRVDPFDLDVFNPHIQNHVKRAVQRLQFVYGPLLTSDRHAI-WAARLNP----V-GSK--KPETPSVVGLVSS---TPRFLPLPLVNQR----------------PSIDTSTNKL--AES-S-AKVDTASINQK-K-SRN---K----A--A-------ANAAS-TARSSAAAFFGA-SSTWGSSIFG +>121225.PHUM413450-PA +-------MTTES---LLEI-DSDQLFEKHTISEIKIIQGKIQNEIEKKKEELRIMVGEKCRDLLKAADIIIEMQDTSKN-IINV--INQTNYLCQSLQEKR-LLGFRQ---P----N---KT--TTTF-TKNSEEI--SKIIEIKILLILPEQIWTALDNKDYFLGAQLFLFATHLHL-LEISSN-S----NFFNKYSVINKQWAIINNCKQIIIDGACNELKILNIPLQKATECLCCLILLESTTYEKLLNQFLDLRLASLNDILKSE-------ELSKKKLRQTVETLQHTLMIVYHCFFDKSSQ-------K-CSIEVLLNTILSNQS--PTLFKIIQK----SS-WPEQYLSPMITNYRPNTS-ENLVSLQQEHIKKVLDFWLENVEKILSVELNKILLLVDNIKRLHKIKEEIFDVKY-----PDNWDEITLSL-LGI-SNLNIYNKFIKSYMTNRMKELIQSAWLNGLNYVLDNLKKVDEVMSKD--------KNKQENDIRWFVWKENKGNF-----------------EEGLKLKTMGYTPKVMELCEKMNHFLIQLLEDVELYVNENSK--------------IKHKIKEVDNDSILILNFLNSHSFEMIQKFTHYVKD----------GCKTLGNESIDSKIIIRARFLSSLTNECPGLEKCLKSSISKEDF----------------------NENVSNNLWQKGRGLLNETSTEIWHDWKVLKSSRLKT-LIKSKLTV--SLRSLLKSKLLSEIITIEEQTEDGSSVKSDLRISSQPSLSLQELLFQICRQVNAIAPHTLPKQVHQELIDCMVKDILEHYQEWTKSE---------TIYQTQAWQMLMDVKFLTLMFVTN-NK---------DLSQEICEILEKSIDPFDLDVHYSYLQNNVKKSVLKLQGTFGILVNISEKLP-FNGLRLS----Q-SSSGVKLEEPNLLAMSTT---VPWFPLLPVAKRS----------------NSRSD----G--LQESP-SYSFKE--LSA-D-KPM--AH----KNKK-------ESVTS-DFFKSAGAFFDAMGGGWSREN-- +>7425.NV10250-PA +-S----------TDKFLD-LDIRKLFEEHGIKDIELIQKQIQHESDRKKIELRTLVGERYRDLIQAADSIAQMKQTSESV-VAK--IVNIEKTFHDLQQKYL-IGFKMHT---E----HV-HS--QR--APNQISDS--VVMQIKILMDIPEQIWSAIDSKDFLLATQLFLLAQHINYSLKFEIG----DANLASRYPIVSKQWGIINQFKSLIFNFCNDALQSVHLSKELAANCLAALVLLDGLNSADLLNRLISLRSQTIKSIVISES-D----LSVKNKIKLCLNVLMDTIPLISSCFIKYRDS-------QDGLVSMYINEIKDTNAF-LML----SQL-DLEEELIQKFLPLVAKNHKPFVQH-ELKKLPLANVQESVNAWFNWVKQLATIEVTKLLNLITSVKGIYSIREECLAVE-----IPENWDSTWDAFSL-PS--VNFWTEFFQPLLTARVKGILSDKLDVCLVNLKKDVSELLGKVSFET-------AQYPENDLRWFVWKDSPEDIPQKLMEGGTL-----DSKRPLLLKARAFSPNVVKLCENFENNLSEVLLHLKQYLYELEQTS----MKDDLLAADIYLTSNKFCDRTEIQEYLQSVSGKLIDDFVVFVKECIIE---------KPKSGRQEVNAIVTARFLQAIPSMCSNFKECFTISRP----------TG---------------ITLTNMKWQEVCDKLKQESTLAWSVWAKCFTKVIHYNRNKYLIKETADELRNHTIITDWEKVIIEEEAEEGKRINSEILVPYQPAVHLQKFLAFVCQDLNKVIPHTIPKSILNVLINNVAVELFNYYYG-------LST--SLDIRQKQAIQILFDVKYISLLMVPRDNK------LLVEQSNKVCNSVISKIDPFDFDVFYPFINTNVKKGVQRSLLIFGNLVPHMEQLHSVLGA----RIEHSDGFKSIKDPPGVLALCSG---TPWFPPLAVTAPTKSLPVIQLPVPERPQ---------------------------------R--RKQ-HP------SKEHTRS-TG--STIKSGAAAFFGAMGSDWFSTS-- +>7460.GB18353-PA +-T----------TTNYLD-LDINKLFEEYTIKEIEAIQKKIQHESDRKKIELRTLVGERYRDLILAADTIRKMKITSEHV-ISR--IIDIENKFGELQKKYL-IGFKIDS---I----QN-DD--EK--NVEASQDS--IIIQIKILMDVPQYIWSSIENKDLLFATQLYLIAQHINYSLLFEVG----STDLSIKYPIVSKQWDVISQFKNIILNKCNNVLQSLDVQPGSIANCLAAFVLLNGTSFSDLLDKLISMRNQAIKSIVTDEN-D----NSVKTKIKL-----------------YSEGE-------SGGLILQYLIKIQDQEAY-SLL----SQL-DLNQELLQEFLPLVTKQHKPFTVH-NSENFCILDLQKRIKSWLHWVAEFCNHEITKLLDLIISIRGLYYVREEAVNIN-----LPENWNKIWEELSL-PR--ITFWVEFFQPLISQRVK--------------------------------------------------------------------------------------------------------HLEQYLYETERVM----IKDNLLSTNISLISDSFFDRAEIQEYLQTISTNMIEDFINFAKTCVND---------KPDYGQRDVNAIVMARFLLALITLSSNLNKCFTLSKV----------SG---------------LTITNMKWQTICDKLKEESTFIWSVWAKTYKVKISEHREKFISKESLHGYPIHLVISEWEKVTIEEDSGEGKRIKSEILVPYQPSIHLQKFLTAINKDLNKIIPHTLPKKVLHEVIEDVVTELLNHIIV-------FN---DANLSQKQAFQVLFDIKYSSLLMIPRENK------ILIDLSNKSCETILSKIDPFDYDVFNPFIHTNVKKSVQRSLLILGNLIPHLEQLHSILGA----RSEYNNIEGVKSDLPTVLALYTG---APWFPPLTVTAPAKNLPLVTATLPEKTQ---------------------------------N--HIF--------------------------------LISK--IYY---- +>12957.ACEP_00009457-PA +-T----------TTNYLD-LNINKLFEQHTIKEIEEIQKKIQLESDRKKLELRTLVGERYRDLILAADTIGKMKITSEKV-TSR--IINIEDKFRELQKKYL-IGFKTEP---I----ED--K--LD--KKGYIFDS--VIIQIKILMDIPQYIWTSIENQNLLFATQLYIIAQHINYSLMFEVG----STELSRRYPIVSKQWDVIMQFKNIISNECNKILQSLDVSTINAANCLASLVFLNESSFADLLEKLISTRCMAIESVIKGEG-H----DSVKNKLKSCMKILIQTVHLIYSCFINADNA-------PGGLVLQFVADIKDQEAY-SLL----SQL-DLDQDLLQEFLPSVTKHHKPFVQD-IPKTFSLPALQNSVKSWLEWVNNFSNLEITKLLDLIVSIKGLYNVREEAISIN-----LPENWNSIWEELSL-PR--ISFWIEFFQPIITRRAKCIITNKWTDALADLKSDITELLDKIAHDK-------FEFPEHDLRWFVWKDSPTDIPQKLTKNGGL-----DNKRSLLMKAKGYSPNVIKLCEKFDENLYALLSDLEHYLYETERVI----IKDSLLSANISLIANSFSDRNEVQEHLQVISTEKIEDLVQFIKTCVND---------KPKHGQSDINAIVLARFLFALTTLCSNLNKCFTSSKV----------SG---------------LIITNVKWQAVCDNLKEESTCMWSIWANIYKVKISEHMKKYILKEPIDGLRVHWIVSEWEKITIEEESGEGKRIKSEILIPYQPSIPLQKFLTAICKDLNKIIPHTLPKRVLQQIIESIITELFNYYLN-------ASK--NIDLRQKQAFQVLYDIRYCTLLMVPHENK------ILNELSTKTCDAVLAKIDPFDYDVFNPFIHTNVKKSVQRSLLIFGNLVSHLEQLHSILGA----RNEHTSNE--RTEPPAVLAVCTG---APWFPPLTVTAPTRNLPLLSMPVPDKTQ---------------------------------K--KIT-K---------EHVKE-PT--SAIKSGAAAFFGAMGSDWFGSSN- +>51511.ENSCSAVP00000011400 +------------------------VFERNNVEEIRELEKKTRHEIELKKEELRQMVGERYRDLLEAADKITGMKKYSEI-VTST--IKDIQEYKRTLS--V----------P--KLR---AS--QLSV-KNENRFL--ELAAETKVLMEMPEEIWLQVEAGNMITASFLYLQSLQVLKNLSLEGN--HSYSPILQWIPMLGQQAQAVGNLRSAILKQCNTRIADHALDLQSISEALCSIVLLEDVSIRCVLTKLLEARRYAIREILTATKNH-G--MGTKGKICASLDILVKTTSQVFELFCSHPQSK--G------VVETMLQKCTQ------EP-D--NSD-NCTK-IWSNCVPKNLALQKVKFN-ITDFTIPEEIIQQLNTEWLTGCKSDLTEGIADLLKFTNSAKDLTNVRIAVMDILDQNPT-KTKWQNTCQAV-FKQ--EVIVWNEILEPLFLNKMKLVVSNTFDELLSESKVMLEQ-----Q----------HHGKGTSISTFLWQEHENDIPSTMAWQGWQHRKT-SENPGLTLKSLAITPNVHQLCELLNKTVRKLLDDVNNYMLSVVAKDKTD---YKR--TASETKVETNQECLTVFSYLKQSSGNFFDSLSQLLSSLEQQLKSKVSKTDYSANEPVLSKALFLSQVCRNFFKLCHTFKECYVTNYTTNQPVR-RHL---SESHSAGDVK----TTTDSSAWDDVVHSMSQQSLNLMTLCCNAILYPAIAAYKVSLLDS--ASGNILLSLSQWDCITVEEESESGNTVKSKIRVPASTMSFTQELLFTVCTEIEKIGGYSISRLTLRNLSSRCLQSILEAFSAAAFARNISDDD-TRSPSQVWALQCLFDLRYLHHLLYQP---LPNEDHENSFTYTELVDWLEGYIDPFDLDVFSPHITNNIQLYAARTSTLFGILVVSNK------TSSQK----L--FS--SKDSHNVLPLM--------------------------------------------------------------------------------------------------------------------- +>7719.ENSCINP00000035803 +V-AVIPITYKYL---IITMDSVMTIFERNGVEEIRELEKKTRHEIELKKEELRQMVGERYRDLIEAADKITEMKKCSEI-VTNT--VKDIQEFTSARRKSA----------L--KPR---AS--QLGA-SNESRFL--EIAAETKVLMEMPEEIWLQVEAGNMITASFLYLQSRQVLKNLSLDGN--HSYSPILQWIPMLGQQAQAVANLRLAILKQCHARIRDHSLDLQSLSEALCSIILLEEVSIETALGKLLESRREAINEILTEAEYY-G--MSTKGKICAGLEVLVKTASQVYELFCCEGERK--S--AVEIMLRKCTEEPEGT-----EPSESFGLG-KCFK-IWTSCVPKNLSLQKVKFN-ITSYNIEDKNIQQLNTQWLSACKSILNKGIADLLQFTNSAKDLTSVREAAMEILDCGHV-KTKWQQTCQAV-FNH--EVDVWDELLQSLFLNKLKSIVAVTFQQLLNDSKALLEK-----Q----------GGEKGTSTSKFLWNEHENDISSTMAWSSWQQRKT-SDHAGLTLKSLSITPNVHRLCEGLDTSVKKLLDDVNNYVVSVVGKSGPN---HKRSVSTSENLIENNVECQTVYGYLKLSSGEFFTSLLEFLSKMKEQLKNKANKTDYTANEDVLSKALFLSRVCRNLFKLCHSFHDCYITKPLHNQPLR-RHM---SESHASGDMK----STTDTSQWEAIVEAMSVQSLNFMSICTNAILSPALVSFEESLLNS--ASGNILLSLSLWDSITVEEESETGDTVKSQIKVPASTMSFTQELLFTVCTELEKIGGYSISRSTLRELSNSCLQGVMRAYSSAALARTLPEED-AS-PSQVWALQSLFDLRYLHNILQQSNPEVGEDEEHPCFTYTELVDWLEGYIDPFDLDVFSPHLTHNIQRYSARTSTLFGILVSS-K------TSSQK----L--FS--SKDSHNVLPL---------------------------------------------------------------------------------------------------------------------- +>10228.TriadP54105 +S-SPTVRHKSVD---WSSEADTDRLFRDNSIDQIRNREKSIRGDIERKKEELRQMVGERYRDLIDAADTIAAMQVSSSE-VVKK--LDDMKHYCYEIDALQ-ANYNAT---NG-DVN---GN--VRIG-KDSSTFY--SIATQMKLLVDIPEKIWSTSDKKKFLDAALLYLLARQIVDNLQKSMT-SSPVKNLLASFPILPRQWSTISHYVVSILQDIRERLKIVDLPEQDIGECLCAILLLDDQFPRQAFKDFLIVRNTLLETLLYSDE-H-T--DSIKLQIRDVVSVIRLTICQIYKIFYVAETE--------------------------------------------------DASKLRPRIF-SSMSLISVEDIRESCQEWVTMITRAVVDGVSRLLAYVSSIKSLMAIRDAIWNLLTDEDN-YPDWDSICIEV-LGR--KLSIWDEFLKGLFFERAKTITQSMFDNAFNVAEEMITEGLLDLDGDQ-------SMVCDHDMSTYIWQESSYDMPSANAWASSFETESVEETGGLTLKSRAFTPSVHRLCRKFDSKLRKILEDCKYYVQDAVSIRPTPTSSALPLKDSKVGAFDKYAGSDEMKQFMKTTCEECIKNIADEINTKLDELQS--ETVSNVKRALLIDSVLWLGRIARAILEQCPKAKKLMTIDKDQENTA-------------------------V--------------KTKSLNKWSSTASKRS-------------------------KSISLEVENEQHQLLTKTYHRAHKSI--LQNLVHRLSSGIYGIYEDHLTNEKIESERDLVLEEGVESFQTA--PE---------KITQTCAIQFLYDIQFINNILNCQTDDITT-SKESYKRAQDLVERIEGYIDPFDLDVFTPYIKSNLNRYTQRCMALLGCLTCISGQPP-ITTDRTS----H--AA--GQESHNVMPLSEL---SVRFSLLPYSTNA----------------QRNSSNKND---IKS-R-KLSEPPSTGIA-E-AGP--EA----TANLFKRVELSYGIFD-DDDTNT----------------- +>7739.JGI126010 +-----AAEMKPE---HIATMDTNILFQKYTINEVKDTEKRVR---------------ERYRDLIEAADTIREMKNS-NNV-GQA-V-SSMDKYCQQLQ-KNKKNH-------A--REN--ME-A---A-KEHDAF--YSIAAEIKLLLDMPEKIWSSLEADELLSAARLYLLSRHIITSLHLDSPSPPSTQSLLTFFPILSRQWSYISHFKVAILK------------------------------------------------------H-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HR---DISAGGDSSTDPPPFDKFADNIHLEKYLQNGCTSCIT------------------------------RALFLARLCAGLVEICPNLQLCMMGKQLKDGTQD--SA---RVLHKQGSSK-MMPPLDENSPWGKLRSQLFATADIGHRLWAEHTSGWLVDQFSSALKDS--SPAALLMSATNWEEMEIQEETEAGKSVQSKIRLPAQASWYVQSMLFLLCREVNRVGGHALSRSVIHEVVQQTCAGVLTAYEALL-------QD-SATLPQARALQLVFDLRYITNMLSARGPDSQAY-RAQADRVMRLLEKIENHIDPFDLDVFTPHLSKALDRLTQRCSVMLGVTTSPDRH----LAAGRP----PGSTG--QQEQHNVLPLPPP---IPKFTLLPITTRT----------------DSKPRQTIEV--PVP-K-VQ-VLPSLSSS-GSRDV--ED----SGRLP---R--A-ASP-SSLYSIGAFST----GWLSNIGQ +>7739.JGI126021 +M-ETVSVPLAPS---FFLYMLASFFV--LGDIWLSCLQ---L---------------AAFGKLCHPGENLSRRPCSDTRR-GRR-LLRYMNM-AVKLFDVDIIN-----------YLF--SC-L---A-TEHDAF--YSIAAEIKLLLDMPEKIWSSLEADELLSAARLYLLSRHIMTSLHLDSPSPPSTQSLLTFFPILSRQWSYISHFKVAILKNARNMLKNPDATEKATAEALCSIILLEDTSPRQVFTEYLLAKTSLMFMLFTP--WPAG--GSIKAHVCGVVQLIVSTVRQMHAVFYSPEAGS--IKEQACDQLLTTLGSVSGDRA-AP-VYTLLETE-LRNR-PFAKHIPSRIAEFCPSLK-TLANPVSQEHLQASCQQWITTCVETIHRGVGELLGYVSTIKGLVAIRDAVWDMLAQDGA-GIKWSEVCQHI-LHR--DVLVWEEFLRPILINRSQVIIESQCSSTAELSLQLVTNTLQELAHKT---NTERTLLSEHNVAGYVWTEVSSDMPSRSSWFHSKTGE---ELGGLAMKAKAFTPRVQSLCKKMDSRLESLLEDVSQYTSVTQHHR---DISTGGDSSTDPPPFDKFADNIHLEKYLQNGCTSCIT------------------------------RALFLARLCAGLVEICPNLQLCMMGKQLKDGTQD--SA---RVLHKQGSSK-MMPPLDENSPWGKLRSQLFATADIGHRLWAEHTSGWLVDQFSSALKDS--SPAALLMSATNWEEMEIQEETEAGKSVQSKIRLPAQASWYVQSMLFLLCREVNRVGGHALSRSVIHEVVQQTCAGVLTAYEALL-------QD-SATLPQARALQLVFDLRYITNMLSARGPDSQAY-RAQADRVMRLLEKIENHIDPFDLDVFTPHLSKALDRLTQRCSVMLGVTTSPDRH----LAAGRP----PGSTG--QQEQHNVLPLPPP---IPKFTLLPITSRT----------------DSKPRQTIEV--PVP-K-VQ-VLPSLSSS-GSRDV--EE----SGRLP---R--A-ASP-SSLYSIGAFST----GWLSNIGQ +>9258.ENSOANP00000015194 +---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G--AGIKAQVCALVELLSTTLYQAHALFYTLPEGQPPDPALPCGLLLSTLETATGQRP-AGEHLGRCYQQ-QNDS-S----LPIMNCFLLPVLP-TSVAPLQQE---SSLSR-ILSCRRKAAPGLP------ESGPGLPSTRSSDWPQSPPHPG-GGEWETDARRG-DS---PG------------AKQHTLAAPASEAGPPTPSTPFLPAAESHVTEP----ALPPGTLHHNAGRRLWFQPPRTWPTDASWVELTPRRPA--APGRAGPSRPDSPCVQAFSSTLDFGARR---------PSWRSL------------GPTCSAFDRYAEGGTVEGLLRNQG-GCVRHLFGRVREKLRRAEAEPRVGPGALRGPQLAAVLFLARLCQSLAELCPHLKRCVLGKSGGPDGPA-REP---WAGKKPAKGK-VQEVDPIWAPWQEVKEDLLQQSLAGYRVWSSAVVEGLGRDFTQSLLLD--DPGSILAAATSWDEIEIQEETESGSSVTSRIRLPAQPSWPVQTLLFSLCQEVNRVGGQALPPSTLQELLRGCLAEVLAGFDKLAQSRQSKKDG-GFPMTQNRALQLLYDLRYLNAMLTSKTDELKGSRSKPDPRLEKAVDFLEGLIDPFDLDVFTPHLNSNLGRLVQRTSVLFGLLAGTENQ----FGARTG----P--FN--SQEPHNILPLAAS---QIRFGLLPLSMTS----------------SRKAKSSGRD--TEP-K-TQAAAPALTRA-D-DDS---R----PGSLF---R--QLATE-EEDAATPSLFKL---GWLSGMTK +>9371.ENSETEP00000005953 +M-AATTASSAMK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCADGL-VDAV--RATDRYCARLRQAA---PAAS---RP--PP---SQ-A-P-P-PSQLRF--YSTAAQIKLLLAIPEQMWSATEASQYLPATRLYLLCCHLHRLLRLGSS-NPLGSPVLSRFPILIRQVAAASHFRSTILQESRQLLKCPAVSDQAVAEALCSIALLEESSPRQALADFLLARKAAIQKPLSQQ-QQ-G--ASTKAQVCALVELLATTLSQAHALFYTLPESQRPDPALPCGLLFSTLETITGPHS-AEKGLEVLQQE-GKLG-SWFKHLPASIVEFQPELR-TLAHPISQDHLKDTLQKWIHVCKEDMKRGLTHLLLYVKSVRSLAGIRDAVWALLTSEAT-DHSWNVVCRRL-LDR--PLLLWEDLMQQLFLERLQSLMREGFEGISSSCSELLGSALRGLEPGANSSPPSKHAHSEHNMALFLWAESPSDLPPDAAWVNVANRTQF-ATSGLAMKAHAVTPCVQSFCSALDAKLQAQLDDIMAYXXXXXXXX---XXXXXXX-XXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XX-XXX---XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLVRGFDRALQLG--DAGAVLASATSWEELEIQEETEAGGSVTSRIRLPVQPSWYVQSLLFSLCQEINQVGGHALPKVTLQEMLKSCLAEVVAAYGKLSEDRQNQXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTENVVDHLEGLVDPFDLDVFTPHLNSNLSRLVQRTAVLFGLLAGTENQ----GTPRSS----T--FN--SQEPHNILPLATS---QIRFGLLPLSMTS----------------TRKAKFSSRN--TPK-A--PAALPAVPRA-D-DPT-------LPGTFF---R--QLVSE-EEDTSSSSLFKL---GWLSNMTK +>8049.ENSGMOP00000003903 +--MTVSTAESLR---VSEIKDPWVLFERYNTEEIRRIERKVRGEIEQKKEELRQMVGERYRDLIDAADTIGEMRQCSQSV-VLS-I-QDMNHYCQKLKQGK-PN-----RET--IAK---QY-L-TQL-KCQGKF--YNMAAQIRLLLEIPECIWSAMESLQYLKATQLYLLCCHLHGMLKLETATGPHCSPILARFPILVRQVATTGHFRSAILLHSRSLLRGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKSSIYQLLNQP-QQ-G--AGIKAQVCSLVELLVTTLFQAYAVFYMPPEGGPGEGALTCGILFSTLEHVTSTVP-AGKDKRILQEE-MSTG-SVFRYLPSSVSEFQPVLR-TLARPIQREQLRDTLQQWITTCKEDICSGISSLLVYVTSLKALAAIRDAIWDLLSTDSI-SLHWGSVCQCL-LER--PLDVWEDFLQHLFLQRLQAITKDEMDTISDSSTQLLTSALRDLETPP----KGHGGRFESDVASFLWSEAPGDLLSDSAWVSVAQRDPQ-HHSGLAMKTLALTPCVQSFCTALDAKLRTRLDDLQHYLPVQEPPT--PSG-TRPAKGLAASAFDRFKDAADVEQSLRDSCLACVQQILSHIRSELSS-----------GSPAHLGTVLFVARLCQSMGDLCTNLRRCVLGREGSSE-AARETP---RPGRKLGKAKAPAQVGPAQARWVGLRRDLGACSMDAYRIWSSALSQALVDHFATALNAD--TPGAILKTATSWEELEIQEEAES-GSVTSKIRLPVQPSWFVQALLFQLCLEVNRVGGHALPRPTLHELLKSCLDQVLHHYHSITQQTQVTQDH-GFPMTQTRALQLLFDLRYLCSTLSPRPEGGQGGGSSQDPRIQQVCDWLEGFIDPFDLDVFTAPLSAHLNRLSQRTSXXXXXXXXXXXX----XXXRNS----A--AS--SQEQYNILPLASS---QIXXXXXXXXXXX----------------XXXXXXXXXX--XXX----XXXXATPTNS-AIDHS--FR----PGNLF---R--QLAHH-EEEPAAPSLFKL---SWLSGMAK +>7955.ENSDARP00000103018 +--MATVPAQSLR---VSEIKDPTVLFERYGTDEIRAVERKVRGEIEQKKEELRQMVGERYRDLIDAADTIGEMRQCSESV-VHS-I-QDMYRYCHKLKQAK-QT-----PQS--SSR---AE-Q-GQK-QSQEKF--YTMASQIKLLLEIPERVWSAMESSQYLQATQLYLLCCHLHSQLQLEGG-GHQYSPVLSRFPILVRQVAAAGHFRSTILLESKSVLRGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKASIQQLLNQP-QH-G--AGVKAQVCSLVELLVTTLYQAYAVFYVPPEGQVSDTGLGCGLLFTTLENVTSNTS-SGKEKKVLDKE-MSTG-SWFKHLPPSVMNFQPVLR-TLAQPIQREQLRDTLQQWIDTCKEDIRSGVSSLLVYVKSLKGLAAIRDAVWELLSSESI-SQHWSTVCQSL-LEQ--PLALWDDLLQQLFLRRLQVITQEGTEGISSSSRQLLSSALRDLQGQASAGSFSRGAQYESDVGAFLWSESQSDLLSDTAWVSVAQRSPQ-QKSGLSMKTQALTPCVQTFCSSLDSKLKAKLEDLQHYLPSDTNGKETL----EKYTVSSSTPINRFMDAEAVEDILRDHCLACVRDVLASVRSELANAQ------AETSSHSQLSSVLFMARLCQSMGELCPSLKQCILGKQGGVDVVSRGTP---RQSKKLGKSGTAADVSPAQAKWSCLKEELLSCSMDAYGIWSSALTRALVGSFAATLHAE--NAGSILGTATNWEELEIQEEAESGNSVMSKIRLPVQPSWYVQSLLFHLCLEVNRVGGHALPKVTLLDILKGCLDQAVSEYERLTQDSQ-SKDT-GLPMTQNRALQLLFDLRYLTVTLGSRLEEGRSSRSQQDPRVQQVCDSLESHIDPFDLDVFTPHLNSNLNRLSQRTSVLLGLLTGTEKQ----FTSRSN----S--IN--SQEPYNILPLASS---QIRFGLLPQSMTN----------------SRKTNSATHG--ADI-T-RPLFFME---------------------------------------------------------- +>8090.ENSORLP00000021771 +--MAQDPAPVLR---LSEMKDPLVLFERYNTEEIRRIERRVRGDIEQKKEELRQMVGERYRDLIDAADTIGEMRQCSERV-VRS-V-QDMQRFCQLLKQSR-PG-----AGA--AA----AE-Q-NQR-QVQDGF--YCMAAQVALLLDIPERIWSAMEAAQYLQATRLYLLCCHLHGLLRLDSASAGHFSPVLARFPILVRQVSTTGHFRSTILMDSKSLLRGRAVSDQAIAEALVSTMLLEDSSPRRALADFLLARKSSIHQLLNQP-QH-G--AGIKAQVCSLVELFVTTLFQAYAVFYLPPEGAPGEGALGCGMLFTILERVTSCSS-AAKGSKVLQEE-GSTG-TWFRFLPPSVTEFQPTLR-TLAQPIQREQLQDTLQQWIDTVKEDICRGVSSLLVYVKSLKGLAAIRDAVWDLLSTDSI-SQHWSAVCQRL-LER--PLAVWEDFLQQLFLQRLQAITKEETEAIAASSVQLLSSALQDLQSQTPSPSAERQAQFEVDVASFLWSESAGDLLSDGGWVTVAQRGPQHQRSGLAMKTQALTPCVQNFCSSLEAKLKTRLDDLQCYLPPQDSVI---MS-TLPPGVPESSSFSRLTDTPAVEAALRDGCAACVQRLLASIRSELAAV-------SPDSAGARLSSVLFMARLCQSVCELCPNLKLCILGKHGESELSARGIP---RQAKKLGKLKTAVEVSPAQAEWAGLKEELLGCSMEAYRIWSSALAQVLMKEFARVLHAE--SAGSVLATATNWEDVEIQEESESGTSVTSKIRLPVQPSWFLQSLLFQLCVEVNKVGGHALLQPTLQELLQACLGRALEQYNELTERQRHGEQD-VFPMTQNRALQMLFDLRFLHSTLSSRLEEGRSSRPPQDRRLIQICDWLESFIDPFDLDVFTPSLNANLTRLTQRTSVLLGLLMGPEKQ----FSARSS----P--VN--SSEPYNILPLASS---QLRFGLLPLSMSN----------------ERKPKAASAA--PQK-A-SPQA-RQSSSA-TMDDA--FR----PGNLF---R--QLAEK-DEDSSSSSLFRL---GWLSGMAK +>8083.ENSXMAP00000007211 +M-MAGDPVLALR---VSEIKDPAALFERYSTEEIRRVERKVRGEIEQKKEELRQMVGERYRDLIDAADTIGEMRECSESV-VES-I-QDMQRYCRTLKQGS-YV-----LLQ--NH-----N-Q-NQR-QWQEKF--YTMASQIKLLLEIPERIWSSMEAAQYLQATQLYLLCCHLHSLLQLEAAPGGLYSPVLARFPILVRQVATTGHFRSTILLDSRSLLRGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKASIHQLLNQP-QH-G--AGIKAQVCSLVELLITTLFQAYAVFYMPAEGAPAEGALSCGMLFSTLENVTSCTP-TGKGRKVLQQV-WSTG-SWFRYLPPSIMEFQPTLR-TLAKPIQAEQLRDTLQQWINTCKQDICQGVGTLLVYVKSLKALAAIRDAVWDLLITDSI-SQHWGNVCQQM-LGR--PLAVWEDFLQQLFLHRLQTITKEETEAIATSSVQLLTSAVRDLEGRPSNPLSGRSAQYEADVASFLWSESPGDLLSDAAWVSVAQRGQQQQRSGLAMKTQALTPCVQNFCSSLDAKLRARLDDLQHYLPSQDTGSDSIA--PPSCGPPDSSSFNRYTDSAAVEEALREACVACVRHILSSVRTELGS------------APTCLSSVLFMARLCQSVGELCPSLKHCLLGRGAPGKPRPREPP---RQGKKLGKSKAAPEVSPAQAKWAELKEELLGCSMDAYRIWSSALSKELMETFGAALLAE--SAGAVLSSATGWEDLEIQEESESGNSVTSKIRLPVQASWFVQSLLFQLCVEVNRVGGHALPRPTLQELLQSCLGQVLHRYDVLAEQRRDANEG-VLPITQNRALQLLFDLRYLNSTLGSRVEEGKTSRSQQDPRFHKICDWLESFIDPFDLDVFTPPLNANLNRLSQRTSVLLGLLTGSEKQ----FTPRSS----T--VN--SQEPYNILPLASS---QIRFGLLPLSMSN----------------ARKPTSSSRG--SDK-S-QNLA-PQSSAA-GSDDV--FR----PGSLF---R--QLADQ-DEDSTAPSLFKL---SWLSGMAK +>8128.ENSONIP00000009923 +T-MAQDSALSLR---VSEISDPAVLFQCYNTEEIRGIERKVRGEIEQKREELRQMVGERYRDLIDAADTIGEMKQCSESV-VQS-I-QDMQQYCHRLKQGK-AS-----VAS--CR----VE-Q-SQT-QWQVKF--YTMASQIKLLLEIPERIWSAMEASQYLQATQLYLMCCHLHHLLQLEATTAGLYSSVLVRFPILIRQVATTEHFRAAILLDSRSLLRGRAVSDQAIAEALVSIMLLEDSSPRQALADFLLARKSSIHQLLNQP-QH-G--AGIKSQVCSLVELLVTTLFQAYAIFYLPPEGSPGDEALSCGMLFSVLDNVTSTSP-AAKERRVLQED-VSTG-SWLKYLPASISEFQPVLR-TLAQPIQREHLQDTLQQWIDTCKEDICHGVGSLLVYVKSLKGLAAIRDAVWDLLSADSI-SQHWNTVCQRL-LEH--PLTLWEDILQQLFLQRLQVITKEETEAISVLSIQLLTSAVRDLQSQSSGTHSSHGAQYEVDVSSFLWLESPGDLLNDAGWFSVSQRGQQQHRSGLAMKTQALTPCVQNFCSSIDAKLKARLDDLQHYLPSQDVAT---PS-SGSADKPSSSSFNRFIDSSAVEEALRDGCLACVHHILSFIRSQLAAV-------SPDSRPICLSSVLFMARLCQSMGKLCPNLKHCILGKQCGFDSTAKGTP---RQGKKLGKATATAEVRPSQDKWEALKDELLGCSMEAYRIWSAALSKGLLEKFGTVLHAE--SAGTILATATNWEDLEIQEEAESGSSVTSKIRLPVQPTWFVQSLLFQLCVEINRVGGHALPRSTLQELLQTCLTEVLHHYHSLTQQTSSTKDA-VFPMTQNRALQFLFDLRYLSATLGSRLEELKNSRPQQDPRFHETCDWLESFIDPFDLDVFTPHLNASLNRLSQRTLVLLGLLTGSEKQ----FALRSS----S--LN--SQDPYNILPLASS---QIRFGLLPLSVSN----------------VQKSKAASRS--SEA-P-QQLVAPQSFTA-GSDDS--FR----PGSLF---R--QLADQ-DEDTAATSLFKL---NWLSGMGK +>69293.ENSGACP00000005927 +--MAEDPALSLR---VSEIKDPEVLFERYNTAEIRRVERKVRGEIEQKKEELRQMVGERYRDLIDAADTIGEMRQCSESV-VQS-I-QDMHRYCHQLKQGR-AG-----TTS--CR-----Q-E-DPT-QWQEKF--YTMASQIKLLLEIPERIWSAMEASQYLQATQLYLLCCHLHSLLQLGAATGGNYSPVLVRFPILVRQVATTGHFRSTILLESRSLLQGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKASIHQLLNQP-QH-G--AGIKAQVCSLVELLVTTLFQAYAVFYLPPEGGPGEGALSCGMLFSTLENVTSTTY-AAKDRTVLQEE-TSTG-CWFKYLPHSITEFQPALR-TLAKPIQREQLRDTLQQWIDTCKEDICRGVSGLLVYVKSLKGLAAIRDSVWDLLSTESI-SQHWSAVCQRL-LER--PLAVWDDFLQQLFLQRLQAITKEETEAISTSSIQLLTSTVRDLEA--TNPGSARGAQYEVDVASFLWSESPGDLLSDAGWVSVNQRGQKHQRSSLAMKTQAVTPFVQNFCSSLDAKLKARLDDLRYYLPFQDPGSSSVPP-SGPSESASASSFNRFTDSPAVEDALREGCLACVRLILSSIRSELLSA-------PPDLSPARLSSVLFMARLCQSMGELCPNLKHCILGKQSGSEATAKGTP---RQGKKLGKARATTEASPSQTKWAALKEDFLVCSMEAYRIWSSALSKVLLDKFATALHAE--SAGAILTTATNWEDLEIQEEAESGSNVTSKIRLPVQPSWFVQSLLFQLCVQVNRVGGHALPRPTLQELLHTCLNQVLHHYQTLTQQAPVTQEG-VFPMTQNRALQLLFDLRYLHTILGSRVEEGKGSRSHQDPRFHEVCDWLEGYIDPFDLDVFTPPLNTNLNRLSQRTSVLLGLLTGSEKQ----FAPRSS----S--GN--SQEPYNILPLASS---QTRFGLLPLSTSS----------------VRKSKSAPRS--CDA-A-LQLATPS-SLA-DGEDS--FR----PGSLF---R--QLADQ-DGDTATQSLFKL---SWLSGMAK +>99883.ENSTNIP00000008530 +E-MADDNTLPLR---VSEIKDSAVLFERYNTEQIRKIERKVRGEIEQKKEELRQMVGERYRDLIDAADTIREMRQCSESV-VRS-V-QDMQRYCHTLKQGK-SG-----VPS--SR-----L-E-NQQ-QLQKNF--YTMASQIKLLLDIPERIWSAMEASQYLEATQLYLLCCHLHSLLQLEATPGGHYSPVLVRFPILVRQVATTGHFRSTILLDSKSLLRGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKATIHQLLNQP-QH-G--AGIKAQVCSVVELLVTTLFQVYAVFYVPREGSPGEGGLSYGMLFSILENVTSPTP-AVKSRRLLQEE-TSTG-GWFKYLPPSIIEFQPTLR-TLAQPIQTEQLRDTLQQWIHTCKEDICHGVGSLLVYVKSLKGLAAIRDAVWDLLSTDSI-SHHWNTVCQRL-LER--PLAVWEDLLQQLFLQRLQAITKEETEAISSSSVQLLTSAIRDLES--TNSGPSRVAQYETDVASYLWSESPGDLSSDAGWVSVSQRGQQHQRSSLAMKTQALTPCIQNFCSAMDAKLNIRLEDLQHYLPSCDTA----TS-SCPAERFSASSFNRFTDSPAVEEALREGCLACIHHILLSIRSELASA-------SPNPSPSQLSSVLFMARLCQSMSELCPNLKHCILGKRRGLEAALKSVP---RQSKKLGKSCAATEVSPAEAKWIGLKEDLLTCSLEAYRIWSSTVSKVLLDKFSTALHAE--SAGAFLMTATGWEDLEIQEEAESGNSVTSKIRLPVQPSWFVQSLLFQLCVEVNKVGAHALPRPTLQELLQACLNQALHQYHSFLQQPI-NKDG-AFPMTQNRALQLLFDLRFLHTTLSSKLEESKSTRSQQDPRFHEVCERLESFIDPFDLDVFTPPLNANLNRLSQRTSVLLGLLTGSEKQ----FSSRSS----SSGVN--SQEPYNILPLASS---QIRFGLLPLSMSN----------------VRKPKSSSRV--SS----HLPTPPS-AKA-EIADS--LQ----PGSLF---R--QLVDQ-DEESASPSLFKL---SWLSGMTK +>31033.ENSTRUP00000029741 +--MADGNAFPLR---LSEIKDPAVLFERYNTEQIRRIERKVRGEIEQKKEELRQMVGERYRDLIDAADTIREMRQCSESV-VES-V-QDMQQYCQTLKQGR-RLPSSNSSSS--SS-----L-E-NQQ-QLQEKF--YTMASQIKLLLDIPERIWSAMEASRYLEATQLYLLCCHLHNLLQLETTTSGHYSPVLLRFPILVRQVATTGHFRSTILLDSKSLLRGRAVSDQAIAEALVSTMLLEDSSPRQALADFLLARKASIHQLLNQP-QH-G--AGIKAQVCSVVELLVTTLFQAYAVFYSAREGGSGEGGLSYGLLFSTLENVTFTTP-AVKGRRLLQEE-TSTG-GWFKYVPPSITEFQPTLR-TLAQPIQSEQLRDTLQQWIHTCKEDICHGVGSLLVYVKSLKGLAAIRDAVWDLLSTDSI-SQHWNTVCQRL-LER--PLAVWDDFLQQLFLQRLQAITKEETEAISMSSVQLLKSAIRDLESQTTNSGPSCVAQYETDVGSYLWSESPGDLSSDAGWVSVSQRAQQRQRSNLAMKTQALTPCIQNFCSAMDAKLHIRLEDLQYYLPSQDTDSISTTS-SGPAECSLGTSFNRFTDSPAVEEALREGCLTCIHHILSSIRSELVNA-------SPNPSSEQLNSVLFMARLCQFMSELCPNLKHCILGKQRGSEAMLQGTP---RQSKKLGKSRAVTEVSPAEAKWIGLKENLLSCSLEAYRIWSSTISNILLDKFGTALHTE--SAGAFLTTATSWEDLEIQEEAESGNNVTSKIHLPVQPSWFVQSLLFQLCVEVNKVGAHALPRPTLQELLQACLNQALQKYQSLIQQPR-DKDA-VFPMTQNRALQLLFDLRFLYNTLGSRLEEGKSTRSQQDPRFHEVCEWLESFIDPFDLDVFTPPLNANLNRLSQRTSVLLGLLTGSEKQ----FSSRSS----S--IH--SQENYNILPLASS---QIRFGLLPLSMSN----------------LHKSKSSSRA--SS----HQLTPPS-TKA-DNPDR--FQ----PGSLF---R--QLADQ-DEDSASPSLFKL---SWLSGMSK +>9813.ENSPCAP00000009886 +-----------------------------------------------------------------------------------------------------------------------------PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASRYLHATQLYLLCCHLHRLLQLDSS-GSSHSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKAAIQKLLNQP-LQ-X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXKGIGVLQEE-MKLC-GWFRHLPASIIEFQPALR-TLARPISREYLKDTLQKWIHMCNEDIKSGLTNLLMSVKNIKSLXXXXXXXXXXXXXXXX-XXXXXXXXXXX-XXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXX-XXXXXXXXXXXXXXXXXXXLQAHSVACIQHTVACVSTELQGVEEVAHRQ---------HAILFMARLCQSLGELCPHLKQCILGKSGSSEKPA-REP---RALKKQGKGR-AQETVPLQTKWQEVTALLLQESVTAYQAWSLAVVKVLVHGFTHSLLLD--DAGSILATATSWDELEIQEETETGSSVTSKIQLPVQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMGEIVAAYEKLTEEKQTKXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXSEEVKSGRAKQDPRTEKVIDYLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENQ----FAPRSS----T--FN--SQEPHNILPLATS---QIRFGLLPLSMTS----------------TRKARFTSRS--AET-K-AQVGPPALSRA-D-DVT-------HPGSLF---R--QLVSE-EEDTFAPSLFKL---GWLSSMTK +>8364.ENSXETP00000053091 +A-V-IAMAATMK---LSEIKDPSALFEAHSAEEIRVLERRVRAEIEQKKEELRQMVGERYRDLIEAADTIGEMRRSSGLV-VGA-V-RDMEKYCGSLKYRG---SCRI---L--RAR---LQ-Q-P-R-PTKEKF--YCTAAQIKLLLEVPEKIWSAMEASQYLHATQLYLLCCHLHSLLHLDSS-PSRYSPVLARFPILVRQVAAAGTFRTTILQESKSLLKCPSASDQAVAGALCSIILLEGSTPRQALTDYLLARKAGIQQLLNQP-HH-G--LGIKAQVCSLVELLANTLYQAHALFYTQSEEMKPEPSLTCGLLFTMLDTVTGQQG-GGKGINVLKEE-MKSV-SWFKHLPPSVVNFQPERR-TLAHPISQEYLCETLQQWISMCNEDIKVGISALLVYVKSLKGLAGIRDAVWELLTSESM-SQNWDKVCHRL-LDR--PFRFWEDILQQLFLERLQALTKEGFESISRNLVQLLMSSLQELEGNP---ETLKHLQHESNICSFLWSEGPSDLPPDAAWVNVGSRGLQ-CRSGLSLKAQAVTPCIQSLCATLDSQLKVKLEDLCSYLPGESPVT---EKEFVTT-AAKISAFDRYGDASTVQEMLSHHCLSCMQQIQDSVNTTLQSVKEGLVDHGVALFSPKLTAVLFLARLCQSLCELCPHLKQCILGKSVSTEQSF-REP---RSTKKTGKGK-KVDSHAVSCKWQDLKDKLKKQSLEAYSIWSSFVVKHLVTSFTHTLLIN--TAGSALATATHWDEIEIQEETEAGSSVTSKIRLPGQCSWYVQMLLFSLCQAVNNVGGHALPRVTLQELLRHCLEEVVGAYESLC-HKLDKKQA-S-SLTQARALQLLFDLRYMNLILSSRSEDLKSSKSKQESRIQKVADQLETCIDPFDLDVFTPHLNANLNRYAQRTSVLFGLLTGAENQ----FITRSS----T--VG--LQETHNVLPLASS---QIRFGLLPLSMSS----------------SRKTKGRAEE---DT-K---IQVGGLSLK-S-DPQ--NL----PGSLF---R--QLATQ-DEEAPSQSLFKL---GWLSSMTK +>9315.ENSMEUP00000005072 +-----------------------------------------------------------------------------------------------------------------------------PPK-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATHLYLLCCHLHSLLQLDST-SGRYSPVLARFPILVRQVAAASHFRSTILHETKMILRCQTVSDQAVAEALSSVMLLEDSSPRQALADFLLARKAAIQQLLNQP-HH-G--AGIKAQICSLVELLVTTLYQAHAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXKGIISVLQE-MKLC-SWFKYLPVSIVEFQPTLR-TLAHPINEEYLKDTLQKWINMCHEDIKTGITSLLVYVKSLKGLAGIRDAVWELLTSDSM-SHSWEVVCRRL-LDK--RISFWEDLLQQLFLDRLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXX-XSSG-SMK-QALSPYVQSFCLALDSKLKVKLDDLSSYLPSDA------PKEALGI-QTKNSAFDRYSDAGTVEEMLRNHCAACTEQIVACVRTELQGAEAVLQGPAHTLSRSKLSSVLFMARLCQSLGELCPHLKRCILGKSGISEKPT-KEP---RSTKKQMKAK-AQEVNPVLAKWQEVKEQLLDQSLLGYRLWSTAITNVLVHEFTQSLLLD--NAGSILAMATNWDELEIQEETETGSSVTSKIRLPVQPSWYVQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLNSNLNRLVQRTSVLFGLLTGTDNQ----FSARSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSTTS----------------MRKAKSTSRS--TEP-K-DQVVLPALSRA-D-DDM---M---RPGSLF---R--QLVTE-EEDTSTPSLFKL---SWLSSMTK +>7897.ENSLACP00000021045 +---AAVPAQNLR---VAEIRDPAALFERYSAEEIRGVERRVRAEIEQKKEELRQMVGERYRDLIEAADTISEMRQCSERV-VEA-V-QEMYQYCSKLKRGQ---GAPA---G--RGR----A-Q-PPL-HCKEKF--YCTAAQTKLLLEIPERIWSSMETSQYLHATQLYLLCCHLHTLLQLDST-GSHYSPILARFPILIRQLAAAGHFRSTILQECKSLLKGRAVSDQSIAEALCSIMLLEGSSPRQALTDFLLARKAAIQQLLNQH-HH-S--AGIKAQVCSLVELLATTLYQAHALFYTSPEGKVQDTQLTSGLLFTTLETVTGQAA-VGKGMAFLKEE-MKSD-IWFKYMPSSVVDFQPALR-SLAHPINQDYLRDTLQQWIHMCKEDIKCGISNLLVYVKSLKGLAGIRDAVWELLTSNSI-RQNWDTVCNRL-LDK--PLSFWDDFLQQLFLDRLTSVTKEGLEAISNSSKQLLVLALQEFETKS--SPVGRPVQFEYDVTLFLWSESASDLLSDAAWVSVASRSHF-TKSGLSMKAQALTPCIQNFCSALDSKLRVRLDDLLSYLPPETPAAKDGPSDSPGP-QPKTSAFDRYADANSVEEMLRSQCLSCIRCVLDCVREELGAAE-RLKGCKYSQDNCSLNAVLFMARLCRPLGELCPHLKQCILGKSGSSSDPVVREP---RSVKKLGKGK-SQEVNPAQAKWQELKEQLLQQSTEAYLIWSSTVSKALIHSFNQSLHSN--TAGSVLATATNWDEIEIQEETESGSSVTSKIRLPVQPSWYVQLLLFHLCQEVNRVGGHALPKVTVQELLKSCMDEVIAGYEKLSDQEQNKGEG-KFPMTQNRALQLLFDLRYLSSVLTARNEDGKSSRNQQDSRIQQAADFLESYIDPFDLDVFMPHLNSNLNRQSQRTSVLFGLLAGTEKQ----YTSRST----S--FS--SQEAHNILPLASS---QIRFGLLPLSATS----------------SRKSKTAARN--AEV-S-KHVNPSTTLVV-E-EEN--FR----PGSMF---R--QLASQ-DDETTTSSLFKL---GWLSSMTK +>9986.ENSOCUP00000010215 +----------------------------------------------------------------------------------------------------------------V--PAR--PS-L-QP--QLSPKF--YSMAAQIKLLLEIPEKMWSAMEASRYLHATQLYLLCRHLHSLLQLEAA-ASRSSPVLARFPILVRQVAAASHFRTTL--PSSVIRVCSATSTFLVMHTFHRDLSQSSATPRQEAASL-PVREALLGGLLGPA-RR-R--TAWRAAVRRPVR-----ARPAPAVSAPLPSGACPLAPRPSGAPAPSHPCPLSAPA-LGKGAGVLQGE-MKLC-SWFRHLPASVVEFQPALR-TLAHPISQEYLRDSLQKWVHMCKEDIKNGITSLLMYVKSMKALAAIRDAVWDLLTHEAA-SHSWDVICRRL-LEQ--PLSFWEDMMQQLFLDRLQTLTREGFDSIASSCEELLASALQELEGSGGSSACSKHVHYEQNMCLFLWSESAGDLPPDAAWVTVANRAPA-AGSGLSMKARAVSPCVQGFCSALDAKLKVKLDDLLAYLPSEESPP---P-------QAKNSAFDRYADAGTVRDLLRAQSAVCIGRITGRIQAELRSIEEAVQGQQAVRSGVQLHAVLFMARLCQSLGELCPHLKQCIVGKPGSPEKPA-REP---RALKKAAKGK-GQDAAPTQAEWQEVREMLLQQSVQGYRVWSAALVKVLTQRFAQSLLLD--DAGSVLATATSWDELEIQEETESGGSITSTIRLPTQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLRSCMAHVVAAYEQLAGEQQRKKEG-AFPVTQNRALQLLYDLRYLSLVLTAKGEEGKSGRSKPDSRIEKVTDYLEGLIDPFDLDVFTPHLNSNLTRLVQRTSVLFGLVTGTENQ----FTSRSN----A--VN--SQEAHNILPLASS---QIRFGLLPLSMTS----------------NRKAKLT-RS--VQT-K-AQADPPALSRA-E-DPM--TH----AGSLF---R--QLVSE-EDDTSAPSLFKL---GWLSSMTK +>28377.ENSACAP00000014302 +A-ALAAALACLK---RGGPGAAEALFEAHTAAELRAVERRLRAGIEGKREELRQMVGERYRDLIEAADTIAEMRLSAQRL-LEA-V-RGLQRQQQQQRQGS---AKGR---R--DPK---PM-P-PPA-KSQEKF--YCLAAQIQLLLQIPEKIWSAMESCQYLYATQLYLLCCHLHGLLQLDSS-GTHYSPILARFPILARQVAAASHFRSTILQESKSLLKSQTVLDQGVAEALCAAMLLEDSSPRQALADFLLARKSAIQQLLNQP-HHANTDAGIKAQVCSLVDLLATTLFQAHALFYTLPEGTPADPSLPCGLLFSTLETITSQHP-TGKGITVLNEE-SKLS-SSFKYLPPSVTEFQPALR-TLAHPISQDYLKGTLQKWINVCNEDIVSGITSLLVYVKSLKGLAGIRDAVWELLTSESM-SQNWETVCCRL-LDK--PLSLWEDLLRQLFLNRLQTLTEEGFDDISSSSRELLVQAIQELEAKFDASAPNKSILFEHNMASFLWSENPNDLPLDAAWISVGNRSQF-AKSGLSMKAQAHSPGVQSFCSALDSKLKAKLDDLLSYLPMDSPST----KDIQQV-QSRNSAFDRFADAGTVEELLRSHCIRCVDHVLDCVQGELRHAQ-VLQGCKDALHNPQINTVLFMARLCRSLGELCPHLKQCILGKSGCPDNVT-REL---WPLKKVGKGK-TQEVNPIKSKWQELKERLLQNSLAAYQIWSATVAKILVQCFAQSLLKD--GPGSILATATNWEEIEIEEETETGSSVKSKIRLPVQPSWCVQSLLFSLCQEVNRVGGHTLPKVTLQELLKTCMTEVLAGYEKLSEVKQEKKDA-AISKSKSLCARLSFFFHYLLQKGTLMGTDVKRHLYCIEFRIEKHTDFLESYIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLLMGSENQ----YSSRSS----T--LT--SQELHNILPLTST---QIRFGLLPLSMSS----------------SRTTKSALRN--SEH-K-AQTPTTALMRG-E-ETF---R----PGSLF---K--QLAAE-EDDTATPSLFKL---GWLSSMTK +>59729.ENSTGUP00000002997 +-----------------------ALFEAHTAAELRAVERRLRAGIEQKREELRQMVGERYRDLIEAADTIAEMRRSAERL-LGA-V-RG-------LQRGG---AARP---GPGTPC---VP-S-PGWPAAQQGF--YGAAAQLKLLLEVPEQVWGAVEGGRYLPAARLHLLGAHLRRQLQLDTP-RARASPILARFPILLRQWHTGSCGRSTILQESKALLRCPTGSDQAVAEALCAIMLLEDSSPRQALADFLLARKLAIQQLLNQP-HH-G--AGIKAQVCSLMELLSTTLYQAHALFYTVPEGMAPEPALPCGLLFSTLESSTGQNP-AGRG-GVLEED-LKLS-SWFKYLPESVVEFQPALR-TLAHPISQEYLRETLQQWINMCSDDIRTGVRSLLVYVKSMKGLAGIRDAVWELLSSEAS-SHNWEAVCRRL-LDR--PVSFWEELLQELFLDRLQTLTKEGFDSISSSSKQLLAGALQELEVKAGSGALSKQIQQEHNVALFLWSESPGDLPGDAAWVSVGQRGPF-ARSGLAMKAQALTPCVQSFCSTLDSQLKARLEDVLSYLPGDDSVP---KE---PA-VPPRSAFDRFADAGTVQGLLRERCVACVQHLLGCVQEQLQSAQSQL----DPPGDARLNAVLFMARLCQALPELCPHLQRCVLGQAGGAESAP-REP---RSAKKLGKGK-AQEVSPELAKWQGVKAELLQQSLVAYQLWSSAVTKGLVQCFTHTLLLD--TAGSVLATATSWDEIEIQEESESGSSVTSKIRLPVQPSWHVQCLLFSLCQEVNRVGGHTLPKVTLQELLRSCMAEVLAAYGKLVEQKQEKRPD-SFPLTQSRALQLLYDLRYVSIILDSKSEDTKPGRIKQDCRIEKVIDFLEGHIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLLTGTENQ----YTSRGG----T--LS--SQELHNILPLSSS---QIRFGLLPLSMSS----------------SRKSKSTARS--TE--R-VQVAP-ALLRG-E-EEA--AR----PGSLF---R--QLIAD-DEDTAAPSLFKL---GWLSGMTK +>10020.ENSDORP00000002346 +M-AATAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRRAEGL-VDAV--RASDQHCARLRLRQ-AGPAAP---RP--PQ---AP-P-PKL-PSQEQF--YSMAAQIKLLLEIPEKIWSAMEASQYLHATGLYLLCCHLHCLLQLDSS--SRHSPILSRFPILVRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIILLEESSPRQALTDFLLARKATIQKLLKQP-RH-G--AGIKAQICSLVELLATTLNQAHALFYTISEGQLPDPSLPCGLLFSTLETITGQHP-PGKGFSVLKED-VQLC-SWSRHLPASIAEFQPTLR-TLAHPISQEYLRDTLQKWIHMCNEDIKTGITNLLSYVKTMKGLAGIRDAMWELLSSELA-GPGWEAVSRRL-LEK--PLLFWEDMMQPLFLDRLQTLTKEGFESISSSSKELLVSALQELESSAGSS-SSKHIHLEQNMSLFLWSESPNDLPADAAWVSVANRGHF-ASTGLSMKAHAISPCVQNFCSALDSRLKMKLDDLLAYLPSDDAPP---PQDAAPGQQSKKPAFDRYSDAATVQGLLQTHSVACIQHIMDCVQAELRSLRDTVQGQQDVLRGTKLHAVLFMARLCQSLGELCPHLKQCIVGKPGSAEKPA-KEM---RAPKKQGKGP-AQEMPPGQAKWQEVKEALLQQSVAGYQVWSSAVVKVLVHGFTQSLLLD--DAGSVLATATNWEELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQEINRVGGQALPKVTLQEMLKSCLAQVIAAYEKLSEEKHTTKEA-AFPVTQNRALQLLYDLRYLSIVLTTKAEEAKSGRNKPDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXX----X--XX--XXXXXXXXXXXXX---XXXXXXXXXXXXX----------------XXXXX-XXXX--XDT-Q-AQVEPLPLSRA-G-DPA-------HPGSLF---R--QLLSD-EDDSSASSLFKL---GWLSSMTK +>9103.ENSMGAP00000006649 +------------------------------------------------------------------------------------------------------------------------P----PAPPRSRKRC--FXXXXXXXXXAGHPRAGVE-RHGGRALPARRPPLPAVSPPARPVAPRRAPRPLQPRPRPLPILLRQVAAASHFRSTILQESKSLLKCQTVSDQAVAEALCAIMLLEDSSPRQALADFLLARKLAIQQLLNQP-HH-G--AGIKAQVCSLMELLTTTLYQAHALFYVMPEGVPPDPALPCGLLFSTLENTTGQQP-AGKG-GVLEDE-VKLN-SWFRYLPESVVEFQPTLR-TLAHPISQDYLRDTLQKWITMCSEDIRAGVSNLLVYVKSLKGLAGIRDAVWELLTSESV-SQNWDVLCRRL-LDK--PASFWEDLLRQLFLDRLEILTKEGFESISSSSKQLLILALQELEAKSNTSALSKHVQFEHNVAQFLWSESSSDLPSDAAWVNVANRSQF-TKSGLSMKAQALTPCVQSFCSALDLKLKARLDDLLSYLPAESSA----TKELAPT-PQPLSAFDRYADTGMVEGQLRDHCVACIHHVLGCVREELQGAQ--A----DASSDTRLHAVLFMARLCQSLSELCPHLKQCILGRSGSVETAL-KET---RSTKKLGKGK-VQEVNPVQAKWQEVKAELLQQSLAAYQIWSSAVTKALVQCFTQTLLLD--TAGSVLATATNWDEIEIQEEAESGNSITSKIRLPMQPSWYVQCLLFSLCQEVNRVGGHTLPKVTLQELLKACMAEVLAAYEKLMEEKQDKKAG-TFPMTQNRALQLLYDLRYLNIILTAKSEEAKTSRIRHDSRIEKVTDFLEGHIDPFDLDVFTPHLNSSLHRLVQRTSVLFGLLTGTENQ----YTSRSG----A--LG--SQELHNILPLASS---QIRFGLLPLSMSS----------------SRKAKPATRN--TE--R-VQVPPPAFTRA-E-DEA--LR----PGSLF---R--QLVTE-EEDTAASSLFKL---GWLSGMTK +>9031.ENSGALP00000007041 +M--------------ASRGAEAEAILETHTAAELREAERRLRAGIEQKREELRQMVGERYRDLIEAADTIAEMRLSAERL-LGS-V-RG-------LQRGG---VTRP---GP---A---P----PAPPRVQEKL--Y-GGGTAEAAAGHPRAGVE-RHGGRAIPARRPPLPAVPPPARPAAARRAPRPLQPRPRP-PILLRQVAAASHFRSTILQESKSLLKSQTVSDQAVAEALCAIMLLEDSSPRQALADFLLARKLAIQQLLNQP-HH-G--AGIKAQVCSLMELLTTTLYQAHALFYMMPEGVPPDPALPCGLLFSTLESTTGQQP-AGKG-GVLEDE-VKLS-SWFRYLPESVVEFQPTLR-TLAHPISQDYLRDTLQKWIAMCSEDIRAGVSNLLVYVKSLKGLAGIRDAVWELLTSESI-SQNWDVLCRRL-LDK--PASFWEDLLRQLFLDRLEILTKEGFESISSSSKQLLILALQELEAKSNTSAFSKHIQFEHNVAQFLWSESSSDLPSDAAWVNVANRSQF-AKSGLSMKAQALTPCIQSFCSALDSKLKARLDDLLSYLPAESSP----TKELTPP-VQPRSSFDRYADTSMVEGLLRDHCIACIHHVLSCVREELHGAQ--A----DAPSDTRLHAVLFMARLCQSLSELCPHLKQCILGRSGSVETAL-KET---RSTKKLGKGK-VQEVNPVQAKWQEVKAELLQQSLAAYQIWSSAVTKALVQCFTQTLLLD--TAGSVLAAATNWDEIEIQEEAESGNSVTSKIRLPMQPSWYVQCLLFNLCQEVNRVGGHTLPKVTLQELLKACMAEVLAAYEKLMDEKQDKKAG-TFPMTQNRALQLLYDLRYLNIILTAKSEEAKTSRIKHDSRIEKVTDFLEGHIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLLTGTENQ----YASRSG----A--LG--SQELHNILPLASS---QIRFGLLPLSMSS----------------SRKTKSATRN--TE--R-VEVPPPALTRA-E-DEA--LR----PGSLF---R--QLVTE-EEDTSAPSLFKL---GWLSGMTK +>13735.ENSPSIP00000020553 +--------------------------------------------------------------MLH-----------------------------------------------------------------SQEKF--YSMAAQIKLLLEIPEKIWSAMEASQYLHATQLYLLCCHLHSLLQLDAS-SSRYSPILARFPILVRQVAAASHFRSTILHESKSLLKCQAVSDQAVAEALCSIMLLEDSSPRQALADFLLARKSAVQQLLNQP-HH-G--AGIKAHVCSLMELLTTTLYQAHALFYTLPEGMLSDPSLPCSLLFSMLETTTSQDP-AGKGIHVLKEE-MKLS-SWFKSLPPSIVEFQPTLR-TLAHPISQDYLRDTLQKWINMCSEDIKSGLITLLVYVKSLKGLAGIRDAVWELLTSESM-RQNWDTVCRRL-LDK--SISFWEDLLRQLFLDRLQTLTKEGFDSISSSSKQLLILALQELEAKSSTSAPSKHTQFEHNMALFLWSESPGDLPPDAAWVSVANRSPF-AKSGLSMKAQALTPCVQSFCSALDAKLKAKLDDLLFYLPADSSTP----KETRGV-QARNSAFDRYADAGTVEELLRDHCVACIQYVLGCAREELQKITVLPASSTSWAVLEKSCRALFMARLCQSLGELCPHLKQCILGKSGSTENGM-RET---RSSKKLGKGK-AQEVNPMQAKWQEVKEQLLQQSLFAYQIWSSAVITVLVHRFTQTLLLD--TAGSILATATNWDEIEIQEETESGSSVTSKIRLPVQPSWYVQCLLFSLCQEVNRVGGHALPKRTLQLLLKTCLAEVLAGYEKLVEEKQE-KKG-SFPMTQNRALQLLYDLRYLNIVLTAKSEEAKASRSKQDSRIEKVTDFLEANIDPFDLDVFTPHLNSGLNRLVQRTSVLFGLLTGAENQ----YTNRSN----H--LS--SQEPHNILPLASS---QIRFGLLPLSMSS----------------SRKTKSAVKT--TEN-P-TQVPPPSVITA-E-ETF---R----PGSLF---R--QLATE-EGDTATPSLFKL---GWLSSMTK +>9361.ENSDNOP00000011178 +M-AAAAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--RATDQYCARLRQAS---PAAP---RP--PW---AP-Q-PQQ-PPQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHRLLHLDSS-GFRYSPILSRFPILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XX-X--XXXXXXICSLVELLATTLNQAHGLFYTLPEGVLPDPALPLCLLLTTLETVTGPQP-TGKGNGVLQ-E-MNLC-SWFKHLPASIVEFQPALR-TLAHPISQEYLKDTLQKWIYMCNEDIKNGITNLLVYVKSMKGLA-IRDAVWELLTNEM---NSWNVICQRL-LEP--SV--WEDLMQQXXXXXXXTLTKEGFDSISSSSRELLVSALQELETSASSSIPNKHIHVELNMSLSLWSESPNDLPSDAAWVSVANRAQF-ANSGLSMKAQAISPCVQSFCSALDSQLKVKLDDLLAYLPSDDSSP---PKEITPM-QAKNSAFDRYADAGTVQGMLRTHSVACIQHIIDCIRTELQSIEEAMQGQQDVLNSVKLHAVLFMARLCRSLGELCPHLKQCILGKSGNSQKPA-RDS---RAMKKQGRGK-TQEIIPMQTKWQEVKELLLQQCVTGYRVWSSAVVQVLVHGFTQSLLLD--DAGSILAMATSWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMSQVVAAYEKLSEEQQIKKEG-AFPVTQNRALQLLYDLRYLSIILTAKSEEVKSGRSQHDSRIEKVTDYLEALIDPFDLDVFMPHLNSNLNRLVQRTSVLFGLATGTENQ----FTPKSS----A--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--AET-K-AQXXXXXXXXD-D-DPV-------QPGSLF---R--QLISE-EDDSPTPSLFKL---GWLSSMTK +>9305.ENSSHAP00000018667 +M-AATAGPLALK---RPELRDAAALFEAHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRCCAEGL-LDA-F-RATDQCCARLRQQS-HASATAT-SR--PSR---AP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHGLLRLDST-SGSYSPVLARFPILVRQVAAASHFRSTILHETKMILRCQTVSDQAVAEALSSVMLLEDSSPRQALTDFLLARKAAIQQLLNQP-HH-G--AGIKAQICSLVELLVTTLYQAHALFYTLPEGVLPDPSLPCGVLFSTLDSVTSQRL-AGKGIVSVLQE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPINEEYLKDTLQKWISMCHEDIKSGITNLLVYVKSLKGLAGIRDAVWELLTSESM-SRSWEMVCRRL-LDK--RLSFWEDLLQQLFLDRLQTLTREGFDSISSSSKQLLTSALQELEASS-STSPNKQVQFEHNMSLFLWSESPSDLPSDAAWVNVANRSQC-ASSGLSMKAQALSPYVQSFCLALDSKLKVKLDDLLSYLPSD---A---PKEASGI-QTKNSAFDRYSDAGTVEGMLRNHCAACIEQIVACVRTELQGAEAVLRGPVQTISRSKLSSVLFMARLCQSLGELCPHLKRCILGKSGSSEKPT-REP---RSMKKQMKGK-AQEVNPILAKWQEVKEQLLEQSLLGYRLWSTAITNVLVHDFTRSLLLH--NAGSILAMATNWDELEIQEETETGSSVTSKIRLPVQPSWYVQSFLFSLCQEINQVGGHALPKATLQEMLKGCLVQVLAGYEKLSEEKPTKKEG-MFPMTQNRALQLLYDLRYLNIVLTVKSEEVKSSRSKQDSRIEKVTDFLEGLIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLLTGTDNQ----FSARSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSTTS----------------TRKAKSAGRS--TEP-K-DQVVLPTLSRA-D-DDM--MR----PGSLF---R--QLVTE-EEDTSTPSLFKL---SWLSSMTK +>13616.ENSMODP00000032296 +--VAMAGSQALK---RLELRDAEALFEAHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRCCAEGL-LDA-V-RATDQCCARLRQQS-HATSTAT-ATA-ASR---SA-R-TPQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHGLLRLDSS-SGCYSPVLARFPILVRQVAAASHFRSTILHETKMILRCQAVSDQAVAEALSSVMLLEDSSPRQALTDFLLARKAAIQHLLNQP-HH-G--AGIKAQICSLVELLATTLYQAHALFYTLPEGVLPDPALPCGLLFSTLDSVTSQQL-AGKGIINVLQE-MKLC-SWFKHLPASIMEFQPTLR-TLAHPINEEYLKDTLQKWINMCHEDIKTGITNLLVYVKSLKGLAGIRDAVWELLTSESM-SQSWEVVCRRL-LDK--PISFWEDLLQQLFLDRLQTLTRDGFDSISSSSKKLLVSALQELEASS-STSPNKQVQFEHNMSLFLWSESPSDLPSDAAWVNVANRSQC-ASSGLSMKAQALSPYVQSFCLALDSKLKVKLDDLLSYLPSD---A---PKEASGA-QTKNSAFDRYSDASTVEGMLRNHCAACTEQIVACVRAELQGAEAALQGPTHMLSRPKLSSVLFMARLCQSLGELCPHLKRCILGKSGSSEKPI-REP---RATKKQAKGK-AQEVNPVLAKWQEVKEQLLEQSLLGYRLWSMAITNVLVRDFTQSLLLG--NAGSILAMATNWDELEIQEETETGSSVTSKIRLPVQPSWYVQSFLFSLCQEINQVGGHALPKATLQEMLKGCLVQVLAGYEKLSEDKPAKKEG-TFPMTQNRALQLLYDLRYLNIVLTVKTEEVKSARSKQDSRIEKVTDFLEGLIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLLTGTDNQ----FSARSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSTTS----------------TRKAKSSSRS--TES-K-DQVSEHSLEPL-S-SGS--PS----PFSI-------EPFGE-ER-------------------TK +>9739.ENSTTRP00000004916 +-----------------------------------------------------------------------------------------------------------------------------PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASEYLHATQLYLLCCHLHKLLQLDPS-TSRYSP-LSRFPILSQQLAAASHFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLNQQ-HH-G--AGVKSQICSLVELLATTLNQAHALFYTLPEGLLPDPSLPCGMLLSTLDNITGQHP-TGKGIGVLQEG-MKLC-SWFKHLPASVVEFQPALR-TLARPISQEYLKDTLQKWIHMCNEDIKNGISNLLMYVTSMKGLAAIRDATWELLANESI-HHSWDVICRRL-LDR--PLLFWEDLMQQLFLDRLQTLTKEGFDSISSSSKELLISALRELESSASSSTSN-HIHFEHNMALFLWSESPSDLPPDAAWVSVSNRAQF-PGSGLSMKAQAVSPCVQSFCSALDSKLKVKLEDLLAYLPSGDPSP---PKEVSPA-QARNCAFDRYADAGTVQEMLQMHSTACVRHITDCVQAELQRIQQAIQGQQDALDGVKLHSVLFMARLCQSLGELCPHLKQCILGKSGSTEKPA-RDS---RALKKQGKGK-TQEIVPMQAKWQEVKELLLQQSVMGYRVWSSAVVKVLAHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPVQPSWYVQSFLLSLCQEINRVGGHALPKVTLQEMKAXXXXXXXXXXXXXXXXXXXXKEG-AFPMTQNRALQLLYDLRYLNIVLTTKGEELKSGRSKQDPRVEKVADYLEALIDPFDLDVFTPHLHGNLNRLVQRTSVLFGLVTATENH----FTPRSS----T--FS--SQEAHNVLPLASS---QIRFGLLPLSMTS----------------PRKAKSAGRS--IET-R-AQAVPPALSRA-D-DLT-------HAGSLF---R--QLVAE-EEDSSAPSLFKL---GWLSSMTK +>10141.ENSCPOP00000018381 +V-AAMATSAALK---RLDLRDSAALFETHGAEEIRRLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--KATDQYKTRLGNGG---LLLS---RH--PR---GS-Q-GKQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHSLLQLDAS-SSQYSPVLSRFPILIRQVTAASHFRSTILRESKMLLKCQAVSDQAVAGALCSIMLLEESSPRQALTDFLMARKAAIQTLLSQP-NH-G--SGIKAQFCSLVELVATTLNQAHALFYTLPEGLLPDPCLPCGLLFSTLETITGQHP-TGKGISILQGE-MKLG-SWLRHLPSSVVEFQPVLR-TLAHPISQEYLRDTLQKWITMCTEDIKNGITNLLLYVKSMKGLAGIRDAIWQLLTSEPA-RQSWEVVCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFESISSSSKELLLSALQELESSSGSSTPNKHILFEQNMSLFLWHESPTDLPSDAAWVSVANRPQL-ASTGLSMKAQAISPHVQNFCTALDSKLKVKLDDLLTYLPSDDSAL---PKDTAPMLQAKNSAFDRYADAETVQAMLRTHSMECVKYIMGCIQAELQSIEVVVQAQEDVLHSTKLHTVLFMARLCQSLGELCPHLKLCIVGRSRSAEKPE-RET---RAPKKQAKGK-AQDLIPGQAQWQEVKELLLQHSVMGYQVWSSAVVKVLVHRFTQSLLLD--DAGSILATATNWEELEIQEETESGSSITSKIRLPSQPSWYVQSFLFSLCQEMNRVGGHTLPKVTLQEMLKNCMVQVITAYEKLSEGKQ-KKEG-AFPLTQNWALQLLYDLRYLRIVLSSK-QEMKSGHGKLDCRTEKVTEQLEALIDPFDLDVFTPYLNSNLHLLVQRTSVLFGLVTGTENQ----FTPRSS----S--LN--SQEAHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSSTTG--VKT-K-AQVGPSALSRA-G-DPT-------QPGSLF---R--QLTSE-EDETSASSLFKL---SWLSSMTK +>10141.ENSCPOP00000003239 +V-AAMAVSAALK---RLDLRDFAALFETHGAEEIRRLERQVRAEIEHKKEELRQMVGERYRDLMEAADTIGQMRRC-EGL-VDAV--KATDQYVKEDRQAC---FLTL---LC--P-------S-QQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEVSQCLQATQLYLLCCHLHSLLQLDAS-SSQYSPILSRFPILIRQVAAASHFRSIILRESKMLLKCQAVSDQAVAGALCSIMLLEESSPRQALTDFLMARKAVIQTLLNQP-NH-G--SGIKAQFCSLVELLATTLNQAHALFYTLPEGLLPDPCLPCGLLFSTLETITSQHP-TGKCISVLQGE-MKLG-SWLRHLPSSVVEFQPVLR-TLAHPISQEYRGDTLQKCITMCTEDIKNGITNLLLYVKSMKGLAGIRDAMWQLLTSEPA-RHSWEVVCWWL-LEK--PLLFWEDVMQQLFLDRLQTLTKEGFESISSSSKELLVSALQELESSTGSSTPNKHILFEQNMSLFLWQESPTDLPSDAAWVSVANRPQL-ASSGLSMKAQAISPRVQNFCTALDSKLKVKLDDLLTYLPSDDSAL---PKNTAPMLQAKNSAFDRYA-AGTVQAMLRTHSVGCVKYIMGCIQAELQSIEVVVQAQEDVLHSTKLHGPRH-GRLCQSLGELCPHLKLCIVGRSRSAEKPE-RET---RAPKKQAKGK-AQDLTPGQAQWQEVKELLLQHSVTGHQVWSSAVVTVLVHRFTQSLLLD--DAGSILATATNWEELEIQEETESGSSITSKIQLPSQPSWYVQSFLFSLCQEMNRVGGHTLPKGTLQEMLKNCMVQVVTAYEKLSEGKQ-KKEG-AFPLTQNWALQLLYDLHYLCIVLSSK-QEMKSGHGKLDCRTEKVTEHLEALIDPFDLDVFTLYLNSNLHLLVQRTSVLFGLVTGTENQ----LTPQSS----S--LN--SQEAHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSSTTG--IET-K-AQVGPLALSRA-G-DPT-------QPGSLFTDAR--QLASE-EDKTSAPSLFKL---SWLSSMTK +>9785.ENSLAFP00000023898 +M-AATAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--RATDQYCARLRQEG---ACTP---KY--PT---SP-Q-PPQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHRLLHLDSS-GSACSPVLSRFPILIRQVAAASHFRSAILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKAAIQKLLNQP-HQ-G--VGTKAQICSLVELLATTLNQAHALFYSLPEGQLPDLSLPCGLLFSTLETITGQHP-NGKGIGVLQEE-MKLC-SWFRHLPASIVEFQPALR-TLAHPISQEYLKDTLQKWIHMCNEDIKSGLTNLLMYVKNMKGLAGIRDAIWELLTNEST-NHSWDVICRRL-LEK--PLLFWEDLTQQLFLDRLQVRVR-------------------------------------------WXTESLNDQPPDAAWINVDIRAQF-ASTGLSMKAHAVSPGVQRFCSALDSKLKVQLDDLLAYLPPDDVSL---PKDASPQ----NSAFDQFADAGTVQGMLQTHSVACIQHIVACIHTELQGVEEITLRQQGVLTDVRLHAVLFMARLCQSLGELCPHLKQCISGRSGGSEKPA-REP---RALKKQGKGK-AQEMMPLQTKWQEVKGLLLQQSVTAYRVWSSAVVKVLVHEFTQSLLLD--DAGSVLATATSWDELEIQEETESGSSVTSKIRLPVQPSWYVQSFLFSLCQEVNRVGGHALPKVTLQEMLKSCMVQIVAAYEKLAEEKQTKKEG-AFPITQNQALQLLYDLRYLSIVLTAKSEEVKSGRSKQDSRTEKVTDYLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENQ----FTPRSS----T--FN--SQEPHNILPLATS---HIRFGLLPLSMTS----------------TRKARLTSRG--AET-K-AQVVPPALPRA-D-DPM---H----PGSLF---R--QLVNE-EEDTSTPSLFKL---GWLSSMTK +>9669.ENSMPUP00000014182 +M-CAAARRGARL---GWGLSLGA--------------------------------------ELVDGKSKMSQWILCLQDTLPEPAT-SGSEHTCCWLDGSP---VLEK---CT--VW---SL-REPQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHNLLQLDSS-GSRFSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKTAIQKLLNQP-QH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGQLPDPSLPCGLLFSTLETITGQHP-PGKGTGALQ-E-MKLC-SWFRHLPASVVHFQPALR-TLAQPISQEYLKDTLRRWIHMCNEDIKNGITNLLTYVKNVQGLAGVRDAIWKLLTSEST-SHSWEVICERL-LEK--PLLFWEDLMQQLFLDRLQTLTKEGFDSISTSSEELLVSALQELEGNASSSSSNKHIYFEHNMSLFLWSESPQDLPPDAAWVSVAHRGPL-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSTDTSL---TKDISPG-PAKGCAFDRYADAGTVRETLQTHSVACIKHITERVQAELQGAEQAMQGQQDVLGGVKLPAVLFMARLCQSLGDLCPHLKQCILGKSGSSEKPA-RDP---RALKKQGKGK-TQEIIPVETKWQEVKELLLQQSVMGYRVWSSAVVKVLAHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSTIRLPVQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVLAAYEKLAEEKQVKKEG-AFPMTQNRALQLLYDLRCLSVVLTARGEEVKTGRNRQDSRLEKVADYLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENP----FTPRSC----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------ARKAKSTSRN--IET-K-AQVVPPALSRA-G-DPA---Q----PGSLF---R--QLVSE-EEDASTPSLFKL-DLNWTNTITS +>10090.ENSMUSP00000018805 +M-AAATASSALK---RLDLRDPNALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--QATDQYCARLRQAG---SVAP---RV--PR---AP-Q-P-Q-PPSEKF--YSMAAQIKLLLEIPEKIWSAMEASQHLQATQLYLLCCHLHSLLQLDSS-NSRYSPILSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQTLLNQS-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGVLPDPSLPCGLLFSTLETVTRQHP-TGKGIGALQGE-MKLC-SWFRHLPTSIIEFQPTLR-TLAHPISQEYLKDTLQKWIDMCNEDIKNGIGNLLMYVKSMKGLAGIRDAIWDLLSNESA-SHSWEVVCQRL-LEK--PLLFWEDLMQQLFLDRLQTLTREGFESISNSSKELLVSALQELETN--NSTSNKHVHFEQNMSFFLWSESPNDLPSDAAWVSVANRAQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSSDTPL---LKDTTPTHQPKNSAFDRYADAGTVQDMLRTQSVACIKSVVGCIQAELCTIEEVTREQKDVLHSTKLHAVLFMARLCQSLGELCPHLKQCVVGQCGGSEKPA-REA---RALKKQGKGR-AQDVLPAQAQWQGVKEVLLQQSVMAYRVWSTALVKFLICGFTRSLLLR--DAGSVLATATNWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQEVNRVGGHALPKVTLQEMLKTCMAQVIAAYEQLTEENQIKKEG-AFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRMEKMTERLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENQ----FASRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKARATSRS--VET-Q-AQVGPPALSRV-G-DPT---T---HPGSLF---R--QLASE-EDDSPAPSLFKL---AWLSSMTK +>10116.ENSRNOP00000003804 +M-AAATASSALK---RLDLRDPNALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--QATDQYCARLRQAG---SAAS---RV--PR---AP-Q-P-H-PPSEKF--YSMAAQIKLLLEIPEKIWSCMEASQHLQATQLYLLCCHLHSLLQLDSS-SSRYSPILSRFPILVRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQTLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGVLPDPSLPCGLLFSTLETVTRQHP-TGKGISALQGE-MKLC-SWFRHLPASVTEFQPALR-TLAHPISQEYLKGTLRKWIDMCSEDIKNGIGNLLMYVKSMKGLAGIRDAIWDLLTNESA-SHSWEVVCQRL-LEK--PLLFWEDLMQQLFLDRLQTLTREGFDSISSSSKELLVSALQELEAN--NSTSNKHVHFEQNMSLYLWSESPNDLPSDAAWVSVANRAQF-ANSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSSDTPL---LKDTTHTHQAKTSAFDRYADAGTVQDMLRTQSVACIKSVVGCIQAELRVIEEVTQDQKDVLHSTKLHAVLFMARLCQSLGELCPHLKQCIVGKCGGSEKPA-REV---RALKKQGKGK-AQDVLPVQAQWQEVKEVLLQQSVMAYRVWSAALVKVLICGFTQSLLLS--DAGSVLATATSWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQEVNRVGGHALPKITLQEMLKTCMAQVIAAYEQLTEENQIKKEG-TFPMTQNRALQLLYDLRYLNIVLTSKGEEVKSSRSKSDSRIEKMADRLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENQ----FASRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKARATGRG--IES-Q-TQVGPPALSRV-G-DPT---A---HPGSLF---R--QLASE-EDGSPAPSLFKL---AWLSSMTK +>59463.ENSMLUP00000015199 +M-AATATSAAFK---RLDLREPRGRFDPRSGRRSEAWKRQVRAEIEHYKEVAAQKAGLGFRGVTRTKDKDVAVVVCLEVM-LEDG--MRIETNCEMTRVSV----PLP---GP--EQ---SG-G-PQQ-PAREKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHSLLQLDSS-GSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAGSDQAVAEALCSIMLLEESSPRQALADFLLARKAAIQKLLNQP-HH-G--AGVKAQICSLVELLATTLNQAHALFYTLPEGLLPDPSLPCGLLFSTLETITGQHP-TEKGIGVLQEE-MKLC-SWFKHLPASIVEFRPALR-TLAHPISQEYLTDTLQKWIHMCKEDIKNGITSLLMFVKSMKGLAGIRDAVWELLTNEST-SRSWDVVCRRL-LEK--PLLLWEDLMQQLFLDRLQTLTKEGFDSISTSSRQLLTSALQELESNTSKSASNKHIQFEHNMSLFLWSESPGDLPPDAAWVSVASRGPF-GGSGLSMKAQAVSPCVQNFCAALDAKLKVKLDDLLAYLPSDDSSL---PKEVTPV-QAKNCAFDRYADAGTVQEMLRTHSVACIKHITDCVRAELQSIEEAVRGQQNALGRDKLHAVLFMARLCQSLGELCPHLKQCILGKSGSSEKPA-RDS---RALKKQGKGK-TEKVLPTQAQWQEVKELLLQQSVMSYRVWSSAVVQVLAHGFAQSLLLD--DAGSVLATATSWDELEIQEEAESGSSITSKIRLPVQVSRPCQSRTETCSEEINRVGGHALPKVTLQEMLKNCVAQVVAAYEKLSEGKETKREG-AFPMTQNRALQLLYDLRYLSTVLTAKGEEVKSGRSKHDSRIEKVTDYLEGLIDPFDLDVFTPHLNSNLTRLVQRTSVLFGLVTGTENQ----FTPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--IES-K-AQVVPPALSRA-D-DPT--H-----PGSLF---R--QFVSE-DEDS-TPSLFKL---GWLSSMTK +>9913.ENSBTAP00000007999 +M-AAAAASSALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAAGL-VDAV--RATDQYCARLRQAG---SAAP---RP--PR---DP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASRYLHATQLYLLCCYLHKLLQLESS-SSRHSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKAAIQKLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGLLPDPLLPCGLLFSTLDSITSQHP-SGKGVWVLQDE-MKLC-SWFKHLPASVVEFQPALR-TLAHPISQEYLKDTLQKWIHVCNEDIRNGISSLLMYVTSTKGLAGIRDAVWGLLANESI-HHSWDVVCRRL-LDK--PLLFWEDLMQQLFLDRLQTLTKEGFDSISSSSTELLTSALQELESSSS--ASSKHLHFEHNMAVFLWSESPSDLPSDAAWVSVSSRAPF-QGSGLSMKAQAISPCVQSFCSALDSKLKVKLEDLLAYLPSGDPLP---RQDTSPA-AAESCAFDRFADAETVQETLRTHSTACIRDITDCIQAELQSIEQAIQGQQDVLDGAKLHSALFMARLCQSLGELCPHLKQCILGRSGSPEKPA-QDS---RALKKQGKGK-AQEVLPTQARWQDVKELLLQRSVTGYRVWGSAVVRVLAHGFAQSLLVD--DAGSILATATSWDELEIQEEAESGSSITSKIRLPVQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCLGRVAAAYERLSEAKQLKKEG-AFPMTQNRALQLLYDLRYLSVVLTAKGEEMKSGRCRQDSRVEKVADYLETLIDPFDLDVFTPHLHSNLNRLVQRTSVLFGLVTGPENQ----FTPRSS----T--FN--SQEAHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSAGGS--MDT-K-AQAAPPALSRA-D-DPR---Q----AGSLF---R--QLVAD-EEDSAAPSLFKL---GWLSSMTK +>37347.ENSTBEP00000010812 +M-AAAATSPAFK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV---ATDQYCARLRQGS----AAL---R---PR---AS-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEAAQYLQATQLYLLCCHLHSLLQLDSS-NSRYSPVLSRFPILIRQVAAASHFRSTILHESKVLLKCQSVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLINQP-HH-G--AGVKTQICSLVELLATTLNQAHALFYTLPEGLLPDPALPCGLLFSTLETITGXXX-XXKGIGVLQGE-VTLC-SWFRHLPASVIEFQPALR-TLAHPISQEYLRDTLQKWIHMCNEDIKNGITHLLLYVKSVRGLAGIRDAIWELLTSESA-SHSWDVICRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSCKELLVSALQELESSTSNSTSNKHVHFEQNMSLFLWSESPSDLPSDAAWVSVASRGQL-ASSGLSMKAHAVSPCVQSFCSALDSQLKVKLDDLLAYLPSEDS-----PKDVPSV-LARSSAFDKYADAGTVQDVLRTHSAACIQHITDCIRAQLQSIEEAVQGQQDALSGARLHAVLFMARLCQSLGELCPHLKQCISGKSSSSEKPA-RES---RALKKQGKGK-TQEIIPVQARWQEVKEVLLQQSVLGYRVWSSAVVKVLIHGFTRSLLLD--DAGSVLATATNWDELEIQEETESGGSVTSRIRLPVQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKNCMVQVIAAYEKLSEETQVKKEG-AFPITQNRALQLLYDLRYLSIVLATKGEEGKSGRSKPDSRIEKVTDHLESLIDPFDLDVFMPHLNSNLNRLVQRTSVLFGLVTGTENQ----FTPRSS----T--FN--SQEAHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--VET-K-AQVVPSALSRA-D-DPT---H----PGSLF---R--QFVNN-EHDTSVPSLFKV---GWLSSMTK +>30608.ENSMICP00000006810 +-----------------------------------------------------------------------------------------------------------------------------PQQ-PSQQNF--YSMAAQIKLLLEXXXXXWSSMETSQYLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSAILHESKMLLKCQAVSDQAVAEALCSIILLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--TGIKDQICSLVELLAATLNQAHALFYTLPEGALPDPSLPCGLLFSTLETVTAQHP-TGKGTGVLQGE-MKLC-SWFKHLPASVVGFQPVLR-TLAHPISPEYLRDTLQKWIHMCNEDIKNGITNLLLYVKSMKGLAGIRDAMWELLTNEST-NHSWDVICRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFESISNSSKELLVSALQELESSTSSPTSNKHIHFEHNLSLFLWSESPNDLPSDAAWVSVANRHQL-ACSGLSMKAQAVSPCVQNFCLALDSKLKVHLDDLLAYLPSDDLSL---PKDISPM-QPKSSAFDRYADAGTVQEMLRAHSVACIQHITDCIRAELRSIEEVVQGQQDVLDSVKLHAVLFMARLCQSLGELCPH-EQCIL-KSGSSEKPA-RES---RALRKQGKET--QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEETESGSSVTSKIRLPIQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEVLKSCMVQVAAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLSIVLTTKAEEGKSSRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTESQ----FSPRSS----T--FN--SQEPHNILPLASS---QIXXXXXPLSMT-----------------TRRVKS-SRS--VET-K--QVVPPALSRA-G-DPM---L----PGSLF---R--QLVSE-EDDTSAPSLFKL---GWLSSMTK +>132908.ENSPVAP00000006353 +M-AAGATSAALK---RLDLRDPAALFETHGTEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRCCAEGL-VDAV--KATDQYCARLRQAG---SAAA---RA--SK---DP-Q--LQ-PSQEKF--YSMAAQIKLLLEIPEKIWSAMEASQYLHATQLYLLCCHLHSLLQLDSS-GSRYSPILSRFPILIRQVAAASHFRSTILHESKMLLKCQAMSDQAVAEALCSIMLLEESSPRQALTDFLLARKAAIQKLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGLLPDPSLPCGLLFSTLETITGQHP-AGKGTGVLQGE-MKLC-SWFRHLPASIVTFQPALR-TLAHPISQEYLQDTLQQWAHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-SHSWDVICRRL-LEK--PLLFWEDLMQQLFLDRLQTLTKEGFDSISTSSKELLVSALQELESSTSNSTSSKHIYFEHNMSAFLWSESPNDLPSDAAWVPVANRGQF-AGSGLSMKAQAVSPCVQNFCSALDSKLKVKLDDLLAYLPSGDSSL---SKDVSLT-QAKTCAFDRYADAGTVQEMLRTHSVACIRHVADCIRAELQSIEEAVRGQQAALSAVKLHAVLFMARLCQSLGELCPHLKQCILGKPGSSEKPA-RDS---RALKKQGKGK-TQEVLPAQAQWQEAKELLLQQSLLGHRVWSSAVVRVLAHGFTQSLLSD--DAGSVLATATSWDELEIQEEAESGSSITSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLLEEKDMKKEG-AFPMTQNRALQLLYDLRYLNIVLTAKGEEVKSSRSKQDSRIEKVADSLEAFIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENQ----FTSRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSSGRS--IES-E-PQVVPPALSRA-D-DPT---H----PGSLF---R--QLVSE-EDDSSTPSLFTL---GWLSSMTK +>9685.ENSFCAP00000004377 +M-AAAATSPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--KATDQYCARLREAG---SAAP---LP--PR---DP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHSLLQLDSS-GSRYSPVLLRFPILIRQVAAASHFRSTILHESKLLLKCQAVSDQAVAEALCSIMLLEESSPRQALADFLLARKAAIQKLLNQP-HHIG--TGIKTQVCSLVELLATTLNQAHALFYTLPEGQLPDPSLPCGLLFSTLETITGQHP-TGKGAGVLQEE-VKLC-SWSRHLPASVVQFQPALR-TLAQPISQEYLKDTLRKWIHMCNEDIKNGITNLLFYVKSIRGLAGIRDAMWELLTNEST-NHSWDVICQRL-LEK--PLLFWEDLMRQLFLDRLQTLTREGFDSISTGCKELLISALRELESSTSSSTPSKHIHLERNMSLFLWSESPQDLPPDAAWVSVAHRGPR-AGSGLSMKAQAVSPCVQDFCSALDAKLQVQLDDLLAYLPSADASP---PKDVSPV-QAKSCAFDRYADAGTVLELLQAQSVACIERITACIRAELHGSEQVVQGQRDALDSVQLHAVLFMARLCQSLGELCPHLKQCVLGKSRNSEKPA-RDP---KALKKQGKGT-TREVLPSQAKWQEVKELLLRQSVMGYRVWSSAVVKVLAHGFTRSLLLD--DAGSILATATSWDELEIQEEAESGSCIMSTIRLPTQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQVKKEG-AFPMTQNRALQLLYDLRYLSIILTARGEEVKSGRSKQDSRIEKVADSLETLIDPFDLDVFTPHLNSNLTRLAQRTSVLFGLVTGTENQ----FTPRSN----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--IET-K-TQVGPPALSRA-G-DPT---H----PGSLF---R--QLVSE-EEDASTPSLFKL---GWLSSMTK +>30611.ENSOGAP00000013460 +M-AATVASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRCCAEGL-VDAV--KATDQYCARLRQAG---SAAP---QP--EQ---DP-Q-PQQ-PSQENF--YSMAAQIKLLLEIPEKMWSSMEASQYLHATQLYLLCCHLHSLLQLDSS-GSRYSPVLSRFPILIRQVAAASHFRSAILHESKMLLKCQAVSDQAVAEALCSIILLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKDQICTLVELLAATLNQAHALFYTMPEGLLPDPALPCGLLFSTLETVTGQHP-TGKGIGVLQGE-MKLC-SWFKYLPASVVGFRPVLR-TLAHPISQEYLRDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAIWELLTNEST-NHSWDVICRRL-LEK--PLLFWEDMMQQLFLDQLQTLTKEGFESISKSSKELLGSALQELESSTGSSTPNKHIHLEQNLSLFLWSESPSDLPSDAAWVSVANRRQV-ASSGLSMKAQAVSPCVQNFCSALDSKLKIHLDDLLAYLPSDDSSL---PKEISPT-QSKSSAFDRFADAGMVEDMLRLHSVACIQHIVDCIWAELHSIEEAVQGQQDVLGSVKLHAVLFMARLCQSLGELCPHLKQCILGKSGSAEKPA-RDS---RALRKQGKGK-TQEILPTQAKWQEVKEALLQQSVMGYRVWSSAVVQVLIHGFTQSLLLA--DAGSVLATATSWDELEIQEETESGSSVTSKIRLPIQPSWYVQSFLFSLCQEINRIGGHALPKVTLQEMLKSCMVQVIAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTTKAEEGKSSRSKPDSRIEKVTDHLEALIDPFDLDVFMPHLNSNLNRLVQRTSVLFGLVTGTENQ----FSPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRRGKSTSRS--AET-K-AQAVPPALSTA-G-DPM---L----PGSLF---R--QLVSE-EDDTSASSLFKL---SWLSSMTK +>9823.ENSSSCP00000018275 +M-AAAAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---DP-Q-PQL-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHTLLQLDAS-SSRYSPVLSRFPILVRQVAAASHFRSTILHESRMLLKCQAVSDQAVAEALCAIMLLEESSPRQALTDFLLARKAAIQKLLNQP-HH-G--AGVKAQICSLVELLATTLNQAHALFYTLPEGLLPEPSLPCGLLFSTLDTITGQHP-PGKGLGVLQQE-MKLC-SWFKHLPASVVEFQPALR-TLAHPISQEFLKDTLQKWIHMCNEDIKNGIGSLLVYVTSMKGLAGIRDAMWELLANESI-HHSWDVICRRL-LDK--PLLFWEDLMQQLFLDRLQTLTKEGFDSISSSSKELLIAALQELESSTSSSTSNKHIHFEHNMSLFLWSESPSDLPSDAAWVSVSNRAQF-PSSGLAMKAQAVSPCVQNFCSALDSKLQVQLEDLLAYLPSGDPAL---PKDVSPA-QAKNCAFDRYADAGTVQDMLRTHSTACIKRVLNCIQAELQSVEQALQGQQDVLGGVKLHAVLFMARLCQSLGELCPHLKQCILGKSGTTEKST-RDS---RALKKQGKGK-AQEMIPMQAKWQEVKELLLQQSVMGYRVWSSVVVKVLAHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPVQPSWYVQSFLFSLCQEVNRVGGHALPKVTLQEMLKSCMVRVVAAYEKLAEEKQLKKEG-AFPMTQNRALQLLYDLRYLNIVLTAKGEEMKSGRSKPDSRVEKVADYLEALIDPFDLDVFTPHLHSNLNRLVQRTSVLFGLVTGTENP----FTSRSG----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSASRS--LET-K-AQVVPPALPRA-D-DPR---H----PGSLF---R--QLVTE-EEDSSTPSLFKL---GWLSSMTK +>43179.ENSSTOP00000001636 +M-AAAAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--KATDQYCARLRQAG-----WP---RP--PR---AP-Q-PQP-PSQEKF--YSMAAQIKLLLEIPEKIWSFMEASQYLHATQLYLLCCHLHSLLQLDSS-SSRYNPILSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAIAEALCSIMLLEESSPRQALTDFLLARKTTIQKLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEDLLPDPSLPCGLLFSTLETITGQQP-TGKGISVLKGE-MKLC-SWFRRLPASVIEFQPALR-TLAHPISQEYLRDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-SHNWEVVCQRL-LER--PLLFWEDMMQQLFLDRLQTLTKEGFESISRSSKELLVSALQELESSTSNSTSNKHIHFEQNMSLFLWSESPSDLPPDAAWVNVANRGQF-ASSGLSMKAQAISPYVQNFCSALDSKLKVKLDDLLAYLPSDDVPL---PKDAVTT-QTKSSAFDRYADAGTVQAMLQTHSVACIKHILDGIQVELQNIEEVVQGQQDVLQGTKLHAVLFMARLCQSLGELCPHLKQCIVGKSRSSDKPS-REA---RALKKQGKSK-AQEILPVQAKWQEVKDVLLQQSVMGYRVWSSAVVKVLIHGFTQSLLLD--DAGSVLATATNWDELEIQEETESGSSVTSKIRLPTQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEELSEEKQIKREG-AFPVTQNRALQLLYDLRYLSIVLTAKSEEAKSGRNKPDSRCEKVTDHLEALIDPFDLDVFTPHFNSNLNHLVQRTSVLFGLVTGTDNQ----FTPRSG----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--TET-K-TQVSAKS---------------------------------------------------------- +>9796.ENSECAP00000006507 +M-AAAAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---DP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHNLLQLDSS-GSQCSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSVMLLEESSPRQALADFLLARKAAIQKLLSQP-LH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGLLPDPSLPCGLLFSTLETITGQHP-TGKGISVLQEE-MKLC-GWFKHLPASVVEFQPALR-TLAHPISQEYLRDTLQKWIHVCNEDIKNGITNLLKYVKSMKALAGIRDAMWELLNMEST-AHGWTVVCRRL-LEK--PLLFWEDLMQRLFLDRLQTLTKEGFDSISASSRELLVSALQELESSTSNATPNKHIHFEHNMALFLWSESSSDLPPDAAWVNVANRGQL-AGSGLSMKAQAVSPCVQNFCSALDSKLKVKLEDLMAYLPSGDSSL---SKDVSPS-QARSCAFDRYADAGTVQDMLQTHSVACIQHITDCIRVELQNIEDVVQGQQDVLSGVKLHAVLFMARLCQSLGELCPHLKECILGKSGSSEKPA-RDS---RALKKQGKGK-TQEIIPTQAKWQEVKELLLQQSVVGYRVWSSAVVKVLAHGFAQSLLLD--DAGSVLATATSWDELEIQEEAESGNSITSKIRLPVQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQIVAAYEKLPEEKQMKKEG-AFPMTQNRALQLLYDLRYLNIVLTAKGEEVKSGRSKQDSRFEKVADYLEGLIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGPENQ----FTPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKTKSTSRS--IET-K-AQAVPPALSRA-D-DPM---Q----PGSLF---R--QLVSE-EEDSSTPSLFKL---GWLSSMTK +>9646.ENSAMEP00000002816 +M-AAAAASPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEG-LVDSV--KATDQYCARLRL---AGSAAX---XX--XX---XX-X-PQP-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHNLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSSILHESKMLLKCQAVSDQAVAEALCSVMLLEESSPRQALTDFLLARKAAIQKLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGQLPDPSLPCGLLFSTLETITGQHP-TGKGAGVLQ-E-MKLC-SWFKHLPASIVQFQPALR-TLAQPISQEYLKDTLQKWIHMCNEDIKNGITSLLIYVKSMKGLAGIRDAMWELLTNEST-SHSWDVICQRL-LEK--PLFLWEDLMQQLFLDRLQTLTKEGFDSISSSSKELLLSALQELEGNSSNSTSNKHIHFEHNMSLFLWSESPQDLPPDAAWVSVAHRGQF-AGSGLAMKAQAVSPCVQNFCSALDSKLKVKLDDLLAYLPTADSSL---PKDVSPV-PAKGCAFDRYADAGTVQAMLQTHSVACIQHIAERIRAELQSVEQVVQGQQDVLSGAKLHAVLFMARLCQSLGELCPHLKQCILGKSGSSEKPA-RDP---RALKKQGKGK-TQEIIPTQAKWQEVKELLLQQSVMGYRVWSSAVVKVLAHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSTIRLPIQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLAEEKQVKKEG-AFPMTQNRALQLLYDLRYLNIVLAARGEEVKSGRGKQDSRIEKVADYLEALIDPFDLDVFTPHLNSNLTRLVQRTSVLFGLVTGTENH----FTPRSC----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--IET-K-AQVVPPALSRA-G-DPT---Q----PGSLF---R--QLVSE-EEDASTPSLFKL---GWLSSMTK +>9615.ENSCAFP00000006718 +------------------------------------------------------MVGERYRDLIEAADTIGQMRRCAEG-LVDAV--KATDQYCARLRLRL-AGPAAP---RP--PR---DP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHNLLQLDSS-TSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCAIMLLEESSPRQALTDFLLARKAAIQKLLNQP-HH-G--ASIKAQICSLVELLATTLNQAHALFYTLPEGQLPDPSLPCGLLFSTLETITGQHP-TGKGTGVLQEE-MKLC-SWFKYLPASIVQFQPALR-TLAQPISQEYLKDTLQKWIHMCNEDIKNGITNLLLYVKSMKGLAGIRDAMWELLTNEST-NHSWDVICQRL-LEK--PLLFWEDLMQQLFLDRLQTLTKEGFDSISTSSKELLISALQELENTTSNSTSNKHIHFEHNMSLFLWSESPHDLPPDAAWVSVAHRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSPL---PKDVFPG-QAKSCAFDRYADAGTVQEMLQTHSVVCIKYITDCIQAELQSIEQVVQGQQDVLNGVKLHAVLFMARLCQSLGELCPHLKQCILGRSGSSEKTA-RDP---RALKKQGKGK-TREVIPMQAKWQEVKELLLQQSVMGYRVWSSAVVKVLAHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSTIRLPIQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLAEEKHVKKEG-AFPMTQNRALQLLYDLRYLNIVLTARTEEVKSGRSKQDSRIEKVADYLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVTGTENH----FTPRSC----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKSTSRS--MET-K-AQVVPPALSRA-G-DPT---H----PGSLF---R--QLVSE-EEDASTPSLFKL---GWLSSMTK +>9478.ENSTSYP00000011163 +-----------------------------------------------------------------------------------------------------------------------------PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQFLHATRLYLLCCHLHSLLRLDSS-SSRHSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLNQAHALFYTLPEGLLPDPSLPCGLLFSTLETITSQHP-AGRGISVLQGE-MKLC-GWFKHLPASVVDFQPARR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGISNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVICRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSSGNSTSSKHVHFEHNMALFLWSESPNDLPSDAAWVNVANRSQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSP---SKDVSPT-QAKNSAFDRFADARTVQELLRTHSVACIKHIMDCICAELQSIEAAVQGQQDILNSVKLHSVLFMARLCQSLGELCPHLKQCILGKSGSTEKPA-RES---RALRKQGKAK-AQEVIPTQAKWQEVKEVLLQQSVTGYRVWSAAVLKVLIHGFTQSLLLD--DAGSVLATATNWDELEIQEETESGSSITSKIRLPVQPSWYVQSFLFSLCQEINRIGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTTKAEEVKSGRSKPDARIESVTDRLEVLIDPFDLDVFTPHLNSNLNRLVQRTSGTVG------HT----FSP---------------------------------FGLLPLSMTS----------------TRKAKSTSRN--VET-K-AQVVPPACSEA-G-DPM---L----PDSLF---K--QLVSE-EDDTSAPSLFKL---GWLSSMTK +>9483.ENSCJAP00000037059 +M-AAAATSPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYTGSPRLLG-FRDETP---NP--AK---PL-SFPQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHSLLQLDSS-SSRHSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAMSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTVKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-TGKGTGVLQEG-MKLC-SWFKHLPASVVEFQPTLR-TLAYPISQEYLKDTLQKWIHMCHEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVICRRL-LEK--PLLFWEDIMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSGSSSNKHIHFEHNMSLFLWSESPNDLPSDAAWVTVANRVQF-ANSGLSMKAQAISPCVQNFCSALDSKLKVKLDDILAYLPSDDSSL---PKDVSPT-QTKSSAFDRYADAGAVQEMLRTQSVVCIKHIVDCIRAELQSIEEGVQGRQDVLSSVKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYRVWSTVVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEMNRVGGHALPKVTVQEMLKSCMVQVVAAYEKLAEEKQIKKDG-TFPVTQNRALQLLYDLRYLNIVLTAKTDEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSN----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKPKST-RN--IET-K-AQVVSPACSTA-G-DPT---L----PGSLF---R--QLISE-EDNSSAPSLFKL---AWLSSMTK +>9544.ENSMMUP00000001688 +M-AAAATSPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---AP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQYLHATQLYLLCCHLHNLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGVTNLLMYVKSMKGLAGIRDAMWELLTNESA-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVSVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPT-QAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSATLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYRVWSTAVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEVNRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQSKKEG-AFPVTQNRALQLLYDLRYLNIVLTAKADEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--VET-K-AQVVPPAHSTA-G-DPT---V----PGSLF---R--QLVSE-EDNTSAPSLFKL---GWLSSMTK +>61853.ENSNLEP00000001585 +M-ATAATSPSLK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---AP-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVNVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPA-QAKSSAFDRYADAGTVQEMLRTQSVACIKHIVNCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSDSSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYRVWSSAVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLSIVLTAKADEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--IET-K-AQVVPPAHSTA-G-DPT---V----PGSLF---R--QLVSE-EDNTSAPSLFKL---GWLSSMTK +>9601.ENSPPYP00000009641 +M-ATGATSPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---AQ-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVNVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPT-QAKSSAFDRYADAGTVQEMLRTQSVASIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYRVWSSAVVKVLIHGFTQSLLLD--AAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLFEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTAKADEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--IET-K-AQVVPPARSTA-G-DPT---V----PGSLF---R--QLISE-EDNTSAPSLFKL---GWLSSMTK +>9593.ENSGGOP00000014253 +-----------------------------------------------------------------------------------------------------------------------------PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTHEST-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVNVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPT-QAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPTQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--IET-K-AQVVPPARSTA-G-DPT---V----PGSLF---R--QLVSE-EDNTSAPSLFKL---GWLSSMTK +>9598.ENSPTRP00000016297 +M-ATAATSPSLK---RLDLRDPAALFETHGAEEIRGLERRVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---AQ-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQAVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVSVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPT-QAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--IET-K-AQVVPPARSTA-G-DPT---V----PGSLF---R--QLVSE-EDNTSAPSLFKL---GWLSSMTK +>9606.ENSP00000299886 +M-ATAATSPALK---RLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAVGL-VDAV--KATDQYCARLRQAG---SAAP---RP--PR---AQ-Q-PQQ-PSQEKF--YSMAAQIKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSS-SSRYSPVLSRFPILIRQVAAASHFRSTILHESKMLLKCQGVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQKLLNQP-HH-G--AGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITGQHP-AGKGTGVLQEE-MKLC-SWFKHLPASIVEFQPTLR-TLAHPISQEYLKDTLQKWIHMCNEDIKNGITNLLMYVKSMKGLAGIRDAMWELLTNEST-NHSWDVLCRRL-LEK--PLLFWEDMMQQLFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVSVANRGQF-ASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSL---PKDVSPT-QAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPA-REF---RALRKQGKVK-TQEIIPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLD--DAGSVLATATSWDELEIQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQVVAAYEKLSEEKQIKKEG-AFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQ----LAPRSS----T--FN--SQEPHNILPLASS---QIRFGLLPLSMTS----------------TRKAKST-RN--IET-K-AQVVPPARSTA-G-DPT---V----PGSLF---R--QLVSE-EDNTSAPSLFKL---GWLSSMTK +>6085.XP_002167371 +-------M--VS---LP---DVRLLFQTHSIEEINVIEKKIRGEIEKKKDDLRIMVGERYRDLINAADTIKDMESESSQ-VFGG--IKNIQNLCLSFHTSL-MSSCSS---K-------------TQS-PRDVAFY--SLATQMDLLVNTPEKIWNALDNHEYLNATQLYMFSHHIVNILVNDPK-P-NSQDVYASFPVLHHQWAAISHFKTSILKGAEYSLKDKTLPDKKLCESLCSLALLDNCSPRQVFATLLLARK-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- +>7757.ENSPMAP00000006833 +---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AGLTMKARGHTPMVQGLCAALDAKLRARIEDVAAYLPPAGPPAS---G-QAPLPQQDSAGFDRFADSGRVQETLQKESASCITALSACARGHLDASAQEGGGGDDEQRRHHLAIVLFVARLCRAIPELCPSLRLAILGAAGVTSPPEAVRP---LPRALAGEAR-SVPRGGRTTAWTELSEELGALSLRAYDAWSRNVAQVAVSEFGSTLRVE--SPGRVLGSTPNWEEIEIMEETESGGSVASKIHLPAQAQNAAQALLFGLGQAMGAVGAQAVPRVTRQALLEAVMDGVLTAYEARLQPAHARTAG-TTPMCQARALQLLFDLRFMHGVLAVRPEGTRGSSAAALCRIQAVVDDLESHVDPFDLDVFTPHLHLHLQRLLQRTNVLFGVLTGTERQ----HTGRPA----P--S---GPEAPSLLAMAAT---HARFALLPLPASS----------------LASQRRATPP--V-------RRGPATAQA-PGVDT--RP----PGALF---R--QLASH-DEGSQGSSLFKL---GWLSAITK +>7668.SPU_016633tr +----------MS---IADL-STNQLFEKYTIEEIRKLEKDTRDEIETKKEDLRQMVGERYRDLIEAADTITEMKTCSEK-IFQS--IQDMQKHCVNLQKTH-LTKGIS---L--SPK---KA--ASSR-SQSSGFY--AIASQTKLLLDIPEKIWSDIESGEHLHATQLYLLACHIVSSLQLDTT-THQSTQLLKWFPVLSRQWAAICHFKPSILQSCRNVLKNATASDMVITKALCSIMLLEDTSPRQVFTEFLLARKNAVHQAFSSSQ-F-D--ASVKKQVCGVTNLINLTLRQIHAIFYHQEGDE--NNDEEGNLLQKVLTEATSS----SDGKTVLADE-LAVG-TFSKHLPANITDFHPTLR-SSTDPIAAPYLQECVSQWVETCISDVHDGISKLLNYVTSIRGLTSIRDAVWDLLQED-D-VPALRNITKRV-LGR--SLCLWGEFVRPLFLSRMQAILQDALDQTLTNSHQLVIQASHDMESSP----------ADLDVAAHTWKEMSSDLPSPMAWRGGAGSRD-LDAGSLYMKARAFTPKTQSICSFIDVRLKSLLEDLSSYTDRQTDKQPSD---QKSASKSSQEPFDKFADTVNLHSFLQIACTKCVSRLADHIKEELSDCKLAQEEKLEDQSSVIINRVVFLGRLCSALTELSPHLQQAVLITEKKDSKG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DPL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- +>7668.SPU_013365tr +----------MS---IADL-STNQLFEKYTIEEIRKLEKDTRDEIETKKEDLRQMVGERYRDLIEAADTITEMKTCSEK-IFQS--IQDMQKHCVNLQKTH-LTKGIS---L--SPK---KA--ASSR-SQSSGFY--AIASQTKLLLDIPEKIWSDIESGEHLHATQLYLLACHIVSSLQLDTT-THQSTQLLKWFPVLSRQWAAICHFKPSILQSCRNVLKNATASDMVITKALCSIMLLEDTSPRQVFTEFLLARKVRSNDCLAPRL-T--------------------------------------------------------------------------------------------------------------------------------------------H-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SHYQ-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/example-tree-ncbi.tree Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,2 @@ +((6669.DappuP312785:1.24473,(((7739.JGI126010:4.02e-06,7739.JGI126021:0.168081)0.99985:0.848895,((45351.NEMVEDRAFT_v1g217973-PA:1.49614,(6085.XP_002167371:1.08059,10228.TriadP54105:1.08509)0.457684:0.128729)0.99985:0.321915,(7668.SPU_016633tr:0.00222941,7668.SPU_013365tr:0.093091)0.99985:0.642533)0.888302:0.101463)0.998565:0.12537,((51511.ENSCSAVP00000011400:0.259936,7719.ENSCINP00000035803:0.209259)0.99985:1.762,(7757.ENSPMAP00000006833:0.945887,((7955.ENSDARP00000103018:0.187989,(8049.ENSGMOP00000003903:0.283082,((8128.ENSONIP00000009923:0.172432,(69293.ENSGACP00000005927:0.11289,(99883.ENSTNIP00000008530:0.0637802,31033.ENSTRUP00000029741:0.0851327)0.99985:0.111539)0.750558:0.0140823)0.99985:0.0210439,(8083.ENSXMAP00000007211:0.156672,8090.ENSORLP00000021771:0.242897)0.99985:0.0332475)0.99985:0.0502247)0.99985:0.097906)0.99985:0.204816,(7897.ENSLACP00000021045:0.20103,(8364.ENSXETP00000053091:0.389689,((9258.ENSOANP00000015194:0.652603,((13616.ENSMODP00000032296:0.0669026,(9315.ENSMEUP00000005072:0.0368095,9305.ENSSHAP00000018667:0.0280404)0.997706:0.0140274)0.99985:0.109803,((9361.ENSDNOP00000011178:0.093465,(9371.ENSETEP00000005953:0.276816,(9813.ENSPCAP00000009886:0.0800451,9785.ENSLAFP00000023898:0.0550027)0.99697:0.0294647)0.99985:0.0375967)0.608183:0.00574174,((((30608.ENSMICP00000006810:0.0353003,30611.ENSOGAP00000013460:0.0515798)0.99985:0.034051,(9478.ENSTSYP00000011163:0.0656837,(9483.ENSCJAP00000037059:0.0556713,(9544.ENSMMUP00000001688:0.00821597,(61853.ENSNLEP00000001585:0.00543935,(9601.ENSPPYP00000009641:0.00544861,(9593.ENSGGOP00000014253:0.00241737,(9606.ENSP00000299886:0.00108745,9598.ENSPTRP00000016297:0.00216932)0.993995:0.00108247)0.99985:0.00217395)0.99985:0.00216928)0.99985:0.00380297)0.99985:0.00880979)0.99985:0.0259329)0.993631:0.00725957)0.99985:0.00775695,((((10141.ENSCPOP00000018381:0.0312261,10141.ENSCPOP00000003239:0.0560276)0.99985:0.131426,(10090.ENSMUSP00000018805:0.0326181,10116.ENSRNOP00000003804:0.0330137)0.99985:0.081468)0.995671:0.0105266,(43179.ENSSTOP00000001636:0.0584822,10020.ENSDORP00000002346:0.148367)0.976029:0.00712029)0.99985:0.020967,(9986.ENSOCUP00000010215:0.342444,37347.ENSTBEP00000010812:0.0710806)0.981559:0.0148504)0.99985:0.0111655)0.99985:0.0141806,((9823.ENSSSCP00000018275:0.0497089,(9739.ENSTTRP00000004916:0.0624029,9913.ENSBTAP00000007999:0.0933538)0.99985:0.0153799)0.99985:0.0353429,((9796.ENSECAP00000006507:0.0593149,(9685.ENSFCAP00000004377:0.0895056,(9615.ENSCAFP00000006718:0.0344248,(9646.ENSAMEP00000002816:0.0246918,9669.ENSMPUP00000014182:0.157245)0.979337:0.0106908)0.990824:0.00781435)0.99985:0.0209773)0.99291:0.00461526,(59463.ENSMLUP00000015199:0.175449,132908.ENSPVAP00000006353:0.0636063)0.828177:0.00861023)0.805512:0.00313751)0.99985:0.0138134)0.99985:0.0180555)0.99985:0.0925821)0.99985:0.0504324)0.99985:0.0408666,(28377.ENSACAP00000014302:0.2972,(13735.ENSPSIP00000020553:0.125656,(59729.ENSTGUP00000002997:0.21101,(9103.ENSMGAP00000006649:0.034221,9031.ENSGALP00000007041:0.0301602)0.99985:0.14558)0.99985:0.0950631)0.912514:0.0193477)0.99985:0.0543705)0.99985:0.0558399)0.99985:0.0851946)0.996306:0.0767894)0.99985:0.242292)0.99843:0.214734)0.760404:0.170331)0.99985:0.889243)0.99985:0.309174,((7070.TC009561-PA:1.414,(7029.ACYPI001869-PA:2.67503,((34740.HMEL012959-PA:0.216556,(13037.EHJ66433:0.30242,7091.BGIBMGA012450-TA:0.234676)0.691542:0.0356537)0.99985:1.06833,(7425.NV10250-PA:0.448078,(7460.GB18353-PA:0.265179,12957.ACEP_00009457-PA:0.219522)0.99985:0.223062)0.99985:0.715703)0.950323:0.0960579)0.630765:0.0828761)0.868488:0.104171,(121225.PHUM413450-PA:1.38201,(((43151.ADAR004533-PA:0.286189,7165.AGAP001322-PA:0.216522)0.99985:0.404262,(7176.CPIJ007948-PA:0.310705,7159.AAEL007141-PA:0.261808)0.99985:0.238196)0.99985:0.352684,(7260.FBpp0240708:0.24283,((7222.FBpp0149372:0.191481,7244.FBpp0224481:0.114954)0.99985:0.156407,(7237.FBpp0281462:0.118908,(7217.FBpp0120932:0.132407,(7245.FBpp0269552:0.0320153,7227.FBpp0082093:0.0340969)0.99985:0.0854297)0.99985:0.0800303)0.99985:0.0655239)0.825983:0.0710402)0.99985:1.14395)0.99985:0.708932)0.628915:0.0819834)0.99985:0.309174); +
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/minimal-tree-out.svg Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,476 @@ +<?xml version="1.0" encoding="UTF-8" standalone="no"?> +<svg xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" width="150.636mm" height="146.756mm" viewBox="0 0 427.497 416" version="1.2" baseProfile="tiny"> + <title>Generated with ETE http://ete.cgenomics.org</title> + <desc>Generated with ETE http://ete.cgenomics.org</desc> + <defs> </defs> + <g fill="none" stroke="black" stroke-width="1" fill-rule="evenodd" stroke-linecap="square" stroke-linejoin="bevel"> + <g fill="none" stroke="none" transform="matrix(1,0,0,1,0,0)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L427.497,0 L427.497,416 L0,416 L0,0"/> + </g> + <g fill="none" stroke="none" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L425.497,0 L425.497,364 L0,364 L0,0"/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,142.895)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.5,17.375 6.5,287.414 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,152.395 6,152.395 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,8.375)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">19</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,6 12.5,29.75 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.0253,17.875 12,17.875 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,17.875 6.0253,17.875 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,149.644,1)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre09.g393654.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 128.644,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,30.4169,19.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">64</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,14)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="21.9169,6 21.9169,26.5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,14)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,16.25 21.4169,16.25 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,128.407,14)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0001s1384.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,14)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 84.9896,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,51.1205,29.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">71</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,27)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="20.2036,6 20.2036,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,27)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 19.7036,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,106.041,27)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">GONPE_KXZ41109.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,64.1205,27)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 41.9201,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,126.672,40)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre01.g010750.t1.2</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,64.1205,40)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 62.5518,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8.63925,108.719)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">6</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="7.13925,22.25 7.13925,110.188 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,66.2188 6.63925,66.2188 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,65.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">12</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,6 12.5,39.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.73974,22.75 12,22.75 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,22.75 5.73974,22.75 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,150.095,53)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0020s0165.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,53)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 121.455,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,81.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">17</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,12.5 12.5,39.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.23287,26 12,26 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,26 5.23287,26 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,48.2506,68.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">51</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.1113,6 19.1113,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 18.6113,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,152.344,66)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0003s0509.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,61.2506,66)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 91.0934,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,152.787,79)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre09.g393284.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,61.2506,79)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 91.536,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,94.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">28</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,92)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,6 12.5,20 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,92)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.95337,13 12,13 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,92)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 6.95337,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,135.617,92)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0008s0105.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,54.6393,92)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 80.9775,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,143.298,105)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0003s0512.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,54.6393,105)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 88.659,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,152.188)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">14</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,15.75 12.5,73.625 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="9.5591,44.6875 12,44.6875 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,44.6875 9.5591,44.6875 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,123.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">24</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,6 12.5,26.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="9.2307,16.25 12,16.25 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,16.25 9.2307,16.25 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,139.85,118)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0021s0041.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,118)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 98.211,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.753,133.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">53</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,131)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="14.6138,6 14.6138,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,131)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 14.1138,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,169.749,131)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0021s0042.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.753,131)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 112.996,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,111.73,144)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0021s0043.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.753,144)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 54.9773,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,180.625)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">23</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,22.25 12.5,46 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="7.28176,34.125 12,34.125 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,34.125 7.28176,34.125 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,42.982,169.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">47</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="13.8428,12.5 13.8428,33 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,22.75 13.3428,22.75 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,70.5247,159.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">72</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="27.0427,6 27.0427,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 26.5427,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,151.574,157)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">GONPE_KXZ50986.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,83.5247,157)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 68.0488,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,158.256,170)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre17.g738632.t1.2</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,83.5247,170)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 74.7309,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,124.63,183)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0026s0121.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,183)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 68.6484,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,125.851,196)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre17.g709800.t1.2</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 84.2114,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,277.414)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">9</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.5,30.375 6.5,127.453 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.09009,78.9141 6,78.9141 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,78.9141 5.09009,78.9141 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,229.375)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">16</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,15.75 12.5,46 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="8.65245,30.875 12,30.875 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,30.875 8.65245,30.875 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,214.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">35</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,6 12.5,26.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.76062,16.25 12,16.25 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,16.25 6.76062,16.25 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,196.558,209)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre06.g302150.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,209)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 155.558,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,75.5319,224.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">96</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,222)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="47.0319,6 47.0319,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,222)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 46.5319,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,271.497,222)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre15.g643700.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,88.5319,222)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 182.965,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,256.027,235)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre17.g738600.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,88.5319,235)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 167.495,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,126.789,248)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre06.g304250.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,248)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 98.7892,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21.8112,325.453)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">49</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.3112,51.9062 19.3112,98 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,74.9531 18.8112,74.9531 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,302.906)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">51</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,26.3125 12.5,78.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="8.28122,52.4062 12,52.4062 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,52.4062 8.28122,52.4062 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.3858,277.312)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">74</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="21.0745,6 21.0745,47.625 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,26.8125 20.5745,26.8125 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,160.286,261)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0024s0053.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,261)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 90.9007,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,297.625)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">18</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,22.25 12.5,46 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="2.74851,34.125 12,34.125 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,34.125 2.74851,34.125 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,85.8131,286.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">47</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="15.9273,12.5 15.9273,33 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,22.75 15.4273,22.75 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,106.124,276.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">79</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.8109,6 19.8109,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 19.3109,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,167.077,274)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">GONPE_KXZ51696.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,119.124,274)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 47.9525,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,174.637,287)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">GONPE_KXZ51697.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,119.124,287)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 55.5127,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,170.032,300)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">GONPE_KXZ54016.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,300)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 71.2185,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,182.931,313)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">VOLCA_Vocar.0024s0052.1.p</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,313)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 100.545,6.5 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,49.7108,328.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">56</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,326)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="14.3996,6 14.3996,20 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,326)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,13 13.8996,13 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,148.743,326)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre14.g617151.t1.2</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,62.7108,326)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 86.0319,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,143.074,339)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre14.g617200.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,62.7108,339)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 80.3635,6.5 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,123.542,352)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">CHLRE_Cre10.g418600.t1.1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,352)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,6.5 88.7304,6.5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,5 50,5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,0 0,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="50,0 50,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <text fill="#000000" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="11" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal">0.07</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,5 50,5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,0 0,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,366)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="50,0 50,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <text fill="#000000" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="11" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal">0.07</text> + </g> + </g> +</svg>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/quicktree_VARL_NCBI.svg Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,1736 @@ +<?xml version="1.0" encoding="UTF-8" standalone="no"?> +<svg xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" width="486.833mm" height="166.511mm" viewBox="0 0 1380.5 472" version="1.2" baseProfile="tiny"> + <title>Generated with ETE http://ete.cgenomics.org</title> + <desc>Generated with ETE http://ete.cgenomics.org</desc> + <defs> </defs> + <g fill="none" stroke="black" stroke-width="1" fill-rule="evenodd" stroke-linecap="square" stroke-linejoin="bevel"> + <g fill="none" stroke="none" transform="matrix(1,0,0,1,0,0)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L1380.5,0 L1380.5,472 L0,472 L0,0"/> + </g> + <g fill="none" stroke="none" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L1378.5,0 L1378.5,420 L0,420 L0,0"/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,166.34)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">1</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.5,20.125 6.5,331.555 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,175.84 6,175.84 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,11.125)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">19</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,7 12.5,34.25 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.0253,20.625 12,20.625 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,20.625 6.0253,20.625 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,149.644,2)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,306.644,1)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre09.g393654.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 128.644,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,1)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,1)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,30.4169,24.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">64</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="21.9169,7 21.9169,30.5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,18.75 21.4169,18.75 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,128.407,17)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,204.407,16)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0001s1384.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 84.9896,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,16)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,16)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,51.1205,35.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">71</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="20.2036,7 20.2036,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.4169,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 19.7036,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,106.041,32)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Gonium pectorale</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,207.041,31)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(33097.GONPE_KXZ41109.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,64.1205,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 41.9201,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#4652b8" fill-opacity="1" stroke="#4652b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,31)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L48,0 L48,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,31)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">gonium</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,126.672,47)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,283.672,46)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre01.g010750.t1.2)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,64.1205,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 62.5518,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,46)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,46)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8.63925,126.906)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">6</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="7.13925,25.75 7.13925,127.062 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,76.4062 6.63925,76.4062 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,76.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">12</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,7 12.5,45.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.73974,26.25 12,26.25 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,26.25 5.73974,26.25 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,150.095,62)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,226.095,61)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0020s0165.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 121.455,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,61)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,61)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,95.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">17</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,14.5 12.5,45.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.23287,30 12,30 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,30 5.23287,30 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,48.2506,80.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">51</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.1113,7 19.1113,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 18.6113,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,152.344,77)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,228.344,76)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0003s0509.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,61.2506,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 91.0934,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,76)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,76)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,152.787,92)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,309.787,91)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre09.g393284.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,61.2506,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 91.536,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,91)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,91)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,110.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">28</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,7 12.5,23 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.95337,15 12,15 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 6.95337,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,135.617,107)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,211.617,106)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0008s0105.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,54.6393,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 80.9775,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,106)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,106)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,143.298,122)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,219.298,121)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0003s0512.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,54.6393,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 88.659,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,121)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,121)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,177.062)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">14</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,18.25 12.5,84.875 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="9.5591,51.5625 12,51.5625 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,51.5625 9.5591,51.5625 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,144.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">24</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,7 12.5,30.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="9.2307,18.75 12,18.75 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,18.75 9.2307,18.75 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,139.85,137)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,215.85,136)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0021s0041.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 98.211,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,136)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,136)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,43.753,155.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">53</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="14.6138,7 14.6138,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 14.1138,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,169.749,152)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,245.749,151)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0021s0042.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.753,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 112.996,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,151)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,151)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,111.73,167)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,187.73,166)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0021s0043.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.753,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 54.9773,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,166)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,166)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,209.875)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">23</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,25.75 12.5,53 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="7.28176,39.375 12,39.375 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28.6393,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,39.375 7.28176,39.375 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,42.982,196.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">47</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="13.8428,14.5 13.8428,38 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,26.25 13.3428,26.25 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,70.5247,185.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">72</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="27.0427,7 27.0427,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 26.5427,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,151.574,182)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Gonium pectorale</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,252.574,181)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(33097.GONPE_KXZ50986.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,83.5247,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 68.0488,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#4652b8" fill-opacity="1" stroke="#4652b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,181)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L48,0 L48,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,181)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">gonium</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,158.256,197)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,315.256,196)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre17.g738632.t1.2)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,83.5247,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 74.7309,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,196)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,196)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,124.63,212)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,200.63,211)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0026s0121.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,55.982,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 68.6484,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,211)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,211)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,125.851,227)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,282.851,226)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre17.g709800.t1.2)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41.6393,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 84.2114,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,226)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,226)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,321.555)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">9</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.5,35.125 6.5,146.984 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="5.09009,91.0547 6,91.0547 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,8,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,91.0547 5.09009,91.0547 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,266.125)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">16</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,18.25 12.5,53 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="8.65245,35.625 12,35.625 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,35.625 8.65245,35.625 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,249.25)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">35</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,7 12.5,30.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="6.76062,18.75 12,18.75 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,18.75 6.76062,18.75 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,196.558,242)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,353.558,241)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre06.g302150.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 155.558,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,241)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,241)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,75.5319,260.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">96</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="47.0319,7 47.0319,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,41,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 46.5319,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,271.497,257)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,428.497,256)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre15.g643700.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,88.5319,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 182.965,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,256)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,256)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,256.027,272)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,413.027,271)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre17.g738600.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,88.5319,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 167.495,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,271)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,271)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,126.789,287)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,283.789,286)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre06.g304250.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,28,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 98.7892,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,286)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,286)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,21.8112,376.984)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">49</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.3112,59.9688 19.3112,113 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,15,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,86.4844 18.8112,86.4844 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,350.969)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">51</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,30.4375 12.5,90.5 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="8.28122,60.4688 12,60.4688 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,60.4688 8.28122,60.4688 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,56.3858,321.438)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">74</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="21.0745,7 21.0745,54.875 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,30.9375 20.5745,30.9375 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,160.286,302)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,236.286,301)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0024s0053.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 90.9007,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,301)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,301)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,344.875)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">18</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="12.5,25.75 12.5,53 "/> + </g> + <g fill="none" stroke="#808080" stroke-opacity="1" stroke-dasharray="1,2" stroke-dashoffset="0" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="2.74851,39.375 12,39.375 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,69.3858,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,39.375 2.74851,39.375 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,85.8131,331.75)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">47</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="15.9273,14.5 15.9273,38 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,26.25 15.4273,26.25 "/> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,106.124,320.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">79</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="19.8109,7 19.8109,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 19.3109,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,167.077,317)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Gonium pectorale</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,268.077,316)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(33097.GONPE_KXZ51696.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,119.124,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 47.9525,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#4652b8" fill-opacity="1" stroke="#4652b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,316)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L48,0 L48,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,316)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">gonium</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,174.637,332)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Gonium pectorale</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,275.637,331)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(33097.GONPE_KXZ51697.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,119.124,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 55.5127,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#4652b8" fill-opacity="1" stroke="#4652b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,331)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L48,0 L48,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,331)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">gonium</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,170.032,347)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Gonium pectorale</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,271.032,346)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(33097.GONPE_KXZ54016.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,98.8131,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 71.2185,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#4652b8" fill-opacity="1" stroke="#4652b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,346)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L48,0 L48,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,346)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">gonium</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,182.931,362)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Volvox carteri</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,258.931,361)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3067.VOLCA_Vocar.0024s0052.1.p)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,82.3858,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 100.545,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#b84670" fill-opacity="1" stroke="#b84670" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L79,0 L79,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvocaceae</text> + </g> + <g fill="#b84659" fill-opacity="1" stroke="#b84659" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,361)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L40,0 L40,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1204.5,361)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">volvox</text> + </g> + <g fill="none" stroke="#cd5c5c" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,49.7108,380.5)" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal"> + <text fill="#cd5c5c" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="8" font-family="Verdana" font-size="7pt" font-weight="400" font-style="normal">56</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="14.3996,7 14.3996,23 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,47.8112,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,15 13.8996,15 "/> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,148.743,377)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,305.743,376)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre14.g617151.t1.2)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,62.7108,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 86.0319,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,376)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,376)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,143.074,392)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,300.074,391)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre14.g617200.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,62.7108,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 80.3635,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,391)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,391)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#777777" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,123.542,407)" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal"> + <text fill="#777777" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="10" font-family="Helvetica" font-size="8pt" font-weight="400" font-style="normal">Chlamydomonas reinhardtii</text> + </g> + <g fill="none" stroke="#444444" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,280.542,406)" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic"> + <text fill="#444444" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Helvetica" font-size="10pt" font-weight="400" font-style="italic">(3055.CHLRE_Cre10.g418600.t1.1)</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="butt" stroke-linejoin="bevel" transform="matrix(1,0,0,1,34.8112,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="-1,7.5 88.7304,7.5 "/> + </g> + <g fill="#4695b8" fill-opacity="1" stroke="#4695b8" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L64,0 L64,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,653.497,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">eukaryota</text> + </g> + <g fill="#b84686" fill-opacity="1" stroke="#b84686" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L77,0 L77,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,722.497,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">viridiplantae</text> + </g> + <g fill="#46b89a" fill-opacity="1" stroke="#46b89a" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L75,0 L75,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,804.497,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyta</text> + </g> + <g fill="#46b883" fill-opacity="1" stroke="#46b883" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L93,0 L93,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,884.497,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlorophyceae</text> + </g> + <g fill="#46b857" fill-opacity="1" stroke="#46b857" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L133,0 L133,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,982.497,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadales</text> + </g> + <g fill="#4bb846" fill-opacity="1" stroke="#4bb846" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L146,0 L146,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1120.5,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonadaceae</text> + </g> + <g fill="#46b86d" fill-opacity="1" stroke="#46b86d" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,406)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <path vector-effect="non-scaling-stroke" fill-rule="evenodd" d="M0,0 L106,0 L106,15 L0,15 L0,0"/> + </g> + <g fill="none" stroke="#ffffff" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1271.5,406)" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal"> + <text fill="#ffffff" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="12" font-family="Arial" font-size="10pt" font-weight="400" font-style="normal">chlamydomonas</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,5 50,5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,0 0,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="50,0 50,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,432)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <text fill="#000000" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="11" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal">0.07</text> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,5 50,5 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="0,0 0,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,422)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <polyline fill="none" vector-effect="none" points="50,0 50,10 "/> + </g> + <g fill="none" stroke="#000000" stroke-opacity="1" stroke-width="1" stroke-linecap="square" stroke-linejoin="bevel" transform="matrix(1,0,0,1,1,432)" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal"> + <text fill="#000000" fill-opacity="1" stroke="none" xml:space="preserve" x="0" y="11" font-family="Sans Serif" font-size="9pt" font-weight="400" font-style="normal">0.07</text> + </g> + </g> +</svg>
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/quicktree_alignment_VARL.tre Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,79 @@ +( +( +CHLRE_Cre09.g393654.t1.1:0.18020, +( +VOLCA_Vocar.0001s1384.1.p:0.11905, +( +GONPE_KXZ41109.1:0.05872, +CHLRE_Cre01.g010750.t1.2:0.08762) +71:0.02760) +64:0.03000) +19:0.00844, +( +( +VOLCA_Vocar.0020s0165.1.p:0.17013, +( +( +VOLCA_Vocar.0003s0509.1.p:0.12760, +CHLRE_Cre09.g393284.t1.1:0.12822) +51:0.02607, +( +VOLCA_Vocar.0008s0105.1.p:0.11343, +VOLCA_Vocar.0003s0512.1.p:0.12419) +28:0.00974) +17:0.00733) +12:0.00804, +( +( +VOLCA_Vocar.0021s0041.1.p:0.13757, +( +VOLCA_Vocar.0021s0042.1.p:0.15828, +VOLCA_Vocar.0021s0043.1.p:0.07701) +53:0.01977) +24:0.01293, +( +( +( +GONPE_KXZ50986.1:0.09532, +CHLRE_Cre17.g738632.t1.2:0.10468) +72:0.03718, +VOLCA_Vocar.0026s0121.1.p:0.09616) +47:0.01869, +CHLRE_Cre17.g709800.t1.2:0.11796) +23:0.01020) +14:0.01339) +6:0.00930, +( +( +( +CHLRE_Cre06.g302150.t1.1:0.21790, +( +CHLRE_Cre15.g643700.t1.1:0.25629, +CHLRE_Cre17.g738600.t1.1:0.23462) +96:0.06518) +35:0.00947, +CHLRE_Cre06.g304250.t1.1:0.13838) +16:0.01212, +( +( +( +VOLCA_Vocar.0024s0053.1.p:0.12733, +( +( +( +GONPE_KXZ51696.1:0.06717, +GONPE_KXZ51697.1:0.07776) +79:0.02705, +GONPE_KXZ54016.1:0.09976) +47:0.02161, +VOLCA_Vocar.0024s0052.1.p:0.14084) +18:0.00385) +74:0.02882, +( +CHLRE_Cre14.g617151.t1.2:0.12051, +CHLRE_Cre14.g617200.t1.1:0.11257) +56:0.01947) +51:0.01160, +CHLRE_Cre10.g418600.t1.1:0.12429) +49:0.02635) +9:0.00713);
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/quicktree_alignment_VARL_NCBI.tre Tue Dec 10 09:55:15 2024 +0000 @@ -0,0 +1,79 @@ +( +( +3055.CHLRE_Cre09.g393654.t1.1:0.18020, +( +3067.VOLCA_Vocar.0001s1384.1.p:0.11905, +( +33097.GONPE_KXZ41109.1:0.05872, +3055.CHLRE_Cre01.g010750.t1.2:0.08762) +71:0.02760) +64:0.03000) +19:0.00844, +( +( +3067.VOLCA_Vocar.0020s0165.1.p:0.17013, +( +( +3067.VOLCA_Vocar.0003s0509.1.p:0.12760, +3055.CHLRE_Cre09.g393284.t1.1:0.12822) +51:0.02607, +( +3067.VOLCA_Vocar.0008s0105.1.p:0.11343, +3067.VOLCA_Vocar.0003s0512.1.p:0.12419) +28:0.00974) +17:0.00733) +12:0.00804, +( +( +3067.VOLCA_Vocar.0021s0041.1.p:0.13757, +( +3067.VOLCA_Vocar.0021s0042.1.p:0.15828, +3067.VOLCA_Vocar.0021s0043.1.p:0.07701) +53:0.01977) +24:0.01293, +( +( +( +33097.GONPE_KXZ50986.1:0.09532, +3055.CHLRE_Cre17.g738632.t1.2:0.10468) +72:0.03718, +3067.VOLCA_Vocar.0026s0121.1.p:0.09616) +47:0.01869, +3055.CHLRE_Cre17.g709800.t1.2:0.11796) +23:0.01020) +14:0.01339) +6:0.00930, +( +( +( +3055.CHLRE_Cre06.g302150.t1.1:0.21790, +( +3055.CHLRE_Cre15.g643700.t1.1:0.25629, +3055.CHLRE_Cre17.g738600.t1.1:0.23462) +96:0.06518) +35:0.00947, +3055.CHLRE_Cre06.g304250.t1.1:0.13838) +16:0.01212, +( +( +( +3067.VOLCA_Vocar.0024s0053.1.p:0.12733, +( +( +( +33097.GONPE_KXZ51696.1:0.06717, +33097.GONPE_KXZ51697.1:0.07776) +79:0.02705, +33097.GONPE_KXZ54016.1:0.09976) +47:0.02161, +3067.VOLCA_Vocar.0024s0052.1.p:0.14084) +18:0.00385) +74:0.02882, +( +3055.CHLRE_Cre14.g617151.t1.2:0.12051, +3055.CHLRE_Cre14.g617200.t1.1:0.11257) +56:0.01947) +51:0.01160, +3055.CHLRE_Cre10.g418600.t1.1:0.12429) +49:0.02635) +9:0.00713);
