annotate test-data/jackhmmer.out @ 5:5113c71c7031 draft

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
author iuc
date Tue, 16 Jun 2020 05:32:33 -0400
parents 793967b6ae8a
children 6e27bb3f0fa6
Ignore whitespace changes - Everywhere: Within whitespace: At end of lines:
rev   line source
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1 # jackhmmer :: iteratively search a protein sequence against a protein database
5
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
2 # HMMER 3.3 (Nov 2019); http://hmmer.org/
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
3 # Copyright (C) 2019 Howard Hughes Medical Institute.
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
4 # Freely distributed under the BSD open source license.
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
5
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
6 # query sequence file: /tmp/tmpfvu1k4r6/files/5/c/1/dataset_5c1435bb-ab6c-4203-863c-578c4a331ea1.dat
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
7 # target sequence database: /tmp/tmpfvu1k4r6/files/0/c/2/dataset_0c23de62-c430-473e-92ee-a18da9f58231.dat
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
8 # max ASCII text line length: unlimited
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
9 # Vit filter P threshold: <= 0.001
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
10 # Fwd filter P threshold: <= 1e-05
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
11 # random number seed set to: 4
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
12 # number of worker threads: 1
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
13 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
14
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
15 Query: sp|P02185|MYG_PHYCD [L=154]
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
16 Description: Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
17
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
18 Scores for complete sequences (score includes all domains):
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
19 --- full sequence --- --- best 1 domain --- -#dom-
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
20 E-value score bias E-value score bias exp N Sequence Description
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
21 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
22 + 3.7e-96 310.8 5.1 4.1e-96 310.7 5.1 1.0 1 MYG_ESCGI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
23 + 1.2e-91 296.2 4.6 1.4e-91 296.0 4.6 1.0 1 MYG_HORSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
24 + 1e-86 280.2 3.1 1.1e-86 280.0 3.1 1.0 1 MYG_PROGU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
25 + 8.4e-86 277.2 4.7 9.3e-86 277.1 4.7 1.0 1 MYG_SAISC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
26 + 1.4e-84 273.3 4.0 1.5e-84 273.1 4.0 1.0 1 MYG_LYCPI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
27 + 7.4e-84 270.9 1.8 8.1e-84 270.8 1.8 1.0 1 MYG_MOUSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
28 + 2.3e-34 110.3 0.0 2.6e-34 110.2 0.0 1.0 1 MYG_MUSAN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
29 + 6.6e-17 53.7 0.0 7.5e-17 53.5 0.0 1.0 1 HBAZ_HORSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
30 + 2.4e-14 45.4 0.0 2.8e-14 45.2 0.0 1.0 1 HBB_COLLI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
31 + 1.3e-13 43.0 0.0 1.5e-13 42.7 0.0 1.0 1 HBB_LARRI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
32 + 1.9e-12 39.2 0.1 2.3e-12 38.9 0.1 1.1 1 HBB2_XENTR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
33 + 3.1e-12 38.5 0.1 3.3e-12 38.5 0.1 1.0 1 HBB_ORNAN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
34 + 6.5e-12 37.5 0.3 6.9e-12 37.4 0.3 1.0 1 HBB_TRIIN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
35 + 8.4e-12 37.1 0.1 9.5e-12 36.9 0.1 1.0 1 HBE_PONPY
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
36 + 1.1e-11 36.8 0.1 1.3e-11 36.6 0.1 1.0 1 HBB1_VAREX
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
37 + 2.2e-11 35.8 0.5 2.4e-11 35.6 0.5 1.0 1 HBB_SPECI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
38 + 8.4e-11 33.9 0.2 8.9e-11 33.8 0.2 1.0 1 HBB_SPETO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
39 + 1.1e-10 33.4 0.2 1.2e-10 33.3 0.2 1.0 1 HBB_TACAC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
40 + 1.3e-10 33.3 0.0 1.4e-10 33.1 0.0 1.0 1 HBAD_PASMO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
41 + 1.4e-10 33.1 0.1 1.5e-10 33.1 0.1 1.0 1 HBB_SUNMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
42 + 2.8e-10 32.2 0.1 3e-10 32.1 0.1 1.1 1 HBA_ERIEU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
43 + 6e-10 31.1 0.6 6.7e-10 31.0 0.6 1.1 1 HBA2_BOSMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
44 + 6.1e-10 31.1 0.1 6.9e-10 30.9 0.1 1.1 1 HBAD_CHLME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
45 + 6.6e-10 31.0 0.1 7e-10 30.9 0.1 1.0 1 HBB_URSMA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
46 + 7.7e-10 30.7 0.2 9.5e-10 30.5 0.2 1.1 1 HBBL_RANCA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
47 + 8.5e-10 30.6 0.2 9e-10 30.5 0.2 1.0 1 HBB_EQUHE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
48 + 2.2e-09 29.3 0.2 2.4e-09 29.1 0.2 1.1 1 HBA_AILME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
49 + 3.1e-09 28.8 0.0 3.3e-09 28.7 0.0 1.0 1 HBB_TUPGL
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
50 + 4.6e-09 28.2 0.1 5.4e-09 28.0 0.1 1.0 1 HBA4_SALIR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
51 + 4.8e-09 28.2 0.2 5.4e-09 28.0 0.2 1.1 1 HBA2_GALCR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
52 + 7.5e-09 27.6 0.4 8.2e-09 27.4 0.4 1.1 1 HBA_MESAU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
53 + 9.2e-09 27.3 0.1 1.1e-08 27.1 0.1 1.0 1 HBB_MANSP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
54 + 1.1e-08 27.0 0.3 1.2e-08 26.9 0.3 1.1 1 HBA_PONPY
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
55 + 1.1e-08 27.0 0.2 1.3e-08 26.8 0.2 1.1 1 HBA_PAGLA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
56 + 1.2e-08 26.9 0.2 1.3e-08 26.7 0.2 1.1 1 HBA_ANSSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
57 + 2.5e-08 25.8 0.3 2.7e-08 25.7 0.3 1.0 1 HBB_RABIT
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
58 + 3.9e-08 25.2 0.1 4.2e-08 25.1 0.1 1.1 1 HBA_PROLO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
59 + 4e-08 25.2 0.3 4.5e-08 25.0 0.3 1.1 1 HBA_MACSI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
60 + 5.3e-08 24.8 0.4 6e-08 24.6 0.4 1.1 1 HBA_MACFA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
61 + 8.9e-08 24.1 0.1 1e-07 23.8 0.1 1.0 1 HBB_CALAR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
62 + 2.3e-07 22.7 0.2 2.6e-07 22.5 0.2 1.1 1 HBA_TRIOC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
63 + 2.5e-07 22.6 0.3 2.9e-07 22.4 0.3 1.1 1 HBA_FRAPO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
64 + 3.9e-07 22.0 0.3 4.4e-07 21.8 0.3 1.1 1 HBA_PHACO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
65 + 1.7e-05 16.6 0.2 1.9e-05 16.5 0.2 1.1 1 HBA_COLLI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
66
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
67
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
68 Domain annotation for each sequence (and alignments):
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
69 >> MYG_ESCGI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
70 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
71 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
72 1 ! 310.7 5.1 4e-96 4.1e-96 2 154 .] 1 153 [] 1 153 [] 1.00
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
73
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
74 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
75 == domain 1 score: 310.7 bits; conditional E-value: 4e-96
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
76 sp|P02185|MYG_PHYCD 2 vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
77 vls++ewqlvl++wakveadvaghgqdilirlfk hpetlekfd+fkhlkteaemkasedlkkhg tvltalg ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhsrhpgdfgadaq+amnkalelfrkdiaakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
78 MYG_ESCGI 1 VLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
79 79******************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
80
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
81 >> MYG_HORSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
82 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
83 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
84 1 ! 296.0 4.6 1.3e-91 1.4e-91 3 154 .] 2 153 .] 1 153 [] 0.99
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
85
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
86 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
87 == domain 1 score: 296.0 bits; conditional E-value: 1.3e-91
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
88 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
89 ls+gewq vl+vw kvead+aghgq++lirlf hpetlekfd+fkhlkteaemkasedlkkhg vltalg ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhs+hpg+fgadaqgam kalelfr diaakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
90 MYG_HORSE 2 LSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
91 89*****************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
92
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
93 >> MYG_PROGU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
94 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
95 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
96 1 ! 280.0 3.1 1.1e-86 1.1e-86 3 154 .] 2 153 .] 1 153 [] 0.99
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
97
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
98 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
99 == domain 1 score: 280.0 bits; conditional E-value: 1.1e-86
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
100 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
101 ls+gewqlvl+vw kve d++ghgq++lirlfk hpetlekfd+fkhlk e em+ase+lkkhg tvltalg ilkkkg+h ael plaqshatkhkip+kylefiseaii+vl+s+hpgdfgadaqgam+kalelfr diaakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
102 MYG_PROGU 2 LSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
103 89*****************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
104
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
105 >> MYG_SAISC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
106 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
107 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
108 1 ! 277.1 4.7 9e-86 9.3e-86 3 154 .] 2 153 .] 1 153 [] 0.99
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
109
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
110 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
111 == domain 1 score: 277.1 bits; conditional E-value: 9e-86
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
112 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
113 ls+gewqlvl++w kvead+ +hgq++li lfk hpetlekfd+fkhlk+e emkase+lkkhg tvltalg ilkkkg+heaelkplaqshatkhkip+kyle+is+ai+hvl+ +hpgdfgadaqgam kalelfr d+aakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
114 MYG_SAISC 2 LSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
115 89*****************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
116
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
117 >> MYG_LYCPI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
118 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
119 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
120 1 ! 273.1 4.0 1.5e-84 1.5e-84 3 154 .] 2 153 .] 1 153 [] 0.99
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
121
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
122 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
123 == domain 1 score: 273.1 bits; conditional E-value: 1.5e-84
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
124 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
125 ls+gewq+vl++w kve d+aghgq++lirlfk+hpetl+kfd+fkhlkte emk sedlkkhg tvltalg ilkkkghheaelkplaqshatkhkip+kylefis+aii+vl+++h gdf ad ++am kalelfr diaakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
126 MYG_LYCPI 2 LSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
127 89*****************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
128
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
129 >> MYG_MOUSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
130 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
131 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
132 1 ! 270.8 1.8 7.9e-84 8.1e-84 3 154 .] 2 153 .] 1 153 [] 0.99
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
133
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
134 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
135 == domain 1 score: 270.8 bits; conditional E-value: 7.9e-84
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
136 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
137 ls+gewqlvl+vw kvead+aghgq++li lfk+hpetl+kfd+fk+lk+e +mk sedlkkhg tvltalg ilkkkg+h ae++plaqshatkhkip+kylefise ii+vl rh gdfgadaqgam+kalelfr diaakykelg+qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
138 MYG_MOUSE 2 LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
139 89*****************************************************************************************************************************************************8 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
141 >> MYG_MUSAN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
142 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
143 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
144 1 ! 110.2 0.0 2.5e-34 2.6e-34 7 154 .] 2 148 .] 1 148 [] 0.98
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
146 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
147 == domain 1 score: 110.2 bits; conditional E-value: 2.5e-34
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
148 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
149 +w+ v vw+ ve+d+ + gq+il+rlf+ +pe+ f +fk+ k+ e+k + d+k ++ tvl+alg i+kkkg h +k la +h t hkip y+ i+ + vl +p++++a q+a++ a++++ di +yk ++qg
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
150 MYG_MUSAN 2 DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEYKAANFQG 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
151 7*****************************************8.7889************************************************************************************************9998 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
152
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
153 >> HBAZ_HORSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
154 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
155 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
156 1 ! 53.5 0.0 7.3e-17 7.5e-17 3 148 .. 2 141 .] 1 141 [] 0.91
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
157
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
158 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
159 == domain 1 score: 53.5 bits; conditional E-value: 7.3e-17
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
160 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
161 l+++e +v+ +w k+ + g + l rlf s+p+t f +f + s l+ hg v a+g +k + l l++ ha ++ ++f+s ++ l sr p+df ada +a +k l + + ky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
162 HBAZ_HORSE 2 LTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDL------HEGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
163 56788899********9999999***************988877752......3578899*********************************99999777789*******************************99998888885 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
164
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
165 >> HBB_COLLI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
166 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
167 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
168 1 ! 45.2 0.0 2.7e-14 2.8e-14 6 147 .. 6 145 .. 2 146 .] 0.95
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
169
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
170 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
171 == domain 1 score: 45.2 bits; conditional E-value: 2.7e-14
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
172 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
173 e ql+ +w kv +va g + l rl+ +p t f f +l + + + ++k hg vlt++g +k + + + l++ h k + + + ++ + ++ +l ++ df + q+a k + + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
174 HBB_COLLI 6 EEKQLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
175 5889********8..589999***********************************************************************999999999*******999999999**************99999999998 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
176
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
177 >> HBB_LARRI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
178 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
179 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
180 1 ! 42.7 0.0 1.5e-13 1.5e-13 6 147 .. 6 145 .. 2 146 .] 0.95
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
181
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
182 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
183 == domain 1 score: 42.7 bits; conditional E-value: 1.5e-13
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
184 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
185 e ql+ +w kv +va g + l rl+ +p t f f +l + + + ++ hg vlt++g +k + + + l++ h k + + + ++ + +i vl ++ df d+q+a k + + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
186 HBB_LARRI 6 EEKQLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
187 5789********8..589999***********************************************************************99999999*******************************99999999998 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
188
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
189 >> HBB2_XENTR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
190 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
191 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
192 1 ! 38.9 0.1 2.3e-12 2.3e-12 10 132 .. 10 130 .. 4 140 .. 0.87
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
193
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
194 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
195 == domain 1 score: 38.9 bits; conditional E-value: 2.3e-12
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
196 sp|P02185|MYG_PHYCD 10 lvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgam 132
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
197 + vw kv+ + g d l rl+ +p t f f +l + + + +k hg vl+a+g+ ++ ++ lk l++sha + + ++ +++ ++ vl ++ + f q+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
198 HBB2_XENTR 10 TIASVWGKVDIEQD--GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVW 130
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
199 5778****976665..5599******************************************************************9877777777889999999999888777777777655 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
200
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
201 >> HBB_ORNAN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
202 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
203 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
204 1 ! 38.5 0.1 3.2e-12 3.3e-12 3 137 .. 3 135 .. 1 146 [] 0.90
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
205
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
206 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
207 == domain 1 score: 38.5 bits; conditional E-value: 3.2e-12
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
208 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkale 137
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
209 ls ge v ++w kv + g + l rl+ +p t f+ f l + + + +k hg vlt++g lk + + l++ h k + + + + +i vl + df+ + q+a k +
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
210 HBB_ORNAN 3 LSGGEKSAVTNLWGKVNINEL--GGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVS 135
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
211 7899************87765..56889*******************************************************************8888888899999999999888899*********999776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
212
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
213 >> HBB_TRIIN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
214 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
215 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
216 1 ! 37.4 0.3 6.8e-12 6.9e-12 6 147 .. 6 145 .. 1 146 [] 0.90
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
217
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
218 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
219 == domain 1 score: 37.4 bits; conditional E-value: 6.8e-12
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
220 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
221 e lv+ +wakv v +g + l rl+ +p t f++f l + + + + +k hg v+t++g lk + + l++ h k + + + ++ ++ vl + +f+ +aq+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
222 HBB_TRIIN 6 EEKALVIGLWAKVN--VKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
223 57789*******95..778999**************************9999**********************999999************999999999*******9996555569**********99987777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
224
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
225 >> HBE_PONPY
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
226 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
227 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
228 1 ! 36.9 0.1 9.3e-12 9.5e-12 9 147 .. 9 145 .. 3 146 .] 0.91
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
229
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
230 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
231 == domain 1 score: 36.9 bits; conditional E-value: 9.3e-12
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
232 sp|P02185|MYG_PHYCD 9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
233 v +w+k+ + ag + l rl+ +p t fd f +l + + + + +k hg vlt++g +k + + + l++ h k + + ++++ ++ +l ++ +f + q+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
234 HBE_PONPY 9 AAVTSLWSKMNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
235 567889***9998886..57899******************************************************************99999999********999999899***********99888777777766 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
236
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
237 >> HBB1_VAREX
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
238 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
239 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
240 1 ! 36.6 0.1 1.2e-11 1.3e-11 7 147 .. 7 145 .. 3 146 .] 0.91
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
241
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
242 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
243 == domain 1 score: 36.6 bits; conditional E-value: 1.2e-11
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
244 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
245 e ql+ +w k++ + g + l l+ +p t +f +f +l + + + +k hg vlt++g +k + + + l++ h k + ++++ ++ vl +h +f +a k + + +a +y
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
246 HBB1_VAREX 7 EKQLICSLWGKIDVGLI--GGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
247 789********977666..5678999****************************************************************98887777899*****************99999999999999988888877 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
248
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
249 >> HBB_SPECI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
250 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
251 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
252 1 ! 35.6 0.5 2.3e-11 2.4e-11 3 147 .. 3 145 .. 1 146 [] 0.91
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
253
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
254 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
255 == domain 1 score: 35.6 bits; conditional E-value: 2.3e-11
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
256 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
257 ls+ge + w kv a g + l rl+ +p t fd f l + + + + +k hg v+ +++ lk + + + l++ h k + + ++++ i+ v+ + df +aq+a+ k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
258 HBB_SPECI 3 LSDGEKNAISTAWGKVHAA--EVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
259 89**************985..557899********************************************************************9999999999*99999887655566************9988777777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
260
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
261 >> HBB_SPETO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
262 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
263 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
264 1 ! 33.8 0.2 8.7e-11 8.9e-11 3 144 .. 3 142 .. 1 146 [] 0.89
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
265
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
266 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
267 == domain 1 score: 33.8 bits; conditional E-value: 8.7e-11
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
268 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdia 144
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
269 l++ge + w kv a a g + l rl+ +p t fd f l + + + + +k hg v+ +++ lk + + + l++ h k + + ++++ i+ v+ + df +aq+a+ k + ++
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
270 HBB_SPETO 3 LTDGEKNAISTAWGKVNA--AEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALS 142
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
271 7899***********987..566899*********************************************************************9999999999*99999887655566**********998866655555 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
272
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
273 >> HBB_TACAC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
274 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
275 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
276 1 ! 33.3 0.2 1.2e-10 1.2e-10 3 147 .. 3 145 .. 1 146 [] 0.89
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
277
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
278 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
279 == domain 1 score: 33.3 bits; conditional E-value: 1.2e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
280 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
281 ls +e v ++w v + g + l rl+ +p t f+ f l + + + +k hg vlt++g lk + + + l++ h k + + + + ++ vl + +f +aq+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
282 HBB_TACAC 3 LSGSEKTAVTNLWGHVNVNEL--GGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
283 566777889999*99987665..56899********************9998999999*************************************8888888899999999999877789**********999887777777766 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
284
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
285 >> HBAD_PASMO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
286 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
287 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
288 1 ! 33.1 0.0 1.4e-10 1.4e-10 7 148 .. 6 141 .] 1 141 [] 0.90
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
289
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
290 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
291 == domain 1 score: 33.1 bits; conditional E-value: 1.4e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
292 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
293 + +l+ ++w k+ g d l r+f s+p t f +f + s+ ++ hg v+ al+ +k + l l+ ha ++ ++f+s+ + l +r +++ + +a++k + +a ky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
294 HBAD_PASMO 6 DKKLIQQIWGKLGGAEEEIGADALWRMFHSYPSTKTYFPHFDL------SQGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
295 568999******999999****************988877742......368999************************************999777789******999********************9999999999985 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
296
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
297 >> HBB_SUNMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
298 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
299 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
300 1 ! 33.1 0.1 1.5e-10 1.5e-10 6 147 .. 6 145 .. 1 146 [] 0.92
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
301
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
302 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
303 == domain 1 score: 33.1 bits; conditional E-value: 1.5e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
304 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
305 e v +w kv d g + l rl+ +p t fd f l + + + + +k hg vl +lg + + + + l++ h k + + + ++ ++ vl s+ +f q+a+ k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
306 HBB_SUNMU 6 EEKACVTGLWGKVNEDEVG--AEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
307 456678899******9875..789********************************************************************999999999***************************99987777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
308
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
309 >> HBA_ERIEU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
310 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
311 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
312 1 ! 32.1 0.1 3e-10 3e-10 11 147 .. 10 140 .. 1 141 [] 0.86
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
313
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
314 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
315 == domain 1 score: 32.1 bits; conditional E-value: 3e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
316 sp|P02185|MYG_PHYCD 11 vlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
317 v w k+ +g + l r+f++hp t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l +hp+df ++++k l + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
318 HBA_ERIEU 10 VKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLN------PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
319 667899999999999**************99888777533......35667899***********9***99**************999997777799*******************999999999998888888887 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
320
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
321 >> HBA2_BOSMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
322 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
323 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
324 1 ! 31.0 0.6 6.5e-10 6.7e-10 7 147 .. 6 140 .. 1 141 [] 0.82
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
325
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
326 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
327 == domain 1 score: 31.0 bits; conditional E-value: 6.5e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
328 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
329 + v w kv a +g + l r+f s p t f +f s +k hg v al + l l+ ha k ++ ++++s +++ l s+ p+df ++++k l + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
330 HBA2_BOSMU 6 DKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
331 55567789**************************9888877543......45667899***9998877666666666789999******999997677799******************9999999999887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
332
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
333 >> HBAD_CHLME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
334 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
335 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
336 1 ! 30.9 0.1 6.8e-10 6.9e-10 6 148 .. 5 141 .] 1 141 [] 0.88
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
337
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
338 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
339 == domain 1 score: 30.9 bits; conditional E-value: 6.8e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
340 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
341 + +l+ ++w kv g + l r+f ++p+t f +f se ++ hg v alg +k + l l+ ha ++ ++++++ + vl ++ d++ + +a++k l +a ky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
342 HBAD_CHLME 5 DDKKLLTQLWEKVAGHQEEFGSEALQRMFLTYPQTKTYFPHFD---L---HPGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
343 56689999***************************98877664...3...357999**************************************99999999*9998877776666699999999999999999988888885 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
344
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
345 >> HBB_URSMA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
346 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
347 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
348 1 ! 30.9 0.1 6.8e-10 7e-10 6 147 .. 6 145 .. 1 146 [] 0.90
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
349
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
350 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
351 == domain 1 score: 30.9 bits; conditional E-value: 6.8e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
352 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
353 e lv +w kv d g + l rl+ +p t fd f l + + + +k hg vl +++ lk + + + l++ h k + + ++++ ++ vl + +f q+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
354 HBB_URSMA 6 EEKSLVTGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
355 4678999*******99876..57899*******************99888889999************************************99999999**********98888889********9999887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
356
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
357 >> HBBL_RANCA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
358 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
359 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
360 1 ! 30.5 0.2 9.3e-10 9.5e-10 9 136 .. 9 134 .. 3 145 .. 0.87
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
361
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
362 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
363 == domain 1 score: 30.5 bits; conditional E-value: 9.3e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
364 sp|P02185|MYG_PHYCD 9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkal 136
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
365 ++ vw kv+ + gh + l rlf +p t f f l + a + + + hg +l a+ + + l l++ ha + + + + + e +i vl ++ f+ q k +
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
366 HBBL_RANCA 9 AVINSVWQKVDVEQDGH--EALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFI 134
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
367 456689***97776665..89*********************************************9999******************988888888899*******999988888888877766655 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
368
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
369 >> HBB_EQUHE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
370 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
371 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
372 1 ! 30.5 0.2 8.8e-10 9e-10 4 147 .. 4 145 .. 1 146 [] 0.87
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
373
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
374 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
375 == domain 1 score: 30.5 bits; conditional E-value: 8.8e-10
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
376 sp|P02185|MYG_PHYCD 4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
377 s e vl +w kv + g + l rl+ +p t fd f l a + + +k hg vl ++g + + + + l++ h k + + + ++ ++ vl + df + q++ k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
378 HBB_EQUHE 4 SGEEKAAVLALWDKVNEEEVG--GEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
379 55566789*******877664..46899********************************************99999999999999********9998899999*999998886555559******999999887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
380
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
381 >> HBA_AILME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
382 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
383 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
384 1 ! 29.1 0.2 2.4e-09 2.4e-09 4 147 .. 3 140 .. 1 141 [] 0.80
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
385
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
386 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
387 == domain 1 score: 29.1 bits; conditional E-value: 2.4e-09
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
388 sp|P02185|MYG_PHYCD 4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
389 s ++ v w k+ +g + l r f s p t f +f a++ k hg v al + l l+ ha k ++ ++++s ++ l s+hp++f ++++k + + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
390 HBA_AILME 3 SPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQV------KAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
391 55666667789*******999****************9999888766655555......556666666666666555666678999******999997777799*****************99999999998887777777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
392
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
393 >> HBB_TUPGL
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
394 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
395 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
396 1 ! 28.7 0.0 3.2e-09 3.3e-09 6 147 .. 6 145 .. 1 146 [] 0.89
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
397
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
398 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
399 == domain 1 score: 28.7 bits; conditional E-value: 3.2e-09
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
400 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
401 e v +w kv+ + g gq l l+ +p t fd f l + + + ++ +k hg vlt+++ l + + + l++ h k + + + ++ +++vl + +f q+a+ k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
402 HBB_TUPGL 6 EEKAAVTGLWGKVDLEKVG-GQS-LGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
403 455678899****999887.666.55677789************************************************************99999999***************99***********99887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
404
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
405 >> HBA4_SALIR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
406 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
407 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
408 1 ! 28.0 0.1 5.2e-09 5.4e-09 11 148 .. 10 142 .] 2 142 .] 0.88
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
409
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
410 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
411 == domain 1 score: 28.0 bits; conditional E-value: 5.2e-09
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
412 sp|P02185|MYG_PHYCD 11 vlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
413 v +w k+ g+ l r++ +p+t f h + a s +kkhg+t++ + + l l++ hatk ++ +++++ +i v+ + p++f + +++k l+ + +a ky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
414 HBA4_SALIR 10 VKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYF---SHWASVA--PGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR 142
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
415 5679999998888999**************8765...5665555..46779***********99999888888899**************99999*******************************999999999985 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
416
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
417 >> HBA2_GALCR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
418 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
419 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
420 1 ! 28.0 0.2 5.3e-09 5.4e-09 7 147 .. 6 140 .. 1 141 [] 0.83
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
421
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
422 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
423 == domain 1 score: 28.0 bits; conditional E-value: 5.3e-09
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
424 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
425 + v w kv a +g + l r+f s p t f +f s +k hg v al + + l l+ ha k ++ ++++ ++ l +hp++f ++++k + + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
426 HBA2_GALCR 6 DKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDL------SHGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
427 55567789*************************9988877743......346788999*******997655566777888*********9999976677899****************99999999998877777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
428
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
429 >> HBA_MESAU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
430 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
431 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
432 1 ! 27.4 0.4 8e-09 8.2e-09 9 147 .. 8 140 .. 1 141 [] 0.81
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
433
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
434 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
435 == domain 1 score: 27.4 bits; conditional E-value: 8e-09
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
436 sp|P02185|MYG_PHYCD 9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
437 + + w k+ +g + l r+f +p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l ++hp+df ++++k + + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
438 HBA_MESAU 8 TNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVS------HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
439 556789*************************99888777543......3566678899999988877777777778899********999997777799*****************99999999887766666666665 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
440
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
441 >> HBB_MANSP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
442 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
443 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
444 1 ! 27.1 0.1 1e-08 1.1e-08 8 147 .. 8 145 .. 2 146 .] 0.90
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
445
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
446 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
447 == domain 1 score: 27.1 bits; conditional E-value: 1e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
448 sp|P02185|MYG_PHYCD 8 wqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
449 v +w kv d g + l rl+ +p t fd f l + + + +k hg vl a++ l + + + l++ h k + + ++++ ++ vl + +f q+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
450 HBB_MANSP 8 KTAVTTLWGKVNVDEVG--GEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
451 5567889*****99876..57899*********************99999****************************************99999999**********98888889********9999887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
452
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
453 >> HBA_PONPY
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
454 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
455 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
456 1 ! 26.9 0.3 1.2e-08 1.2e-08 3 147 .. 2 140 .. 1 141 [] 0.85
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
457
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
458 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
459 == domain 1 score: 26.9 bits; conditional E-value: 1.2e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
460 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
461 ls ++ v w kv a +g + l r+f s p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l ++ p++f ++++k l + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
462 HBA_PONPY 2 LSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
463 555666667889*************************99888877543......45667899******9998888888888889*********999997777799******************9999999999988877777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
464
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
465 >> HBA_PAGLA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
466 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
467 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
468 1 ! 26.8 0.2 1.3e-08 1.3e-08 3 147 .. 2 140 .. 1 141 [] 0.82
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
469
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
470 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
471 == domain 1 score: 26.8 bits; conditional E-value: 1.3e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
472 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
473 ls ++ + w k+ + +g + l r f s p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l +hp++f +a++k + + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
474 HBA_PAGLA 2 LSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLSHG------SAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
475 666677778889**************************999888865544......45566788888888776655444555679999*******9997777899******************9999999999888777777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
476
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
477 >> HBA_ANSSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
478 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
479 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
480 1 ! 26.7 0.2 1.3e-08 1.3e-08 8 148 .. 7 141 .] 1 141 [] 0.85
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
481
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
482 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
483 == domain 1 score: 26.7 bits; conditional E-value: 1.3e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
484 sp|P02185|MYG_PHYCD 8 wqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
485 v v+ k+ +g + l r+f++ p+t f +f s +k hg v al l l+ ha k ++ ++f+ ++ vl +hp+ + + ++m+k l + aky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
486 HBA_ANSSE 7 KGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQ------PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
487 55567789999999999****************9888777543......356678889999999988888888888899*************9777789****************************99999888888885 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
488
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
489 >> HBB_RABIT
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
490 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
491 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
492 1 ! 25.7 0.3 2.7e-08 2.7e-08 3 147 .. 3 145 .. 1 146 [] 0.89
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
493
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
494 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
495 == domain 1 score: 25.7 bits; conditional E-value: 2.7e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
496 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
497 ls e v +w kv + g + l rl+ +p t f+ f l + + + +k hg vl a++ l + + + l++ h k + + + ++ ++ vl + +f q+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
498 HBB_RABIT 3 LSSEEKSAVTALWGKVNVEEVG--GEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
499 56677888999*****887665..57899*******************99988999999************************************999989999***99999997767779********9999887777777776 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
500
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
501 >> HBA_PROLO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
502 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
503 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
504 1 ! 25.1 0.1 4.2e-08 4.2e-08 6 147 .. 5 140 .. 1 141 [] 0.82
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
505
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
506 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
507 == domain 1 score: 25.1 bits; conditional E-value: 4.2e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
508 sp|P02185|MYG_PHYCD 6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
509 ++ + w k+ +g + l r f s p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l +hp++f ++++k + + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
510 HBA_PROLO 5 ADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPG------SAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
511 555566778*******999****************998888865444......5556778888888888877777778889************997777899*****************99999998887766666666665 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
512
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
513 >> HBA_MACSI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
514 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
515 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
516 1 ! 25.0 0.3 4.4e-08 4.5e-08 3 147 .. 2 140 .. 1 141 [] 0.85
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
517
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
518 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
519 == domain 1 score: 25.0 bits; conditional E-value: 4.4e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
520 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
521 ls ++ v w kv +g + l r+f s p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l ++ p++f ++++k l + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
522 HBA_MACSI 2 LSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
523 566666678899**************************9888877643......35667889999999999888877777888999*******999997677799******************9999999999988877777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
524
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
525 >> HBA_MACFA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
526 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
527 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
528 1 ! 24.6 0.4 5.8e-08 6e-08 3 147 .. 2 140 .. 1 141 [] 0.84
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
529
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
530 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
531 == domain 1 score: 24.6 bits; conditional E-value: 5.8e-08
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
532 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
533 ls ++ v w kv +g + l r+f s p t f +f s +k hg v al + l l+ ha k ++ ++++s ++ l ++ p++f ++++k l + +ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
534 HBA_MACFA 2 LSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
535 555666667789**************************9888877643......35667889999999999888877777888999*******999997677799******************9999999999988877777777 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
536
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
537 >> HBB_CALAR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
538 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
539 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
540 1 ! 23.8 0.1 1e-07 1e-07 7 147 .. 7 145 .. 2 146 .] 0.89
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
541
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
542 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
543 == domain 1 score: 23.8 bits; conditional E-value: 1e-07
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
544 sp|P02185|MYG_PHYCD 7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
545 e v +w kv d g + l rl+ +p t f+ f l t + + +k hg vl a++ l + + + l++ h k + + + ++ ++ vl + +f q+a k + +a ky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
546 HBB_CALAR 7 EKSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKY 145
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
547 45668889*****99876..57899*********************99999999*************************************999999999*********98877889999999999998877777777666 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
548
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
549 >> HBA_TRIOC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
550 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
551 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
552 1 ! 22.5 0.2 2.5e-07 2.6e-07 4 148 .. 3 141 .] 1 141 [] 0.84
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
553
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
554 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
555 == domain 1 score: 22.5 bits; conditional E-value: 2.5e-07
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
556 sp|P02185|MYG_PHYCD 4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
557 s ++ v v+ k+ +g + l r+f ++p t f +f s +k hg v+ al + l l+ ha k ++ ++++ + ++ v+ +hp+ + + ++++k l ++aky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
558 HBA_TRIOC 3 SANDKTNVKTVFTKITGHAEDYGAETLERMFITYPPTKTYFPHFDLH------HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
559 55566667789999999999*****************9988877543......3566778899999877766666666677899************97777899***************************99999999999985 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
560
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
561 >> HBA_FRAPO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
562 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
563 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
564 1 ! 22.4 0.3 2.8e-07 2.9e-07 3 148 .. 2 141 .] 1 141 [] 0.86
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
565
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
566 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
567 == domain 1 score: 22.4 bits; conditional E-value: 2.8e-07
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
568 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
569 ls ++ v ++ k+ + +g + l r+f ++p t f +f s +k hg v+ al l l+ ha k ++ ++++ + ++ v+ +hp+ + + ++++k l + aky+
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
570 HBA_FRAPO 2 LSAADKNNVKGIFGKISSHAEDYGAEALERMFITYPSTKTYFPHFDLS------HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKYR 141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
571 6666667788899*************************9988877543......35667889****999988777777778899*********999997677799***************************99988888888885 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
572
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
573 >> HBA_PHACO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
574 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
575 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
576 1 ! 21.8 0.3 4.3e-07 4.4e-07 3 147 .. 2 140 .. 1 141 [] 0.86
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
577
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
578 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
579 == domain 1 score: 21.8 bits; conditional E-value: 4.3e-07
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
580 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
581 ls ++ v ++ k+ +g + l r+f ++p t f +f s +k hg v+ al + l l+ ha k ++ ++++ + ++ v+ +hp+ + + ++++k l + aky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
582 HBA_PHACO 2 LSAADKNNVKGIFTKIAGHAEEYGAEALERMFITYPSTKTYFPHFDLS------HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
583 56666667778899999999999***************9988877543......45677899******999999999999999**********999997677799**************************99988888888888 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
584
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
585 >> HBA_COLLI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
586 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
587 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
588 1 ! 16.5 0.2 1.9e-05 1.9e-05 3 147 .. 2 140 .. 1 141 [] 0.80
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
589
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
590 Alignments for each domain:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
591 == domain 1 score: 16.5 bits; conditional E-value: 1.9e-05
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
592 sp|P02185|MYG_PHYCD 3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
593 ls ++ v v+ak+ g + l rlf ++p+t f +f s +k hg v al l l+ ha k ++ ++++ ++ v+ + p+ + + ++++k + + aky
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
594 HBA_COLLI 2 LSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS------HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKY 140
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
595 666677778899*****999999***************9988877543......456678999999999998888888888899999*******999966667888888888888888888888877777776666666666666 PP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
596
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
597
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
598
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
599 Internal pipeline statistics summary:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
600 -------------------------------------
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
601 Query model(s): 1 (154 nodes)
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
602 Target sequences: 45 (6519 residues searched)
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
603 Passed MSV filter: 45 (1); expected 0.9 (0.02)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
604 Passed bias filter: 45 (1); expected 0.9 (0.02)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
605 Passed Vit filter: 45 (1); expected 0.0 (0.001)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
606 Passed Fwd filter: 44 (0.977778); expected 0.0 (1e-05)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
607 Initial search space (Z): 45 [actual number of targets]
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
608 Domain search space (domZ): 44 [number of targets reported over threshold]
5
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
609 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
610 # Mc/sec: 20.54
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
611
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
612 @@ New targets included: 44
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
613 @@ New alignment includes: 45 subseqs (was 1), including original query
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
614 @@ Continuing to next round.
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
615
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
616 @@
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
617 @@ Round: 2
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
618 @@ Included in MSA: 45 subsequences (query + 44 subseqs from 44 targets)
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
619 @@ Model size: 154 positions
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
620 @@
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
621
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
622 Scores for complete sequences (score includes all domains):
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
623 --- full sequence --- --- best 1 domain --- -#dom-
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
624 E-value score bias E-value score bias exp N Sequence Description
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
625 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
626 4.5e-68 219.3 2.1 4.9e-68 219.1 2.1 1.0 1 MYG_ESCGI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
627 5.1e-68 219.1 0.1 5.6e-68 218.9 0.1 1.0 1 HBB_MANSP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
628 1.6e-67 217.5 2.0 1.7e-67 217.3 2.0 1.0 1 MYG_LYCPI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
629 2.2e-67 217.0 0.2 2.4e-67 216.9 0.2 1.0 1 HBB_URSMA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
630 2.7e-67 216.7 0.3 3e-67 216.6 0.3 1.0 1 MYG_PROGU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
631 3.6e-67 216.3 1.1 4e-67 216.2 1.1 1.0 1 MYG_HORSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
632 4e-67 216.2 0.7 4.4e-67 216.0 0.7 1.0 1 HBB_RABIT
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
633 8.5e-67 215.1 0.8 9.4e-67 215.0 0.8 1.0 1 HBB_SPECI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
634 8.6e-67 215.1 1.2 9.5e-67 214.9 1.2 1.0 1 MYG_SAISC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
635 9.6e-67 214.9 0.1 1e-66 214.8 0.1 1.0 1 HBB_SUNMU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
636 1.2e-66 214.6 0.0 1.3e-66 214.4 0.0 1.0 1 HBB_COLLI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
637 1.4e-66 214.4 0.1 1.5e-66 214.3 0.1 1.0 1 HBB_EQUHE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
638 2.2e-66 213.7 0.4 2.5e-66 213.6 0.4 1.0 1 MYG_MOUSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
639 3.7e-66 213.0 0.3 4e-66 212.9 0.3 1.0 1 HBB_TACAC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
640 4e-66 212.9 0.5 4.4e-66 212.8 0.5 1.0 1 HBB_SPETO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
641 1.3e-65 211.2 0.4 1.5e-65 211.1 0.4 1.0 1 HBE_PONPY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
642 1.6e-65 211.0 0.1 1.7e-65 210.9 0.1 1.0 1 HBB_CALAR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
643 2.2e-65 210.5 0.0 2.4e-65 210.4 0.0 1.0 1 HBB_ORNAN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
644 4.2e-65 209.6 0.2 4.6e-65 209.5 0.2 1.0 1 HBA_MESAU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
645 8.8e-65 208.5 0.0 9.6e-65 208.4 0.0 1.0 1 HBB_LARRI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
646 1.1e-64 208.2 0.1 1.2e-64 208.1 0.1 1.0 1 HBB_TRIIN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
647 1.7e-64 207.6 0.5 1.9e-64 207.4 0.5 1.0 1 HBA_PONPY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
648 4.9e-64 206.1 0.2 5.5e-64 206.0 0.2 1.0 1 HBA_MACFA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
649 6.2e-64 205.8 0.2 6.8e-64 205.7 0.2 1.0 1 HBA_MACSI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
650 9.2e-64 205.2 0.1 1e-63 205.1 0.1 1.0 1 HBA_AILME
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
651 3.1e-63 203.5 0.3 3.4e-63 203.4 0.3 1.0 1 HBA_FRAPO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
652 3.1e-63 203.5 0.3 3.5e-63 203.4 0.3 1.0 1 HBA_PHACO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
653 3.4e-63 203.4 0.3 3.8e-63 203.2 0.3 1.0 1 HBA2_BOSMU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
654 3.7e-63 203.3 0.4 4.1e-63 203.1 0.4 1.0 1 HBA2_GALCR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
655 3.8e-63 203.3 0.0 4.1e-63 203.1 0.0 1.0 1 HBB_TUPGL
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
656 1.1e-62 201.7 0.4 1.2e-62 201.6 0.4 1.0 1 HBA_ANSSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
657 1.1e-62 201.7 0.3 1.2e-62 201.6 0.3 1.0 1 HBA_PAGLA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
658 2e-62 200.9 0.1 2.2e-62 200.8 0.1 1.0 1 HBA_ERIEU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
659 2.1e-62 200.8 0.0 2.3e-62 200.7 0.0 1.0 1 HBA_PROLO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
660 4.2e-62 199.9 0.4 4.6e-62 199.7 0.4 1.0 1 HBA_TRIOC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
661 9.3e-62 198.7 0.1 1.1e-61 198.5 0.1 1.0 1 HBB1_VAREX
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
662 5.9e-61 196.1 0.4 6.5e-61 196.0 0.4 1.0 1 HBAD_CHLME
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
663 9.8e-61 195.4 0.1 1.1e-60 195.3 0.1 1.0 1 HBAZ_HORSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
664 2.2e-60 194.2 0.2 2.5e-60 194.1 0.2 1.0 1 HBA_COLLI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
665 1.5e-59 191.5 0.1 1.7e-59 191.4 0.1 1.0 1 HBAD_PASMO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
666 1.3e-57 185.2 0.2 1.6e-57 185.0 0.2 1.0 1 HBBL_RANCA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
667 3e-56 180.9 0.7 3.5e-56 180.6 0.7 1.0 1 HBB2_XENTR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
668 2.9e-55 177.6 0.4 3.2e-55 177.5 0.4 1.0 1 MYG_MUSAN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
669 7.5e-55 176.3 0.1 8.3e-55 176.2 0.1 1.0 1 HBA4_SALIR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
670 + 1.7e-38 123.2 0.0 1.8e-38 123.1 0.0 1.0 1 HBB2_TRICR
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
671
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
672
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
673 Domain annotation for each sequence (and alignments):
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
674 >> MYG_ESCGI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
675 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
676 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
677 1 ! 219.1 2.1 4.9e-68 4.9e-68 2 154 .] 1 153 [] 1 153 [] 0.99
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
678
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
679 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
680 == domain 1 score: 219.1 bits; conditional E-value: 4.9e-68
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
681 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
682 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
683 vlsd+e+qlv ++w+kvead+a++Gq++L+rlf+ +Pet e+FdkF++lk+eae+k+s+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++++p++f++++qaa++k+lel+++++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
684 MYG_ESCGI 1 VLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
685 69******************************************************************************************************************************************************8 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
686
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
687 >> HBB_MANSP
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
688 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
689 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
690 1 ! 218.9 0.1 5.6e-68 5.6e-68 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
691
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
692 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
693 == domain 1 score: 218.9 bits; conditional E-value: 5.6e-68
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
694 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
695 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
696 l+ eek++v+++wgkv++d e+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g++kvkahgkkvl a+++++++ld+lkg++++LselH++kl+vdpenfkll++vlv+vla++f+keftp+vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
697 HBB_MANSP 3 LTPEEKTAVTTLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
698 7899************886..669************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
699
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
700 >> MYG_LYCPI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
701 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
702 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
703 1 ! 217.3 2.0 1.7e-67 1.7e-67 3 154 .] 2 153 .] 1 153 [] 1.00
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
704
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
705 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
706 == domain 1 score: 217.3 bits; conditional E-value: 1.7e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
707 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
708 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
709 lsd+e+q v ++wgkve+d a++Gqe+L+rlf+++Pet ++FdkF++lk+e+e+kgs+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++k++++f+++++aa++k+lel++n++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
710 MYG_LYCPI 2 LSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
711 89*****************************************************************************************************************************************************8 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
712
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
713 >> HBB_URSMA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
714 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
715 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
716 1 ! 216.9 0.2 2.4e-67 2.4e-67 3 147 .. 3 145 .. 1 146 [] 0.98
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
717
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
718 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
719 == domain 1 score: 216.9 bits; conditional E-value: 2.4e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
720 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
721 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
722 l+ eek+lv+ +wgkv++d e+G+eaL rl+vvyP+t+++Fd+F+dl+s++++++++kvkahgkkvl+++++++k+ld+lkg+++kLselH++kl+vdpenfkll++vlv+vla++f+keftp+vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
723 HBB_URSMA 3 LTGEEKSLVTGLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
724 7899************886..669************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
725
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
726 >> MYG_PROGU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
727 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
728 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
729 1 ! 216.6 0.3 3e-67 3e-67 3 154 .] 2 153 .] 1 153 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
730
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
731 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
732 == domain 1 score: 216.6 bits; conditional E-value: 3e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
733 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
734 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
735 lsd+e+qlv +vwgkve+d +++Gqe+L+rlf+ +Pet e+FdkF++lk+e+e+++s+++k+hg++vltalg ++kk+++++++l++L+++Hatk+k+++++++++se++++vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
736 MYG_PROGU 2 LSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
737 89*****************************************************************************************************************************************************8 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
738
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
739 >> MYG_HORSE
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
740 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
741 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
742 1 ! 216.2 1.1 4e-67 4e-67 3 154 .] 2 153 .] 1 153 [] 1.00
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
743
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
744 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
745 == domain 1 score: 216.2 bits; conditional E-value: 4e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
746 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
747 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
748 lsd+e+q+v +vwgkvead a++Gqe+L+rlf+ +Pet e+FdkF++lk+eae+k+s+++k+hg+ vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
749 MYG_HORSE 2 LSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
750 89*****************************************************************************************************************************************************8 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
751
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
752 >> HBB_RABIT
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
753 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
754 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
755 1 ! 216.0 0.7 4.4e-67 4.4e-67 3 147 .. 3 145 .. 1 146 [] 0.98
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
756
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
757 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
758 == domain 1 score: 216.0 bits; conditional E-value: 4.4e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
759 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
760 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
761 ls+eek++v+++wgkv+++ e+G+eaL rl+vvyP+t+++F++F+dl+s+++v++++kvkahgkkvl+a++e++++ld+lkg+++kLselH++kl+vdpenf+ll++vlv+vl+++f+keftp+vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
762 HBB_RABIT 3 LSSEEKSAVTALWGKVNVE--EVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
763 89**************875..679************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
764
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
765 >> HBB_SPECI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
766 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
767 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
768 1 ! 215.0 0.8 9.4e-67 9.4e-67 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
769
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
770 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
771 == domain 1 score: 215.0 bits; conditional E-value: 9.4e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
772 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
773 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
774 lsd+ek++++++wgkv +aae+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g+akvkahgkkv++++++++k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
775 HBB_SPECI 3 LSDGEKNAISTAWGKV--HAAEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
776 9***************..67889************************************************************************************************************************** PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
777
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
778 >> MYG_SAISC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
779 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
780 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
781 1 ! 214.9 1.2 9.5e-67 9.5e-67 3 154 .] 2 153 .] 1 153 [] 0.99
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
782
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
783 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
784 == domain 1 score: 214.9 bits; conditional E-value: 9.5e-67
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
785 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
786 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
787 lsd+e+qlv ++wgkvead ++Gqe+L+ lf+ +Pet e+FdkF++lkse+e+k+s+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++l+s+++v+vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
788 MYG_SAISC 2 LSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
789 89*****************************************************************************************************************************************************8 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
790
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
791 >> HBB_SUNMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
792 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
793 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
794 1 ! 214.8 0.1 1e-66 1e-66 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
795
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
796 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
797 == domain 1 score: 214.8 bits; conditional E-value: 1e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
798 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
799 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
800 ls eek+ v+ +wgkv++d e+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g++kvkahgkkvl++lge+v +ld+lkg+++kLselH++kl+vdpenf+ll++vlvvvla+kf+keftp vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
801 HBB_SUNMU 3 LSGEEKACVTGLWGKVNED--EVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
802 899*************865..679************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
803
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
804 >> HBB_COLLI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
805 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
806 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
807 1 ! 214.4 0.0 1.3e-66 1.3e-66 4 147 .. 4 145 .. 1 146 [] 0.98
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
808
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
809 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
810 == domain 1 score: 214.4 bits; conditional E-value: 1.3e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
811 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
812 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
813 s+eekql++s+wgkv++ a++G+eaL+rl++vyP+t+++F++F++l+s+++++g+++vkahgkkvlt++g+avk+ld++kg++++LselH++kl+vdpenf+ll+++lv++laa+f+k+ftpe+qaa++kl+++va+ala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
814 HBB_COLLI 4 SAEEKQLITSIWGKVNV--ADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
815 899************75..789************************************************************************************************************************** PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
816
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
817 >> HBB_EQUHE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
818 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
819 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
820 1 ! 214.3 0.1 1.5e-66 1.5e-66 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
821
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
822 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
823 == domain 1 score: 214.3 bits; conditional E-value: 1.5e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
824 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
825 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
826 ls eek++v ++w+kv++ +e+G+eaL rl+vvyP+t+++Fd+F+dl+++a+v+g++kvkahgkkvl+++ge+v++ld+lkg++++LselH++kl+vdpenf+ll++vlvvvla++f+k+ftpe qa+++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
827 HBB_EQUHE 3 LSGEEKAAVLALWDKVNE--EEVGGEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
828 899*************75..5789************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
829
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
830 >> MYG_MOUSE
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
831 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
832 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
833 1 ! 213.6 0.4 2.5e-66 2.5e-66 3 154 .] 2 153 .] 1 153 [] 1.00
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
834
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
835 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
836 == domain 1 score: 213.6 bits; conditional E-value: 2.5e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
837 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
838 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
839 lsd+e+qlv +vwgkvead a++Gqe+L+ lf+++Pet ++FdkF++lkse+++kgs+++k+hg +vltalg+++kk++++++++++L+++Hatk+k+++++++++se+++ vl+++++++f++++q+a++k+lel++n++aakYkelgfqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
840 MYG_MOUSE 2 LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
841 89*****************************************************************************************************************************************************8 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
842
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
843 >> HBB_TACAC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
844 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
845 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
846 1 ! 212.9 0.3 4e-66 4e-66 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
847
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
848 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
849 == domain 1 score: 212.9 bits; conditional E-value: 4e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
850 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
851 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
852 ls +ek++v+++wg+v+++ e+G+eaL rl+vvyP+t+++F++F+dl+s+++v+g+akvkahg kvlt++g+a+k+ld+lkg+++kLselH++kl+vdpenf+ l++vlvvvla++f+keftpe+qaa++kl++ v++ala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
853 HBB_TACAC 3 LSGSEKTAVTNLWGHVNVN--ELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
854 899*************875..779************************************************************************************************************************* PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
855
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
856 >> HBB_SPETO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
857 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
858 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
859 1 ! 212.8 0.5 4.4e-66 4.4e-66 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
860
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
861 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
862 == domain 1 score: 212.8 bits; conditional E-value: 4.4e-66
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
863 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
864 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
865 l+d+ek++++++wgkv+ aaeiG+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g+akvkahgkkv++++++++k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k+++ vanal++kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
866 HBB_SPETO 3 LTDGEKNAISTAWGKVN--AAEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALSHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
867 899*************7..5789************************************************************************************************************************** PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
868
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
869 >> HBE_PONPY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
870 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
871 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
872 1 ! 211.1 0.4 1.5e-65 1.5e-65 4 147 .. 4 145 .. 1 146 [] 0.97
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
873
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
874 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
875 == domain 1 score: 211.1 bits; conditional E-value: 1.5e-65
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
876 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
877 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
878 ++eek++v+s+w+k+++++a G+eaL rl+vvyP+t+++Fd+F++l+s++++ g++kvkahgkkvlt++g+a+k++d+lk++++kLselH++kl+vdpenfkll++v+v++la++f+keftpevqaa++kl+++va ala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
879 HBE_PONPY 4 TAEEKAAVTSLWSKMNVEEA--GGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
880 689************98755..9************************************************************************************************************************* PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
881
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
882 >> HBB_CALAR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
883 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
884 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
885 1 ! 210.9 0.1 1.7e-65 1.7e-65 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
886
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
887 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
888 == domain 1 score: 210.9 bits; conditional E-value: 1.7e-65
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
889 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
890 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
891 l+ eek++v+++wgkv++d e+G+eaL rl+vvyP+t+++F++F+dl+++++v++++kvkahgkkvl a+++++++ld+lkg++++LselH++kl+vdpenf+ll++vlv+vla++f+keftp vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
892 HBB_CALAR 3 LTGEEKSAVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
893 7899************886..669************************************************************************************************************************* PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
894
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
895 >> HBB_ORNAN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
896 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
897 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
898 1 ! 210.4 0.0 2.4e-65 2.4e-65 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
899
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
900 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
901 == domain 1 score: 210.4 bits; conditional E-value: 2.4e-65
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
902 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
903 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
904 ls +ek++v+++wgkv+ + e+G+eaL rl+vvyP+t+++F+ F+dl+s+ +v+g++kvkahg kvlt++g+a+k+lddlkg+++kLselH++kl+vdpenf+ l++vl+vvla++f+k+f+pevqaa++kl++ va+al +kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
905 HBB_ORNAN 3 LSGGEKSAVTNLWGKVNIN--ELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVSGVAHALGHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
906 899*************875..779************************************************************************************************************************* PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
907
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
908 >> HBA_MESAU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
909 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
910 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
911 1 ! 209.5 0.2 4.6e-65 4.6e-65 2 148 .. 1 141 [] 1 141 [] 0.99
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
912
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
913 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
914 == domain 1 score: 209.5 bits; conditional E-value: 4.6e-65
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
915 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
916 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
917 vls+++k++++++wgk++++a e+G+eaLer+f vyP+tk+yF++Fd + +gsa+vk+hgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p++ftp+v+a+ldk++++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
918 HBA_MESAU 1 VLSAKDKTNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVS------HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
919 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
920
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
921 >> HBB_LARRI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
922 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
923 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
924 1 ! 208.4 0.0 9.6e-65 9.6e-65 4 147 .. 4 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
925
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
926 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
927 == domain 1 score: 208.4 bits; conditional E-value: 9.6e-65
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
928 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
929 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
930 s+eekql++ +wgkv++ a++G+eaL+rl++vyP+t+++F +F++l+s+++++g++ v+ahgkkvlt++geavk+ld++k+++++LselH++kl+vdpenf+ll+++l++vlaa+f+k+ftp+ qaa++kl+++va+ala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
931 HBB_LARRI 4 SAEEKQLITGLWGKVNV--ADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
932 899************75..789************************************************************************************************************************** PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
933
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
934 >> HBB_TRIIN
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
935 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
936 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
937 1 ! 208.1 0.1 1.2e-64 1.2e-64 3 147 .. 3 145 .. 1 146 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
938
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
939 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
940 == domain 1 score: 208.1 bits; conditional E-value: 1.2e-64
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
941 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
942 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
943 l+ eek+lv +w+kv++ +e+G+eaL rl+vvyP+t+++F++F+dl+s++++++++kvkahg+kv+t++g+++k+l+dlkga+++LselH++kl+vdpenf+ll++vlv+vla++f+kef+pe+qaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
944 HBB_TRIIN 3 LTPEEKALVIGLWAKVNV--KEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
945 7899************76..689************************************************************************************************************************** PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
946
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
947 >> HBA_PONPY
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
948 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
949 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
950 1 ! 207.4 0.5 1.9e-64 1.9e-64 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
951
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
952 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
953 == domain 1 score: 207.4 bits; conditional E-value: 1.9e-64
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
954 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
955 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
956 vls ++k++vk++wgkv+a+a ++G+eaLer+f ++P+tk+yF++Fd + +gsa+vk+hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
957 HBA_PONPY 1 VLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
958 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
959
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
960 >> HBA_MACFA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
961 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
962 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
963 1 ! 206.0 0.2 5.5e-64 5.5e-64 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
964
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
965 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
966 == domain 1 score: 206.0 bits; conditional E-value: 5.5e-64
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
967 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
968 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
969 vls ++k++vk++wgkv+++a e+G+eaLer+f ++P+tk+yF++Fd + +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
970 HBA_MACFA 1 VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
971 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
972
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
973 >> HBA_MACSI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
974 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
975 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
976 1 ! 205.7 0.2 6.8e-64 6.8e-64 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
977
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
978 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
979 == domain 1 score: 205.7 bits; conditional E-value: 6.8e-64
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
980 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
981 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
982 vls ++k++vk++wgkv+++a e+G+eaLer+f ++P+tk+yF++Fd + +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
983 HBA_MACSI 1 VLSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
984 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
985
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
986 >> HBA_AILME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
987 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
988 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
989 1 ! 205.1 0.1 1e-63 1e-63 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
990
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
991 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
992 == domain 1 score: 205.1 bits; conditional E-value: 1e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
993 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
994 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
995 vls ++k++vk+ w+k++++a e+G+eaLer f ++P+tk+yF++Fd + gsa+vkahgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
996 HBA_AILME 1 VLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
997 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
998
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
999 >> HBA_FRAPO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1000 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1001 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1002 1 ! 203.4 0.3 3.4e-63 3.4e-63 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1003
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1004 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1005 == domain 1 score: 203.4 bits; conditional E-value: 3.4e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1006 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1007 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1008 vls+++k++vk ++gk++++a+++G+eaLer+f++yP+tk+yF++Fd + +gsa+vk+hgkkv++al ea +++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v n+l+akY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1009 HBA_FRAPO 1 VLSAADKNNVKGIFGKISSHAEDYGAEALERMFITYPSTKTYFPHFDLS------HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1010 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1011
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1012 >> HBA_PHACO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1013 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1014 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1015 1 ! 203.4 0.3 3.5e-63 3.5e-63 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1016
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1017 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1018 == domain 1 score: 203.4 bits; conditional E-value: 3.5e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1019 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1020 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1021 vls+++k++vk +++k+ ++a+e+G+eaLer+f++yP+tk+yF++Fd + +gsa++k+hgkkv++al eav+++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v ++l+akY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1022 HBA_PHACO 1 VLSAADKNNVKGIFTKIAGHAEEYGAEALERMFITYPSTKTYFPHFDLS------HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1023 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1024
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1025 >> HBA2_BOSMU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1026 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1027 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1028 1 ! 203.2 0.3 3.8e-63 3.8e-63 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1029
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1030 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1031 == domain 1 score: 203.2 bits; conditional E-value: 3.8e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1032 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1033 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1034 vls+++k +vk++wgkv+++aae+G+eaLer+f ++P+tk+yF++Fd + +gsa+vk+hg kv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls+ l+v+la+++p++ftp+v+a+ldk+l+ v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1035 HBA2_BOSMU 1 VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1036 699********************************************96......9******************************************************************************************7 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1037
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1038 >> HBA2_GALCR
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1039 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1040 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1041 1 ! 203.1 0.4 4.1e-63 4.1e-63 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1042
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1043 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1044 == domain 1 score: 203.1 bits; conditional E-value: 4.1e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1045 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1046 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1047 vls +k++vk++w+kv+a+a ++G+eaLer+f ++P+tk+yF++Fd + +gs++vk+hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfkll ++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1048 HBA2_GALCR 1 VLSPTDKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1049 6999*******************************************96......9******************************************************************************************7 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1050
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1051 >> HBB_TUPGL
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1052 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1053 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1054 1 ! 203.1 0.0 4.1e-63 4.1e-63 3 147 .. 3 145 .. 1 146 [] 0.97
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1055
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1056 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1057 == domain 1 score: 203.1 bits; conditional E-value: 4.1e-63
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1058 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1059 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1060 ls eek++v+ +wgkv+ +++G++ L l++vyP+t+++Fd+F+dl+s+++v++++kvkahgkkvlt++++++++ld+lkg+++kLselH++kl+vdpenf+ll++vlv vla++f+ eftp+vqaa++k+++ vanala+kY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1061 HBB_TUPGL 3 LSGEEKAAVTGLWGKVDL--EKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1062 899*************75..567999*********************************************************************************************************************** PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1063
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1064 >> HBA_ANSSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1065 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1066 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1067 1 ! 201.6 0.4 1.2e-62 1.2e-62 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1068
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1069 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1070 == domain 1 score: 201.6 bits; conditional E-value: 1.2e-62
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1071 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1072 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1073 vls+++k +vk+v+gk++++a+e+G+e+L+r+f+++P+tk+yF++Fd + gsa++kahgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfk+l+++++vvla ++p+ +tpev+a++dk+l++va++l+akY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1074 HBA_ANSSE 1 VLSAADKGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQ------PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1075 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1076
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1077 >> HBA_PAGLA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1078 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1079 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1080 1 ! 201.6 0.3 1.2e-62 1.2e-62 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1081
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1082 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1083 == domain 1 score: 201.6 bits; conditional E-value: 1.2e-62
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1084 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1085 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1086 vls+++k+++k+ w+k++++a e+G+eaLer f+++P+tk+yF++Fd + +gsa+vkahgkkv++al+ av +l+dl +al++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v++aldk++++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1087 HBA_PAGLA 1 VLSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLS------HGSAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1088 69*********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1089
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1090 >> HBA_ERIEU
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1091 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1092 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1093 1 ! 200.8 0.1 2.2e-62 2.2e-62 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1094
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1095 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1096 == domain 1 score: 200.8 bits; conditional E-value: 2.2e-62
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1097 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1098 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1099 vls+ +k++vk+ wgk++++ e+G+eaL r+f+ +P+tk+yF++Fd gsa+vk+hgkkv++al++av++ldd+ gal++Ls+lHa+kl+vdp+nfklls++l+v+la ++p++ftp+v+a+ldk+l++va++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1100 HBA_ERIEU 1 VLSATDKANVKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLN------PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1101 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1102
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1103 >> HBA_PROLO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1104 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1105 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1106 1 ! 200.7 0.0 2.3e-62 2.3e-62 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1107
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1108 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1109 == domain 1 score: 200.7 bits; conditional E-value: 2.3e-62
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1110 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1111 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1112 vls ++k+++k+ w+k++++a e+G+eaLer f ++P+tk+yF++Fd + gsa+vkahgkkv++al+ av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1113 HBA_PROLO 1 VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1114 699********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1115
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1116 >> HBA_TRIOC
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1117 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1118 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1119 1 ! 199.7 0.4 4.6e-62 4.6e-62 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1120
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1121 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1122 == domain 1 score: 199.7 bits; conditional E-value: 4.6e-62
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1123 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1124 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1125 vls+++k++vk+v++k++++a+++G+e+Ler+f++yP tk+yF++Fd + +gsa++kahgkkv+ al eav+++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+ +tpev+a+ldk+l++v n+l+akY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1126 HBA_TRIOC 1 VLSANDKTNVKTVFTKITGHAEDYGAETLERMFITYPPTKTYFPHFDLH------HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1127 69*********************************************95......9******************************************************************************************7 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1128
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1129 >> HBB1_VAREX
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1130 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1131 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1132 1 ! 198.5 0.1 1.1e-61 1.1e-61 4 147 .. 4 145 .. 2 146 .] 0.97
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1133
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1134 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1135 == domain 1 score: 198.5 bits; conditional E-value: 1.1e-61
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1136 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1137 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1138 ++eekql+ s+wgk+++ iG+e+L+ l+v yP+t+++F++F++l+s+++++g+++vkahgkkvlt++g+a+k+ld++k++++kLselH++kl+vdp+nfkll++vlv+vla +++keftp+ +aa++kl+++v+++la++Y
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1139 HBB1_VAREX 4 TAEEKQLICSLWGKIDVG--LIGGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1140 579************765..569************************************************************************************************************************* PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1141
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1142 >> HBAD_CHLME
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1143 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1144 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1145 1 ! 196.0 0.4 6.5e-61 6.5e-61 3 148 .. 2 141 .] 1 141 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1146
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1147 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1148 == domain 1 score: 196.0 bits; conditional E-value: 6.5e-61
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1149 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1150 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1151 l++++k+l++++w+kv ++++e+G+eaL+r+f +yP+tk+yF++Fd + gs++v++hgkkv++alg+avk+ld+l++al++Ls+lHa++l+vdp nfkll++++ vvla++++k+++pe++aa+dk+l++va +la+kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1152 HBAD_CHLME 2 LTADDKKLLTQLWEKVAGHQEEFGSEALQRMFLTYPQTKTYFPHFDLH------PGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1153 7899******************************************95......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1154
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1155 >> HBAZ_HORSE
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1156 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1157 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1158 1 ! 195.3 0.1 1.1e-60 1.1e-60 3 148 .. 2 141 .] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1159
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1160 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1161 == domain 1 score: 195.3 bits; conditional E-value: 1.1e-60
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1162 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1163 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1164 l+++e+++v s+wgk++++a+++G+eaL+rlf +yP+tk+yF++Fd + +gs++++ahg+kv++a+g+avk++d+++gal+kLselHa+ l+vdp+nfk+ls++l+v+la+++p++ft++++aa+dk+l++v+++l++kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1165 HBAZ_HORSE 2 LTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDLH------EGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1166 7899******************************************95......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1167
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1168 >> HBA_COLLI
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1169 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1170 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1171 1 ! 194.1 0.2 2.5e-60 2.5e-60 2 148 .. 1 141 [] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1172
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1173 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1174 == domain 1 score: 194.1 bits; conditional E-value: 2.5e-60
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1175 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1176 sp|P02185|MYG_PHYCD-i1 2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1177 vls+++k++vk+v++k++++a ++G+eaLerlf++yP+tk+yF++Fd + +gsa++k+hgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a +fp+ +tpev+a+ldk++ +v ++l+akY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1178 HBA_COLLI 1 VLSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS------HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1179 69*********************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1180
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1181 >> HBAD_PASMO
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1182 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1183 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1184 1 ! 191.4 0.1 1.7e-59 1.7e-59 3 148 .. 2 141 .] 1 141 [] 0.99
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1185
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1186 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1187 == domain 1 score: 191.4 bits; conditional E-value: 1.7e-59
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1188 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1189 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1190 l++e+k+l++++wgk+++ ++eiG++aL r+f++yP+tk+yF++Fd + +gs+++++hgkkv++al++a+k+ld+l++al++Ls+lHa++l+vdp+nfk+ls++l v la++++ke++pev++a+dk++++va++la+kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1191 HBAD_PASMO 2 LTAEDKKLIQQIWGKLGGAEEEIGADALWRMFHSYPSTKTYFPHFDLS------QGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKYR 141
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1192 789*******************************************96......9******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1193
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1194 >> HBBL_RANCA
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1195 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1196 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1197 1 ! 185.0 0.2 1.6e-57 1.6e-57 4 147 .. 4 145 .. 2 146 .] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1198
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1199 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1200 == domain 1 score: 185.0 bits; conditional E-value: 1.6e-57
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1201 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1202 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1203 ++eek++++svw+kv+++++ G+eaL+rlf+vyP+t++yF++F+dl+s+a+++g++kv+ahgkk+l a+++a+++ldd+kg+l++Lse Ha++l+vdpenf+ l+evl+vvl ak++k+f+p+vq++++k+++++ al++ Y
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1204 HBBL_RANCA 4 TAEEKAVINSVWQKVDVEQD--GHEALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFIAVLVDALSHSY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1205 579************99988..89**********************************************************************************************************************99 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1206
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1207 >> HBB2_XENTR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1208 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1209 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1210 1 ! 180.6 0.7 3.5e-56 3.5e-56 4 147 .. 4 145 .. 2 146 .] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1211
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1212 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1213 == domain 1 score: 180.6 bits; conditional E-value: 3.5e-56
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1214 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1215 sp|P02185|MYG_PHYCD-i1 4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1216 ++eek+++ svwgkv+ +++ G++aL+rl+vvyP+t++yF++F++l++ ++v+g+ kvkahg+kvl+a+g+a+++ldd+k++lk Ls++Ha++l+vdpenfk l++vlv+vlaak++++ftp+vqa+++kl +++ al++ Y
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1217 HBB2_XENTR 4 TAEEKATIASVWGKVDIEQD--GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVWEKLNATLVAALSHGY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1218 579************99988..89********************************************************************************************************************9998 PP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1219
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1220 >> MYG_MUSAN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1221 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1222 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1223 1 ! 177.5 0.4 3.2e-55 3.2e-55 7 154 .] 2 148 .] 1 148 [] 0.99
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1224
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1225 Alignments for each domain:
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1226 == domain 1 score: 177.5 bits; conditional E-value: 3.2e-55
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1227 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1228 sp|P02185|MYG_PHYCD-i1 7 ekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1229 ++++v+svw+ ve+d ++iGq++L rlf++yPe++++F+kF++ ks e+k++a++ka++++vl+alg++vkk++++++ +k+L+++H+t++k++p++f++++++ v vl++++p+e++++vqaa++ ++++++++++++Yk+++fqg
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1230 MYG_MUSAN 2 DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEYKAANFQG 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1231 8*****************************************9.79*****************************************************************************************************8 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1232
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1233 >> HBA4_SALIR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1234 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1235 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1236 1 ! 176.2 0.1 8.3e-55 8.3e-55 3 148 .. 2 142 .] 1 142 [] 0.98
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1237
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1238 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1239 == domain 1 score: 176.2 bits; conditional E-value: 8.3e-55
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1240 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1241 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1242 ls+++k++vk++wgk+ +++eiG++aL+r++vvyP+tk yF+++ + gsa vk+hg +++++++++v ++ddl g l+kLselHatkl+vdp+nfk+l++ l+vv+aa fp+eftpe++ ++dk+l+++a ala+kY+
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1243 HBA4_SALIR 2 LSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASV-----APGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR 142
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1244 899***************************************999986.....69******************************************************************************************7 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1245
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1246 >> HBB2_TRICR
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1247 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1248 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1249 1 ! 123.1 0.0 1.8e-38 1.8e-38 3 147 .. 3 145 .] 1 145 [] 0.97
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1250
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1251 Alignments for each domain:
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1252 == domain 1 score: 123.1 bits; conditional E-value: 1.8e-38
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1253 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1254 sp|P02185|MYG_PHYCD-i1 3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1255 l++e+++ + ++ gkv++d+ +G++ L+rl+vv P++++yF F+dl+s +++ ++kv ahg kv+ ++ ea k+ld+l++ ++Ls +H k+ vdpenfkl s +++v la + +f+ + q a++kl++ v++al + Y
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1256 HBB2_TRICR 3 LTAEDRKEIAAILGKVNVDS--LGGQCLARLIVVNPWSRRYFHDFGDLSSCDAICRNPKVLAHGAKVMRSIVEATKHLDNLREYYADLSVTHSLKFYVDPENFKLFSGIVIVCLALTLQTDFSCHKQLAFEKLMKGVSHALGHGY 145
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1257 7899************9875..59*********************************************************************************************************************9988 PP
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1258
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1259
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1260
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1261 Internal pipeline statistics summary:
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1262 -------------------------------------
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1263 Query model(s): 1 (154 nodes)
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1264 Target sequences: 45 (6519 residues searched)
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1265 Passed MSV filter: 45 (1); expected 0.9 (0.02)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1266 Passed bias filter: 45 (1); expected 0.9 (0.02)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1267 Passed Vit filter: 45 (1); expected 0.0 (0.001)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1268 Passed Fwd filter: 45 (1); expected 0.0 (1e-05)
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1269 Initial search space (Z): 45 [actual number of targets]
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1270 Domain search space (domZ): 45 [number of targets reported over threshold]
5
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
1271 # CPU time: 0.22u 0.00s 00:00:00.22 Elapsed: 00:00:00.22
5113c71c7031 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
1272 # Mc/sec: 4.45
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1273
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1274 @@ New targets included: 1
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1275 @@ New alignment includes: 46 subseqs (was 45), including original query
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1276 @@ Continuing to next round.
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1277
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1278 @@
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1279 @@ Round: 3
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1280 @@ Included in MSA: 46 subsequences (query + 45 subseqs from 45 targets)
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1281 @@ Model size: 154 positions
0
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1282 @@
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1283
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1284 Scores for complete sequences (score includes all domains):
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1285 --- full sequence --- --- best 1 domain --- -#dom-
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1286 E-value score bias E-value score bias exp N Sequence Description
b23fd24e45a3 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1287 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1288 1.5e-69 224.0 0.1 1.7e-69 223.9 0.1 1.0 1 HBB_MANSP
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1289 4.6e-69 222.5 0.2 5e-69 222.3 0.2 1.0 1 HBB_URSMA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1290 2.5e-68 220.1 0.6 2.7e-68 220.0 0.6 1.0 1 HBB_RABIT
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1291 7.6e-68 218.5 0.0 8.3e-68 218.4 0.0 1.0 1 HBB_SUNMU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1292 9.5e-68 218.2 0.0 1.1e-67 217.9 0.0 1.0 1 HBB_COLLI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1293 1.4e-67 217.6 0.1 1.6e-67 217.5 0.1 1.0 1 HBB_EQUHE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1294 1.5e-67 217.6 0.3 1.6e-67 217.4 0.3 1.0 1 HBB_TACAC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1295 3.3e-67 216.5 0.7 3.6e-67 216.3 0.7 1.0 1 HBB_SPECI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1296 3.4e-67 216.4 0.1 3.8e-67 216.3 0.1 1.0 1 HBB_CALAR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1297 3.7e-67 216.3 0.4 4.1e-67 216.1 0.4 1.0 1 HBB_SPETO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1298 6.6e-67 215.5 0.0 7.2e-67 215.3 0.0 1.0 1 HBB_ORNAN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1299 8.4e-67 215.1 0.3 9.2e-67 215.0 0.3 1.0 1 HBE_PONPY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1300 2.3e-66 213.7 1.7 2.6e-66 213.5 1.7 1.0 1 MYG_ESCGI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1301 2.9e-66 213.4 0.1 3.2e-66 213.2 0.1 1.0 1 HBB_TRIIN
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1302 5.3e-66 212.5 0.0 6.4e-66 212.3 0.0 1.0 1 HBB_LARRI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1303 8.7e-66 211.8 1.6 9.6e-66 211.7 1.6 1.0 1 MYG_LYCPI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1304 1.8e-65 210.8 0.2 2e-65 210.6 0.2 1.0 1 MYG_PROGU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1305 2.5e-65 210.3 0.9 2.8e-65 210.2 0.9 1.0 1 MYG_SAISC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1306 2.6e-65 210.3 0.8 2.9e-65 210.1 0.8 1.0 1 MYG_HORSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1307 9.1e-65 208.5 0.2 1e-64 208.4 0.2 1.0 1 HBA_MESAU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1308 1.3e-64 208.0 0.3 1.4e-64 207.9 0.3 1.0 1 MYG_MOUSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1309 1.5e-64 207.8 0.0 1.7e-64 207.6 0.0 1.0 1 HBB_TUPGL
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1310 1.3e-63 204.7 0.5 1.5e-63 204.6 0.5 1.0 1 HBA_PONPY
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1311 2.9e-63 203.6 0.2 3.2e-63 203.5 0.2 1.0 1 HBA_MACFA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1312 4e-63 203.2 0.2 4.4e-63 203.0 0.2 1.0 1 HBA_MACSI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1313 5e-63 202.9 0.1 5.9e-63 202.6 0.1 1.0 1 HBB1_VAREX
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1314 5.7e-63 202.7 0.1 6.4e-63 202.5 0.1 1.0 1 HBA_AILME
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1315 8.6e-63 202.1 0.3 9.6e-63 201.9 0.3 1.0 1 HBA2_BOSMU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1316 1.8e-62 201.0 0.3 2e-62 200.9 0.3 1.0 1 HBA_FRAPO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1317 1.9e-62 201.0 0.4 2.1e-62 200.8 0.4 1.0 1 HBA2_GALCR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1318 2.1e-62 200.8 0.3 2.4e-62 200.7 0.3 1.0 1 HBA_PHACO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1319 4e-62 199.9 0.3 4.4e-62 199.8 0.3 1.0 1 HBA_ANSSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1320 4e-62 199.9 0.1 4.5e-62 199.8 0.1 1.0 1 HBA_ERIEU
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1321 8.3e-62 198.9 0.3 9.2e-62 198.8 0.3 1.0 1 HBA_PAGLA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1322 9.5e-62 198.7 0.0 1.1e-61 198.6 0.0 1.0 1 HBA_PROLO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1323 2.2e-61 197.5 0.4 2.4e-61 197.4 0.4 1.0 1 HBA_TRIOC
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1324 1.2e-60 195.1 0.5 1.3e-60 195.0 0.5 1.0 1 HBAD_CHLME
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1325 4.1e-60 193.4 0.1 4.5e-60 193.3 0.1 1.0 1 HBAZ_HORSE
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1326 6e-60 192.9 0.2 6.7e-60 192.7 0.2 1.0 1 HBA_COLLI
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1327 1.7e-59 191.4 0.2 2e-59 191.2 0.2 1.0 1 HBBL_RANCA
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1328 2.2e-59 191.0 0.1 2.4e-59 190.9 0.1 1.0 1 HBAD_PASMO
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1329 1.1e-58 188.8 0.6 1.3e-58 188.6 0.6 1.0 1 HBB2_XENTR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
1330 5.3e-56 180.0 0.1 5.9e-56 179.9 0.1 1.0 1 HBA4_SALIR
793967b6ae8a planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0