comparison test-data/uniprot_globins_match.out @ 0:b23fd24e45a3 draft

planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47

0:b23fd24e45a3

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  /tmp/tmpJW6ntL/files/000/dataset_1.dat
# target sequence database:        /tmp/tmpJW6ntL/files/000/dataset_2.dat
# per-seq hits tabular output:     /tmp/tmpJW6ntL/files/000/dataset_4.dat
# per-dom hits tabular output:     /tmp/tmpJW6ntL/files/000/dataset_5.dat
# pfam-style tabular hit output:   /tmp/tmpJW6ntL/files/000/dataset_6.dat
# max ASCII text line length:      unlimited
# Vit filter P threshold:       <= 0.001
# Fwd filter P threshold:       <= 1e-05
# random number seed set to:       4
# number of worker threads:        1
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       globins4  [M=149]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.8e-70  222.7   3.2      2e-70  222.6   3.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    9.2e-69  217.2   0.1      1e-68  217.0   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.6   3.2     2e-70     2e-70       2     149 .]       2     148 ..       1     148 [. 0.99

  Alignments for each domain:
  == domain 1  score: 222.6 bits;  conditional E-value: 2e-70
             globins4   2 vLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
                          vLse+e++ v++vWakveadv+++G+diL+rlfks+P+t+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++ea+lk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk
  sp|P02185|MYG_PHYCD   2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          8*****************************************************************************.99******************************************************************7 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.0   0.1     1e-68     1e-68       1     149 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 217.0 bits;  conditional E-value: 1e-68
             globins4   1 vvLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
                          v+L+++ek++v+a+W+kv  +v+e+G+++L rl++++P+tq+fFe+F+dLst+d+++++++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a va++la+kY+
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          69****************..*************************************************************.******************************************************************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                              1  (149 nodes)
Target sequences:                            2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: inf
//
[ok]