view test-data/jackhmmer.out @ 7:b28e8ed99424 draft default tip

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
author iuc
date Wed, 21 Jul 2021 14:11:12 +0000
parents b4fe2f703b4b
children
line wrap: on
line source

# jackhmmer :: iteratively search a protein sequence against a protein database
# HMMER 3.3.2 (Nov 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /tmp/tmpzdnl83p_/files/2/7/9/dataset_27979eae-6ed4-4ade-aa69-7ece7b993e22.dat
# target sequence database:        /tmp/tmpzdnl83p_/files/e/6/d/dataset_e6d4b38b-8770-49ed-98bb-842ce026d3c8.dat
# max ASCII text line length:      unlimited
# Vit filter P threshold:       <= 0.001
# Fwd filter P threshold:       <= 1e-05
# random number seed set to:       4
# number of worker threads:        0
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       sp|P02185|MYG_PHYCD  [L=154]
Description: Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2

Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
+   3.7e-96  310.8   5.1    4.1e-96  310.7   5.1    1.0  1  MYG_ESCGI   
+   1.2e-91  296.2   4.6    1.4e-91  296.0   4.6    1.0  1  MYG_HORSE   
+     1e-86  280.2   3.1    1.1e-86  280.0   3.1    1.0  1  MYG_PROGU   
+   8.4e-86  277.2   4.7    9.3e-86  277.1   4.7    1.0  1  MYG_SAISC   
+   1.4e-84  273.3   4.0    1.5e-84  273.1   4.0    1.0  1  MYG_LYCPI   
+   7.4e-84  270.9   1.8    8.1e-84  270.8   1.8    1.0  1  MYG_MOUSE   
+   2.3e-34  110.3   0.0    2.6e-34  110.2   0.0    1.0  1  MYG_MUSAN   
+   6.6e-17   53.7   0.0    7.5e-17   53.5   0.0    1.0  1  HBAZ_HORSE  
+   2.4e-14   45.4   0.0    2.8e-14   45.2   0.0    1.0  1  HBB_COLLI   
+   1.3e-13   43.0   0.0    1.5e-13   42.7   0.0    1.0  1  HBB_LARRI   
+   1.9e-12   39.2   0.1    2.3e-12   38.9   0.1    1.1  1  HBB2_XENTR  
+   3.1e-12   38.5   0.1    3.3e-12   38.5   0.1    1.0  1  HBB_ORNAN   
+   6.5e-12   37.5   0.3    6.9e-12   37.4   0.3    1.0  1  HBB_TRIIN   
+   8.4e-12   37.1   0.1    9.5e-12   36.9   0.1    1.0  1  HBE_PONPY   
+   1.1e-11   36.8   0.1    1.3e-11   36.6   0.1    1.0  1  HBB1_VAREX  
+   2.2e-11   35.8   0.5    2.4e-11   35.6   0.5    1.0  1  HBB_SPECI   
+   8.4e-11   33.9   0.2    8.9e-11   33.8   0.2    1.0  1  HBB_SPETO   
+   1.1e-10   33.4   0.2    1.2e-10   33.3   0.2    1.0  1  HBB_TACAC   
+   1.3e-10   33.3   0.0    1.4e-10   33.1   0.0    1.0  1  HBAD_PASMO  
+   1.4e-10   33.1   0.1    1.5e-10   33.1   0.1    1.0  1  HBB_SUNMU   
+   2.8e-10   32.2   0.1      3e-10   32.1   0.1    1.1  1  HBA_ERIEU   
+     6e-10   31.1   0.6    6.7e-10   31.0   0.6    1.1  1  HBA2_BOSMU  
+   6.1e-10   31.1   0.1    6.9e-10   30.9   0.1    1.1  1  HBAD_CHLME  
+   6.6e-10   31.0   0.1      7e-10   30.9   0.1    1.0  1  HBB_URSMA   
+   7.7e-10   30.7   0.2    9.5e-10   30.5   0.2    1.1  1  HBBL_RANCA  
+   8.5e-10   30.6   0.2      9e-10   30.5   0.2    1.0  1  HBB_EQUHE   
+   2.2e-09   29.3   0.2    2.4e-09   29.1   0.2    1.1  1  HBA_AILME   
+   3.1e-09   28.8   0.0    3.3e-09   28.7   0.0    1.0  1  HBB_TUPGL   
+   4.6e-09   28.2   0.1    5.4e-09   28.0   0.1    1.0  1  HBA4_SALIR  
+   4.8e-09   28.2   0.2    5.4e-09   28.0   0.2    1.1  1  HBA2_GALCR  
+   7.5e-09   27.6   0.4    8.2e-09   27.4   0.4    1.1  1  HBA_MESAU   
+   9.2e-09   27.3   0.1    1.1e-08   27.1   0.1    1.0  1  HBB_MANSP   
+   1.1e-08   27.0   0.3    1.2e-08   26.9   0.3    1.1  1  HBA_PONPY   
+   1.1e-08   27.0   0.2    1.3e-08   26.8   0.2    1.1  1  HBA_PAGLA   
+   1.2e-08   26.9   0.2    1.3e-08   26.7   0.2    1.1  1  HBA_ANSSE   
+   2.5e-08   25.8   0.3    2.7e-08   25.7   0.3    1.0  1  HBB_RABIT   
+   3.9e-08   25.2   0.1    4.2e-08   25.1   0.1    1.1  1  HBA_PROLO   
+     4e-08   25.2   0.3    4.5e-08   25.0   0.3    1.1  1  HBA_MACSI   
+   5.3e-08   24.8   0.4      6e-08   24.6   0.4    1.1  1  HBA_MACFA   
+   8.9e-08   24.1   0.1      1e-07   23.8   0.1    1.0  1  HBB_CALAR   
+   2.3e-07   22.7   0.2    2.6e-07   22.5   0.2    1.1  1  HBA_TRIOC   
+   2.5e-07   22.6   0.3    2.9e-07   22.4   0.3    1.1  1  HBA_FRAPO   
+   3.9e-07   22.0   0.3    4.4e-07   21.8   0.3    1.1  1  HBA_PHACO   
+   1.7e-05   16.6   0.2    1.9e-05   16.5   0.2    1.1  1  HBA_COLLI   


Domain annotation for each sequence (and alignments):
>> MYG_ESCGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  310.7   5.1     4e-96   4.1e-96       2     154 .]       1     153 []       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 310.7 bits;  conditional E-value: 4e-96
  sp|P02185|MYG_PHYCD   2 vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          vls++ewqlvl++wakveadvaghgqdilirlfk hpetlekfd+fkhlkteaemkasedlkkhg tvltalg ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhsrhpgdfgadaq+amnkalelfrkdiaakykelg+qg
            MYG_ESCGI   1 VLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 153
                          79******************************************************************************************************************************************************8 PP

>> MYG_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  296.0   4.6   1.3e-91   1.4e-91       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 296.0 bits;  conditional E-value: 1.3e-91
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          ls+gewq vl+vw kvead+aghgq++lirlf  hpetlekfd+fkhlkteaemkasedlkkhg  vltalg ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhs+hpg+fgadaqgam kalelfr diaakykelg+qg
            MYG_HORSE   2 LSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153
                          89*****************************************************************************************************************************************************8 PP

>> MYG_PROGU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  280.0   3.1   1.1e-86   1.1e-86       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 280.0 bits;  conditional E-value: 1.1e-86
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          ls+gewqlvl+vw kve d++ghgq++lirlfk hpetlekfd+fkhlk e em+ase+lkkhg tvltalg ilkkkg+h ael plaqshatkhkip+kylefiseaii+vl+s+hpgdfgadaqgam+kalelfr diaakykelg+qg
            MYG_PROGU   2 LSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                          89*****************************************************************************************************************************************************8 PP

>> MYG_SAISC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  277.1   4.7     9e-86   9.3e-86       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 277.1 bits;  conditional E-value: 9e-86
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          ls+gewqlvl++w kvead+ +hgq++li lfk hpetlekfd+fkhlk+e emkase+lkkhg tvltalg ilkkkg+heaelkplaqshatkhkip+kyle+is+ai+hvl+ +hpgdfgadaqgam kalelfr d+aakykelg+qg
            MYG_SAISC   2 LSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153
                          89*****************************************************************************************************************************************************8 PP

>> MYG_LYCPI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  273.1   4.0   1.5e-84   1.5e-84       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 273.1 bits;  conditional E-value: 1.5e-84
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          ls+gewq+vl++w kve d+aghgq++lirlfk+hpetl+kfd+fkhlkte emk sedlkkhg tvltalg ilkkkghheaelkplaqshatkhkip+kylefis+aii+vl+++h gdf ad ++am kalelfr diaakykelg+qg
            MYG_LYCPI   2 LSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153
                          89*****************************************************************************************************************************************************8 PP

>> MYG_MOUSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  270.8   1.8   7.9e-84   8.1e-84       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 270.8 bits;  conditional E-value: 7.9e-84
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          ls+gewqlvl+vw kvead+aghgq++li lfk+hpetl+kfd+fk+lk+e +mk sedlkkhg tvltalg ilkkkg+h ae++plaqshatkhkip+kylefise ii+vl  rh gdfgadaqgam+kalelfr diaakykelg+qg
            MYG_MOUSE   2 LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                          89*****************************************************************************************************************************************************8 PP

>> MYG_MUSAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.2   0.0   2.5e-34   2.6e-34       7     154 .]       2     148 .]       1     148 [] 0.98

  Alignments for each domain:
  == domain 1  score: 110.2 bits;  conditional E-value: 2.5e-34
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakykelgyqg 154
                          +w+ v  vw+ ve+d+ + gq+il+rlf+ +pe+   f +fk+ k+  e+k + d+k ++ tvl+alg i+kkkg h   +k la +h t hkip  y+  i+   + vl   +p++++a  q+a++ a++++  di  +yk  ++qg
            MYG_MUSAN   2 DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEYKAANFQG 148
                          7*****************************************8.7889************************************************************************************************9998 PP

>> HBAZ_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   53.5   0.0   7.3e-17   7.5e-17       3     148 ..       2     141 .]       1     141 [] 0.91

  Alignments for each domain:
  == domain 1  score: 53.5 bits;  conditional E-value: 7.3e-17
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                          l+++e  +v+ +w k+     + g + l rlf s+p+t   f +f         + s  l+ hg  v  a+g  +k   +    l  l++ ha   ++    ++f+s  ++  l sr p+df ada +a +k l +    +  ky+
           HBAZ_HORSE   2 LTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDL------HEGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR 141
                          56788899********9999999***************988877752......3578899*********************************99999777789*******************************99998888885 PP

>> HBB_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   45.2   0.0   2.7e-14   2.8e-14       6     147 ..       6     145 ..       2     146 .] 0.95

  Alignments for each domain:
  == domain 1  score: 45.2 bits;  conditional E-value: 2.7e-14
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e ql+  +w kv  +va  g + l rl+  +p t   f  f +l +   +  + ++k hg  vlt++g  +k   + +  +  l++ h  k  +  + + ++ + ++ +l ++   df  + q+a  k + +    +a ky
            HBB_COLLI   6 EEKQLITSIWGKV--NVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKY 145
                          5889********8..589999***********************************************************************999999999*******999999999**************99999999998 PP

>> HBB_LARRI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.7   0.0   1.5e-13   1.5e-13       6     147 ..       6     145 ..       2     146 .] 0.95

  Alignments for each domain:
  == domain 1  score: 42.7 bits;  conditional E-value: 1.5e-13
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e ql+  +w kv  +va  g + l rl+  +p t   f  f +l +   +  +  ++ hg  vlt++g  +k   + +  +  l++ h  k  +  + + ++ + +i vl ++   df  d+q+a  k + +    +a ky
            HBB_LARRI   6 EEKQLITGLWGKV--NVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKY 145
                          5789********8..589999***********************************************************************99999999*******************************99999999998 PP

>> HBB2_XENTR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.9   0.1   2.3e-12   2.3e-12      10     132 ..      10     130 ..       4     140 .. 0.87

  Alignments for each domain:
  == domain 1  score: 38.9 bits;  conditional E-value: 2.3e-12
  sp|P02185|MYG_PHYCD  10 lvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgam 132
                           +  vw kv+ +    g d l rl+  +p t   f  f +l   + +  +  +k hg  vl+a+g+ ++     ++ lk l++sha    +  + ++ +++ ++ vl ++  + f    q+  
           HBB2_XENTR  10 TIASVWGKVDIEQD--GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVW 130
                          5778****976665..5599******************************************************************9877777777889999999999888777777777655 PP

>> HBB_ORNAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.5   0.1   3.2e-12   3.3e-12       3     137 ..       3     135 ..       1     146 [] 0.90

  Alignments for each domain:
  == domain 1  score: 38.5 bits;  conditional E-value: 3.2e-12
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkale 137
                          ls ge   v ++w kv  +    g + l rl+  +p t   f+ f  l +   +  +  +k hg  vlt++g  lk     +  +  l++ h  k  +  + +  +   +i vl  +   df+ + q+a  k + 
            HBB_ORNAN   3 LSGGEKSAVTNLWGKVNINEL--GGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVS 135
                          7899************87765..56889*******************************************************************8888888899999999999888899*********999776 PP

>> HBB_TRIIN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.4   0.3   6.8e-12   6.9e-12       6     147 ..       6     145 ..       1     146 [] 0.90

  Alignments for each domain:
  == domain 1  score: 37.4 bits;  conditional E-value: 6.8e-12
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e  lv+ +wakv   v  +g + l rl+  +p t   f++f  l + + +  +  +k hg  v+t++g  lk     +  +  l++ h  k  +  + + ++   ++ vl  +   +f+ +aq+a  k +      +a ky
            HBB_TRIIN   6 EEKALVIGLWAKVN--VKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKY 145
                          57789*******95..778999**************************9999**********************999999************999999999*******9996555569**********99987777777776 PP

>> HBE_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.9   0.1   9.3e-12   9.5e-12       9     147 ..       9     145 ..       3     146 .] 0.91

  Alignments for each domain:
  == domain 1  score: 36.9 bits;  conditional E-value: 9.3e-12
  sp|P02185|MYG_PHYCD   9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                            v  +w+k+  + ag   + l rl+  +p t   fd f +l + + +  +  +k hg  vlt++g  +k   + +  +  l++ h  k  +  + ++++   ++ +l ++   +f  + q+a  k +      +a ky
            HBE_PONPY   9 AAVTSLWSKMNVEEAG--GEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 145
                          567889***9998886..57899******************************************************************99999999********999999899***********99888777777766 PP

>> HBB1_VAREX  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.6   0.1   1.2e-11   1.3e-11       7     147 ..       7     145 ..       3     146 .] 0.91

  Alignments for each domain:
  == domain 1  score: 36.6 bits;  conditional E-value: 1.2e-11
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          e ql+  +w k++  +   g + l  l+  +p t  +f +f +l +   +  +  +k hg  vlt++g  +k   + +  +  l++ h  k  +    ++++   ++ vl  +h  +f     +a  k + +    +a +y
           HBB1_VAREX   7 EKQLICSLWGKIDVGLI--GGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRY 145
                          789********977666..5678999****************************************************************98887777899*****************99999999999999988888877 PP

>> HBB_SPECI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.6   0.5   2.3e-11   2.4e-11       3     147 ..       3     145 ..       1     146 [] 0.91

  Alignments for each domain:
  == domain 1  score: 35.6 bits;  conditional E-value: 2.3e-11
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls+ge   +   w kv a     g + l rl+  +p t   fd f  l + + +  +  +k hg  v+ +++  lk   + +  +  l++ h  k  +  + ++++   i+ v+  +   df  +aq+a+ k +      +a ky
            HBB_SPECI   3 LSDGEKNAISTAWGKVHAA--EVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKY 145
                          89**************985..557899********************************************************************9999999999*99999887655566************9988777777777 PP

>> HBB_SPETO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.8   0.2   8.7e-11   8.9e-11       3     144 ..       3     142 ..       1     146 [] 0.89

  Alignments for each domain:
  == domain 1  score: 33.8 bits;  conditional E-value: 8.7e-11
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdia 144
                          l++ge   +   w kv a  a  g + l rl+  +p t   fd f  l + + +  +  +k hg  v+ +++  lk   + +  +  l++ h  k  +  + ++++   i+ v+  +   df  +aq+a+ k +      ++
            HBB_SPETO   3 LTDGEKNAISTAWGKVNA--AEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALS 142
                          7899***********987..566899*********************************************************************9999999999*99999887655566**********998866655555 PP

>> HBB_TACAC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.3   0.2   1.2e-10   1.2e-10       3     147 ..       3     145 ..       1     146 [] 0.89

  Alignments for each domain:
  == domain 1  score: 33.3 bits;  conditional E-value: 1.2e-10
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls +e   v ++w  v  +    g + l rl+  +p t   f+ f  l +   +  +  +k hg  vlt++g  lk   + +  +  l++ h  k  +  + +  +   ++ vl  +   +f  +aq+a  k +      +a ky
            HBB_TACAC   3 LSGSEKTAVTNLWGHVNVNEL--GGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKY 145
                          566777889999*99987665..56899********************9998999999*************************************8888888899999999999877789**********999887777777766 PP

>> HBAD_PASMO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.1   0.0   1.4e-10   1.4e-10       7     148 ..       6     141 .]       1     141 [] 0.90

  Alignments for each domain:
  == domain 1  score: 33.1 bits;  conditional E-value: 1.4e-10
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                          + +l+ ++w k+       g d l r+f s+p t   f +f         + s+ ++ hg  v+ al+  +k   +    l  l+  ha   ++    ++f+s+ +   l +r   +++ +  +a++k +      +a ky+
           HBAD_PASMO   6 DKKLIQQIWGKLGGAEEEIGADALWRMFHSYPSTKTYFPHFDL------SQGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKYR 141
                          568999******999999****************988877742......368999************************************999777789******999********************9999999999985 PP

>> HBB_SUNMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.1   0.1   1.5e-10   1.5e-10       6     147 ..       6     145 ..       1     146 [] 0.92

  Alignments for each domain:
  == domain 1  score: 33.1 bits;  conditional E-value: 1.5e-10
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e   v  +w kv  d  g   + l rl+  +p t   fd f  l + + +  +  +k hg  vl +lg  +    + +  +  l++ h  k  +  + + ++   ++ vl s+   +f    q+a+ k +      +a ky
            HBB_SUNMU   6 EEKACVTGLWGKVNEDEVG--AEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKY 145
                          456678899******9875..789********************************************************************999999999***************************99987777777776 PP

>> HBA_ERIEU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.1   0.1     3e-10     3e-10      11     147 ..      10     140 ..       1     141 [] 0.86

  Alignments for each domain:
  == domain 1  score: 32.1 bits;  conditional E-value: 3e-10
  sp|P02185|MYG_PHYCD  11 vlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          v   w k+      +g + l r+f++hp t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l  +hp+df     ++++k l      + +ky
            HBA_ERIEU  10 VKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLN------PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKY 140
                          667899999999999**************99888777533......35667899***********9***99**************999997777799*******************999999999998888888887 PP

>> HBA2_BOSMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.0   0.6   6.5e-10   6.7e-10       7     147 ..       6     140 ..       1     141 [] 0.82

  Alignments for each domain:
  == domain 1  score: 31.0 bits;  conditional E-value: 6.5e-10
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          +   v   w kv    a +g + l r+f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s +++  l s+ p+df     ++++k l      + +ky
           HBA2_BOSMU   6 DKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKY 140
                          55567789**************************9888877543......45667899***9998877666666666789999******999997677799******************9999999999887777777776 PP

>> HBAD_CHLME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.9   0.1   6.8e-10   6.9e-10       6     148 ..       5     141 .]       1     141 [] 0.88

  Alignments for each domain:
  == domain 1  score: 30.9 bits;  conditional E-value: 6.8e-10
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                           + +l+ ++w kv       g + l r+f ++p+t   f +f           se ++ hg  v  alg  +k   +    l  l+  ha   ++    ++++++ +  vl ++   d++ +  +a++k l      +a ky+
           HBAD_CHLME   5 DDKKLLTQLWEKVAGHQEEFGSEALQRMFLTYPQTKTYFPHFD---L---HPGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKYR 141
                          56689999***************************98877664...3...357999**************************************99999999*9998877776666699999999999999999988888885 PP

>> HBB_URSMA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.9   0.1   6.8e-10     7e-10       6     147 ..       6     145 ..       1     146 [] 0.90

  Alignments for each domain:
  == domain 1  score: 30.9 bits;  conditional E-value: 6.8e-10
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e  lv  +w kv  d  g   + l rl+  +p t   fd f  l +   +  +  +k hg  vl +++  lk   + +  +  l++ h  k  +  + ++++   ++ vl  +   +f    q+a  k +      +a ky
            HBB_URSMA   6 EEKSLVTGLWGKVNVDEVG--GEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                          4678999*******99876..57899*******************99888889999************************************99999999**********98888889********9999887777777776 PP

>> HBBL_RANCA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.5   0.2   9.3e-10   9.5e-10       9     136 ..       9     134 ..       3     145 .. 0.87

  Alignments for each domain:
  == domain 1  score: 30.5 bits;  conditional E-value: 9.3e-10
  sp|P02185|MYG_PHYCD   9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkal 136
                           ++  vw kv+ +  gh  + l rlf  +p t   f  f  l + a +  +  +  hg  +l a+   +      +  l  l++ ha +  +  + +  + e +i vl ++    f+   q    k +
           HBBL_RANCA   9 AVINSVWQKVDVEQDGH--EALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFI 134
                          456689***97776665..89*********************************************9999******************988888888899*******999988888888877766655 PP

>> HBB_EQUHE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.5   0.2   8.8e-10     9e-10       4     147 ..       4     145 ..       1     146 [] 0.87

  Alignments for each domain:
  == domain 1  score: 30.5 bits;  conditional E-value: 8.8e-10
  sp|P02185|MYG_PHYCD   4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          s  e   vl +w kv  +  g   + l rl+  +p t   fd f  l   a +  +  +k hg  vl ++g  +    + +  +  l++ h  k  +  + + ++   ++ vl  +   df  + q++  k +      +a ky
            HBB_EQUHE   4 SGEEKAAVLALWDKVNEEEVG--GEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKY 145
                          55566789*******877664..46899********************************************99999999999999********9998899999*999998886555559******999999887777777776 PP

>> HBA_AILME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.1   0.2   2.4e-09   2.4e-09       4     147 ..       3     140 ..       1     141 [] 0.80

  Alignments for each domain:
  == domain 1  score: 29.1 bits;  conditional E-value: 2.4e-09
  sp|P02185|MYG_PHYCD   4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          s ++   v   w k+      +g + l r f s p t   f +f      a++      k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l s+hp++f     ++++k +      + +ky
            HBA_AILME   3 SPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPGSAQV------KAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKY 140
                          55666667789*******999****************9999888766655555......556666666666666555666678999******999997777799*****************99999999998887777777777 PP

>> HBB_TUPGL  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.7   0.0   3.2e-09   3.3e-09       6     147 ..       6     145 ..       1     146 [] 0.89

  Alignments for each domain:
  == domain 1  score: 28.7 bits;  conditional E-value: 3.2e-09
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                           e   v  +w kv+ +  g gq  l  l+  +p t   fd f  l + + + ++  +k hg  vlt+++  l    + +  +  l++ h  k  +  + + ++   +++vl  +   +f    q+a+ k +      +a ky
            HBB_TUPGL   6 EEKAAVTGLWGKVDLEKVG-GQS-LGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKY 145
                          455678899****999887.666.55677789************************************************************99999999***************99***********99887777777776 PP

>> HBA4_SALIR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.0   0.1   5.2e-09   5.4e-09      11     148 ..      10     142 .]       2     142 .] 0.88

  Alignments for each domain:
  == domain 1  score: 28.0 bits;  conditional E-value: 5.2e-09
  sp|P02185|MYG_PHYCD  11 vlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                          v  +w k+       g+  l r++  +p+t   f    h  + a    s  +kkhg+t++  +   +         l  l++ hatk ++    +++++  +i v+ +  p++f  +   +++k l+ +   +a ky+
           HBA4_SALIR  10 VKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYF---SHWASVA--PGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR 142
                          5679999998888999**************8765...5665555..46779***********99999888888899**************99999*******************************999999999985 PP

>> HBA2_GALCR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.0   0.2   5.3e-09   5.4e-09       7     147 ..       6     140 ..       1     141 [] 0.83

  Alignments for each domain:
  == domain 1  score: 28.0 bits;  conditional E-value: 5.3e-09
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          +   v   w kv a    +g + l r+f s p t   f +f           s  +k hg  v  al   +       + l  l+  ha k ++    ++++   ++  l  +hp++f     ++++k +      + +ky
           HBA2_GALCR   6 DKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDL------SHGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKY 140
                          55567789*************************9988877743......346788999*******997655566777888*********9999976677899****************99999999998877777777776 PP

>> HBA_MESAU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.4   0.4     8e-09   8.2e-09       9     147 ..       8     140 ..       1     141 [] 0.81

  Alignments for each domain:
  == domain 1  score: 27.4 bits;  conditional E-value: 8e-09
  sp|P02185|MYG_PHYCD   9 qlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                            + + w k+      +g + l r+f  +p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l ++hp+df     ++++k +      + +ky
            HBA_MESAU   8 TNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVS------HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKY 140
                          556789*************************99888777543......3566678899999988877777777778899********999997777799*****************99999999887766666666665 PP

>> HBB_MANSP  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.1   0.1     1e-08   1.1e-08       8     147 ..       8     145 ..       2     146 .] 0.90

  Alignments for each domain:
  == domain 1  score: 27.1 bits;  conditional E-value: 1e-08
  sp|P02185|MYG_PHYCD   8 wqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                             v  +w kv  d  g   + l rl+  +p t   fd f  l +   +  +  +k hg  vl a++  l    + +  +  l++ h  k  +  + ++++   ++ vl  +   +f    q+a  k +      +a ky
            HBB_MANSP   8 KTAVTTLWGKVNVDEVG--GEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                          5567889*****99876..57899*********************99999****************************************99999999**********98888889********9999887777777776 PP

>> HBA_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.9   0.3   1.2e-08   1.2e-08       3     147 ..       2     140 ..       1     141 [] 0.85

  Alignments for each domain:
  == domain 1  score: 26.9 bits;  conditional E-value: 1.2e-08
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   v   w kv a    +g + l r+f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l ++ p++f     ++++k l      + +ky
            HBA_PONPY   2 LSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          555666667889*************************99888877543......45667899******9998888888888889*********999997777799******************9999999999988877777777 PP

>> HBA_PAGLA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.8   0.2   1.3e-08   1.3e-08       3     147 ..       2     140 ..       1     141 [] 0.82

  Alignments for each domain:
  == domain 1  score: 26.8 bits;  conditional E-value: 1.3e-08
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   +   w k+ +    +g + l r f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l  +hp++f     +a++k +      + +ky
            HBA_PAGLA   2 LSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLSHG------SAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKY 140
                          666677778889**************************999888865544......45566788888888776655444555679999*******9997777899******************9999999999888777777777 PP

>> HBA_ANSSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.7   0.2   1.3e-08   1.3e-08       8     148 ..       7     141 .]       1     141 [] 0.85

  Alignments for each domain:
  == domain 1  score: 26.7 bits;  conditional E-value: 1.3e-08
  sp|P02185|MYG_PHYCD   8 wqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                             v  v+ k+      +g + l r+f++ p+t   f +f           s  +k hg  v  al             l  l+  ha k ++    ++f+   ++ vl  +hp+ +  +  ++m+k l      + aky+
            HBA_ANSSE   7 KGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQ------PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKYR 141
                          55567789999999999****************9888777543......356678889999999988888888888899*************9777789****************************99999888888885 PP

>> HBB_RABIT  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.7   0.3   2.7e-08   2.7e-08       3     147 ..       3     145 ..       1     146 [] 0.89

  Alignments for each domain:
  == domain 1  score: 25.7 bits;  conditional E-value: 2.7e-08
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls  e   v  +w kv  +  g   + l rl+  +p t   f+ f  l +   +  +  +k hg  vl a++  l    + +  +  l++ h  k  +  + + ++   ++ vl  +   +f    q+a  k +      +a ky
            HBB_RABIT   3 LSSEEKSAVTALWGKVNVEEVG--GEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                          56677888999*****887665..57899*******************99988999999************************************999989999***99999997767779********9999887777777776 PP

>> HBA_PROLO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.1   0.1   4.2e-08   4.2e-08       6     147 ..       5     140 ..       1     141 [] 0.82

  Alignments for each domain:
  == domain 1  score: 25.1 bits;  conditional E-value: 4.2e-08
  sp|P02185|MYG_PHYCD   6 gewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ++   +   w k+      +g + l r f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l  +hp++f     ++++k +      + +ky
            HBA_PROLO   5 ADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLSPG------SAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKY 140
                          555566778*******999****************998888865444......5556778888888888877777778889************997777899*****************99999998887766666666665 PP

>> HBA_MACSI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.0   0.3   4.4e-08   4.5e-08       3     147 ..       2     140 ..       1     141 [] 0.85

  Alignments for each domain:
  == domain 1  score: 25.0 bits;  conditional E-value: 4.4e-08
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   v   w kv      +g + l r+f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l ++ p++f     ++++k l      + +ky
            HBA_MACSI   2 LSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          566666678899**************************9888877643......35667889999999999888877777888999*******999997677799******************9999999999988877777777 PP

>> HBA_MACFA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.6   0.4   5.8e-08     6e-08       3     147 ..       2     140 ..       1     141 [] 0.84

  Alignments for each domain:
  == domain 1  score: 24.6 bits;  conditional E-value: 5.8e-08
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   v   w kv      +g + l r+f s p t   f +f           s  +k hg  v  al   +         l  l+  ha k ++    ++++s  ++  l ++ p++f     ++++k l      + +ky
            HBA_MACFA   2 LSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          555666667789**************************9888877643......35667889999999999888877777888999*******999997677799******************9999999999988877777777 PP

>> HBB_CALAR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.8   0.1     1e-07     1e-07       7     147 ..       7     145 ..       2     146 .] 0.89

  Alignments for each domain:
  == domain 1  score: 23.8 bits;  conditional E-value: 1e-07
  sp|P02185|MYG_PHYCD   7 ewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          e   v  +w kv  d  g   + l rl+  +p t   f+ f  l t   +  +  +k hg  vl a++  l    + +  +  l++ h  k  +  + + ++   ++ vl  +   +f    q+a  k +      +a ky
            HBB_CALAR   7 EKSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKY 145
                          45668889*****99876..57899*********************99999999*************************************999999999*********98877889999999999998877777777666 PP

>> HBA_TRIOC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.5   0.2   2.5e-07   2.6e-07       4     148 ..       3     141 .]       1     141 [] 0.84

  Alignments for each domain:
  == domain 1  score: 22.5 bits;  conditional E-value: 2.5e-07
  sp|P02185|MYG_PHYCD   4 segewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                          s ++   v  v+ k+      +g + l r+f ++p t   f +f           s  +k hg  v+ al   +         l  l+  ha k ++    ++++ + ++ v+  +hp+ +  +  ++++k l      ++aky+
            HBA_TRIOC   3 SANDKTNVKTVFTKITGHAEDYGAETLERMFITYPPTKTYFPHFDLH------HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKYR 141
                          55566667789999999999*****************9988877543......3566778899999877766666666677899************97777899***************************99999999999985 PP

>> HBA_FRAPO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.4   0.3   2.8e-07   2.9e-07       3     148 ..       2     141 .]       1     141 [] 0.86

  Alignments for each domain:
  == domain 1  score: 22.4 bits;  conditional E-value: 2.8e-07
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaakyk 148
                          ls ++   v  ++ k+ +    +g + l r+f ++p t   f +f           s  +k hg  v+ al             l  l+  ha k ++    ++++ + ++ v+  +hp+ +  +  ++++k l      + aky+
            HBA_FRAPO   2 LSAADKNNVKGIFGKISSHAEDYGAEALERMFITYPSTKTYFPHFDLS------HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKYR 141
                          6666667788899*************************9988877543......35667889****999988777777778899*********999997677799***************************99988888888885 PP

>> HBA_PHACO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   21.8   0.3   4.3e-07   4.4e-07       3     147 ..       2     140 ..       1     141 [] 0.86

  Alignments for each domain:
  == domain 1  score: 21.8 bits;  conditional E-value: 4.3e-07
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   v  ++ k+      +g + l r+f ++p t   f +f           s  +k hg  v+ al   +         l  l+  ha k ++    ++++ + ++ v+  +hp+ +  +  ++++k l      + aky
            HBA_PHACO   2 LSAADKNNVKGIFTKIAGHAEEYGAEALERMFITYPSTKTYFPHFDLS------HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKY 140
                          56666667778899999999999***************9988877543......45677899******999999999999999**********999997677799**************************99988888888888 PP

>> HBA_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.5   0.2   1.9e-05   1.9e-05       3     147 ..       2     140 ..       1     141 [] 0.80

  Alignments for each domain:
  == domain 1  score: 16.5 bits;  conditional E-value: 1.9e-05
  sp|P02185|MYG_PHYCD   3 lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalelfrkdiaaky 147
                          ls ++   v  v+ak+       g + l rlf ++p+t   f +f           s  +k hg  v  al             l  l+  ha k ++    ++++   ++ v+  + p+ +  +  ++++k +      + aky
            HBA_COLLI   2 LSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS------HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKY 140
                          666677778899*****999999***************9988877543......456678999999999998888888888899999*******999966667888888888888888888888877777776666666666666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (154 nodes)
Target sequences:                         45  (6519 residues searched)
Passed MSV filter:                        45  (1); expected 0.9 (0.02)
Passed bias filter:                       45  (1); expected 0.9 (0.02)
Passed Vit filter:                        45  (1); expected 0.0 (0.001)
Passed Fwd filter:                        44  (0.977778); expected 0.0 (1e-05)
Initial search space (Z):                 45  [actual number of targets]
Domain search space  (domZ):              44  [number of targets reported over threshold]
# CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 28.10

@@ New targets included:   44
@@ New alignment includes: 45 subseqs (was 1), including original query
@@ Continuing to next round.

@@
@@ Round:                  2
@@ Included in MSA:        45 subsequences (query + 44 subseqs from 44 targets)
@@ Model size:             154 positions
@@

Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.5e-68  219.3   2.1    4.9e-68  219.1   2.1    1.0  1  MYG_ESCGI   
    5.1e-68  219.1   0.1    5.6e-68  218.9   0.1    1.0  1  HBB_MANSP   
    1.6e-67  217.5   2.0    1.7e-67  217.3   2.0    1.0  1  MYG_LYCPI   
    2.2e-67  217.0   0.2    2.4e-67  216.9   0.2    1.0  1  HBB_URSMA   
    2.7e-67  216.7   0.3      3e-67  216.6   0.3    1.0  1  MYG_PROGU   
    3.6e-67  216.3   1.1      4e-67  216.2   1.1    1.0  1  MYG_HORSE   
      4e-67  216.2   0.7    4.4e-67  216.0   0.7    1.0  1  HBB_RABIT   
    8.5e-67  215.1   0.8    9.4e-67  215.0   0.8    1.0  1  HBB_SPECI   
    8.6e-67  215.1   1.2    9.5e-67  214.9   1.2    1.0  1  MYG_SAISC   
    9.6e-67  214.9   0.1      1e-66  214.8   0.1    1.0  1  HBB_SUNMU   
    1.2e-66  214.6   0.0    1.3e-66  214.4   0.0    1.0  1  HBB_COLLI   
    1.4e-66  214.4   0.1    1.5e-66  214.3   0.1    1.0  1  HBB_EQUHE   
    2.2e-66  213.7   0.4    2.5e-66  213.6   0.4    1.0  1  MYG_MOUSE   
    3.7e-66  213.0   0.3      4e-66  212.9   0.3    1.0  1  HBB_TACAC   
      4e-66  212.9   0.5    4.4e-66  212.8   0.5    1.0  1  HBB_SPETO   
    1.3e-65  211.2   0.4    1.5e-65  211.1   0.4    1.0  1  HBE_PONPY   
    1.6e-65  211.0   0.1    1.7e-65  210.9   0.1    1.0  1  HBB_CALAR   
    2.2e-65  210.5   0.0    2.4e-65  210.4   0.0    1.0  1  HBB_ORNAN   
    4.2e-65  209.6   0.2    4.6e-65  209.5   0.2    1.0  1  HBA_MESAU   
    8.8e-65  208.5   0.0    9.6e-65  208.4   0.0    1.0  1  HBB_LARRI   
    1.1e-64  208.2   0.1    1.2e-64  208.1   0.1    1.0  1  HBB_TRIIN   
    1.7e-64  207.6   0.5    1.9e-64  207.4   0.5    1.0  1  HBA_PONPY   
    4.9e-64  206.1   0.2    5.5e-64  206.0   0.2    1.0  1  HBA_MACFA   
    6.2e-64  205.8   0.2    6.8e-64  205.7   0.2    1.0  1  HBA_MACSI   
    9.2e-64  205.2   0.1      1e-63  205.1   0.1    1.0  1  HBA_AILME   
    3.1e-63  203.5   0.3    3.4e-63  203.4   0.3    1.0  1  HBA_FRAPO   
    3.1e-63  203.5   0.3    3.5e-63  203.4   0.3    1.0  1  HBA_PHACO   
    3.4e-63  203.4   0.3    3.8e-63  203.2   0.3    1.0  1  HBA2_BOSMU  
    3.7e-63  203.3   0.4    4.1e-63  203.1   0.4    1.0  1  HBA2_GALCR  
    3.8e-63  203.3   0.0    4.1e-63  203.1   0.0    1.0  1  HBB_TUPGL   
    1.1e-62  201.7   0.4    1.2e-62  201.6   0.4    1.0  1  HBA_ANSSE   
    1.1e-62  201.7   0.3    1.2e-62  201.6   0.3    1.0  1  HBA_PAGLA   
      2e-62  200.9   0.1    2.2e-62  200.8   0.1    1.0  1  HBA_ERIEU   
    2.1e-62  200.8   0.0    2.3e-62  200.7   0.0    1.0  1  HBA_PROLO   
    4.2e-62  199.9   0.4    4.6e-62  199.7   0.4    1.0  1  HBA_TRIOC   
    9.3e-62  198.7   0.1    1.1e-61  198.5   0.1    1.0  1  HBB1_VAREX  
    5.9e-61  196.1   0.4    6.5e-61  196.0   0.4    1.0  1  HBAD_CHLME  
    9.8e-61  195.4   0.1    1.1e-60  195.3   0.1    1.0  1  HBAZ_HORSE  
    2.2e-60  194.2   0.2    2.5e-60  194.1   0.2    1.0  1  HBA_COLLI   
    1.5e-59  191.5   0.1    1.7e-59  191.4   0.1    1.0  1  HBAD_PASMO  
    1.3e-57  185.2   0.2    1.6e-57  185.0   0.2    1.0  1  HBBL_RANCA  
      3e-56  180.9   0.7    3.5e-56  180.6   0.7    1.0  1  HBB2_XENTR  
    2.9e-55  177.6   0.4    3.2e-55  177.5   0.4    1.0  1  MYG_MUSAN   
    7.5e-55  176.3   0.1    8.3e-55  176.2   0.1    1.0  1  HBA4_SALIR  
+   1.7e-38  123.2   0.0    1.8e-38  123.1   0.0    1.0  1  HBB2_TRICR  


Domain annotation for each sequence (and alignments):
>> MYG_ESCGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.1   2.1   4.9e-68   4.9e-68       2     154 .]       1     153 []       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 219.1 bits;  conditional E-value: 4.9e-68
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             vlsd+e+qlv ++w+kvead+a++Gq++L+rlf+ +Pet e+FdkF++lk+eae+k+s+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++++p++f++++qaa++k+lel+++++aakYkelgfqg
               MYG_ESCGI   1 VLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 153
                             69******************************************************************************************************************************************************8 PP

>> HBB_MANSP  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  218.9   0.1   5.6e-68   5.6e-68       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 218.9 bits;  conditional E-value: 5.6e-68
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l+ eek++v+++wgkv++d  e+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g++kvkahgkkvl a+++++++ld+lkg++++LselH++kl+vdpenfkll++vlv+vla++f+keftp+vqaa++k+++ vanala+kY
               HBB_MANSP   3 LTPEEKTAVTTLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             7899************886..669************************************************************************************************************************* PP

>> MYG_LYCPI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.3   2.0   1.7e-67   1.7e-67       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 217.3 bits;  conditional E-value: 1.7e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             lsd+e+q v ++wgkve+d a++Gqe+L+rlf+++Pet ++FdkF++lk+e+e+kgs+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++k++++f+++++aa++k+lel++n++aakYkelgfqg
               MYG_LYCPI   2 LSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBB_URSMA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.9   0.2   2.4e-67   2.4e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 216.9 bits;  conditional E-value: 2.4e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l+ eek+lv+ +wgkv++d  e+G+eaL rl+vvyP+t+++Fd+F+dl+s++++++++kvkahgkkvl+++++++k+ld+lkg+++kLselH++kl+vdpenfkll++vlv+vla++f+keftp+vqaa++k+++ vanala+kY
               HBB_URSMA   3 LTGEEKSLVTGLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             7899************886..669************************************************************************************************************************* PP

>> MYG_PROGU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.6   0.3     3e-67     3e-67       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 216.6 bits;  conditional E-value: 3e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             lsd+e+qlv +vwgkve+d +++Gqe+L+rlf+ +Pet e+FdkF++lk+e+e+++s+++k+hg++vltalg ++kk+++++++l++L+++Hatk+k+++++++++se++++vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_PROGU   2 LSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> MYG_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.2   1.1     4e-67     4e-67       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 216.2 bits;  conditional E-value: 4e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             lsd+e+q+v +vwgkvead a++Gqe+L+rlf+ +Pet e+FdkF++lk+eae+k+s+++k+hg+ vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_HORSE   2 LSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBB_RABIT  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.0   0.7   4.4e-67   4.4e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 216.0 bits;  conditional E-value: 4.4e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls+eek++v+++wgkv+++  e+G+eaL rl+vvyP+t+++F++F+dl+s+++v++++kvkahgkkvl+a++e++++ld+lkg+++kLselH++kl+vdpenf+ll++vlv+vl+++f+keftp+vqaa++k+++ vanala+kY
               HBB_RABIT   3 LSSEEKSAVTALWGKVNVE--EVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             89**************875..679************************************************************************************************************************* PP

>> HBB_SPECI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.0   0.8   9.4e-67   9.4e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 215.0 bits;  conditional E-value: 9.4e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             lsd+ek++++++wgkv  +aae+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g+akvkahgkkv++++++++k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k+++ vanala+kY
               HBB_SPECI   3 LSDGEKNAISTAWGKV--HAAEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKY 145
                             9***************..67889************************************************************************************************************************** PP

>> MYG_SAISC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  214.9   1.2   9.5e-67   9.5e-67       3     154 .]       2     153 .]       1     153 [] 0.99

  Alignments for each domain:
  == domain 1  score: 214.9 bits;  conditional E-value: 9.5e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             lsd+e+qlv ++wgkvead  ++Gqe+L+ lf+ +Pet e+FdkF++lkse+e+k+s+++k+hg++vltalg ++kk+++++++lk+L+++Hatk+k+++++++l+s+++v+vl++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_SAISC   2 LSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBB_SUNMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  214.8   0.1     1e-66     1e-66       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 214.8 bits;  conditional E-value: 1e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls eek+ v+ +wgkv++d  e+G+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g++kvkahgkkvl++lge+v +ld+lkg+++kLselH++kl+vdpenf+ll++vlvvvla+kf+keftp vqaa++k+++ vanala+kY
               HBB_SUNMU   3 LSGEEKACVTGLWGKVNED--EVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKY 145
                             899*************865..679************************************************************************************************************************* PP

>> HBB_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  214.4   0.0   1.3e-66   1.3e-66       4     147 ..       4     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 214.4 bits;  conditional E-value: 1.3e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             s+eekql++s+wgkv++  a++G+eaL+rl++vyP+t+++F++F++l+s+++++g+++vkahgkkvlt++g+avk+ld++kg++++LselH++kl+vdpenf+ll+++lv++laa+f+k+ftpe+qaa++kl+++va+ala+kY
               HBB_COLLI   4 SAEEKQLITSIWGKVNV--ADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKY 145
                             899************75..789************************************************************************************************************************** PP

>> HBB_EQUHE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  214.3   0.1   1.5e-66   1.5e-66       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 214.3 bits;  conditional E-value: 1.5e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls eek++v ++w+kv++  +e+G+eaL rl+vvyP+t+++Fd+F+dl+++a+v+g++kvkahgkkvl+++ge+v++ld+lkg++++LselH++kl+vdpenf+ll++vlvvvla++f+k+ftpe qa+++k+++ vanala+kY
               HBB_EQUHE   3 LSGEEKAAVLALWDKVNE--EEVGGEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKY 145
                             899*************75..5789************************************************************************************************************************* PP

>> MYG_MOUSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.6   0.4   2.5e-66   2.5e-66       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 213.6 bits;  conditional E-value: 2.5e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             lsd+e+qlv +vwgkvead a++Gqe+L+ lf+++Pet ++FdkF++lkse+++kgs+++k+hg +vltalg+++kk++++++++++L+++Hatk+k+++++++++se+++ vl+++++++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_MOUSE   2 LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBB_TACAC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.9   0.3     4e-66     4e-66       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 212.9 bits;  conditional E-value: 4e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls +ek++v+++wg+v+++  e+G+eaL rl+vvyP+t+++F++F+dl+s+++v+g+akvkahg kvlt++g+a+k+ld+lkg+++kLselH++kl+vdpenf+ l++vlvvvla++f+keftpe+qaa++kl++ v++ala+kY
               HBB_TACAC   3 LSGSEKTAVTNLWGHVNVN--ELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKY 145
                             899*************875..779************************************************************************************************************************* PP

>> HBB_SPETO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.8   0.5   4.4e-66   4.4e-66       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 212.8 bits;  conditional E-value: 4.4e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l+d+ek++++++wgkv+  aaeiG+eaL rl+vvyP+t+++Fd+F+dl+s+++v+g+akvkahgkkv++++++++k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k+++ vanal++kY
               HBB_SPETO   3 LTDGEKNAISTAWGKVN--AAEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALSHKY 145
                             899*************7..5789************************************************************************************************************************** PP

>> HBE_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.1   0.4   1.5e-65   1.5e-65       4     147 ..       4     145 ..       1     146 [] 0.97

  Alignments for each domain:
  == domain 1  score: 211.1 bits;  conditional E-value: 1.5e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ++eek++v+s+w+k+++++a  G+eaL rl+vvyP+t+++Fd+F++l+s++++ g++kvkahgkkvlt++g+a+k++d+lk++++kLselH++kl+vdpenfkll++v+v++la++f+keftpevqaa++kl+++va ala+kY
               HBE_PONPY   4 TAEEKAAVTSLWSKMNVEEA--GGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 145
                             689************98755..9************************************************************************************************************************* PP

>> HBB_CALAR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.9   0.1   1.7e-65   1.7e-65       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 210.9 bits;  conditional E-value: 1.7e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l+ eek++v+++wgkv++d  e+G+eaL rl+vvyP+t+++F++F+dl+++++v++++kvkahgkkvl a+++++++ld+lkg++++LselH++kl+vdpenf+ll++vlv+vla++f+keftp vqaa++k+++ vanala+kY
               HBB_CALAR   3 LTGEEKSAVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKY 145
                             7899************886..669************************************************************************************************************************* PP

>> HBB_ORNAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.4   0.0   2.4e-65   2.4e-65       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 210.4 bits;  conditional E-value: 2.4e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls +ek++v+++wgkv+ +  e+G+eaL rl+vvyP+t+++F+ F+dl+s+ +v+g++kvkahg kvlt++g+a+k+lddlkg+++kLselH++kl+vdpenf+ l++vl+vvla++f+k+f+pevqaa++kl++ va+al +kY
               HBB_ORNAN   3 LSGGEKSAVTNLWGKVNIN--ELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVSGVAHALGHKY 145
                             899*************875..779************************************************************************************************************************* PP

>> HBA_MESAU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  209.5   0.2   4.6e-65   4.6e-65       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 209.5 bits;  conditional E-value: 4.6e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k++++++wgk++++a e+G+eaLer+f vyP+tk+yF++Fd +      +gsa+vk+hgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p++ftp+v+a+ldk++++v+++l++kY+
               HBA_MESAU   1 VLSAKDKTNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVS------HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBB_LARRI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.4   0.0   9.6e-65   9.6e-65       4     147 ..       4     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 208.4 bits;  conditional E-value: 9.6e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             s+eekql++ +wgkv++  a++G+eaL+rl++vyP+t+++F +F++l+s+++++g++ v+ahgkkvlt++geavk+ld++k+++++LselH++kl+vdpenf+ll+++l++vlaa+f+k+ftp+ qaa++kl+++va+ala+kY
               HBB_LARRI   4 SAEEKQLITGLWGKVNV--ADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKY 145
                             899************75..789************************************************************************************************************************** PP

>> HBB_TRIIN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.1   0.1   1.2e-64   1.2e-64       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 208.1 bits;  conditional E-value: 1.2e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l+ eek+lv  +w+kv++  +e+G+eaL rl+vvyP+t+++F++F+dl+s++++++++kvkahg+kv+t++g+++k+l+dlkga+++LselH++kl+vdpenf+ll++vlv+vla++f+kef+pe+qaa++k+++ vanala+kY
               HBB_TRIIN   3 LTPEEKALVIGLWAKVNV--KEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKY 145
                             7899************76..689************************************************************************************************************************** PP

>> HBA_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.4   0.5   1.9e-64   1.9e-64       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 207.4 bits;  conditional E-value: 1.9e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls ++k++vk++wgkv+a+a ++G+eaLer+f ++P+tk+yF++Fd +      +gsa+vk+hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_PONPY   1 VLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_MACFA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  206.0   0.2   5.5e-64   5.5e-64       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 206.0 bits;  conditional E-value: 5.5e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls ++k++vk++wgkv+++a e+G+eaLer+f ++P+tk+yF++Fd +      +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_MACFA   1 VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_MACSI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.7   0.2   6.8e-64   6.8e-64       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 205.7 bits;  conditional E-value: 6.8e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls ++k++vk++wgkv+++a e+G+eaLer+f ++P+tk+yF++Fd +      +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_MACSI   1 VLSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_AILME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.1   0.1     1e-63     1e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 205.1 bits;  conditional E-value: 1e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls ++k++vk+ w+k++++a e+G+eaLer f ++P+tk+yF++Fd +       gsa+vkahgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
               HBA_AILME   1 VLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_FRAPO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.4   0.3   3.4e-63   3.4e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.4 bits;  conditional E-value: 3.4e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k++vk ++gk++++a+++G+eaLer+f++yP+tk+yF++Fd +      +gsa+vk+hgkkv++al ea +++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v n+l+akY+
               HBA_FRAPO   1 VLSAADKNNVKGIFGKISSHAEDYGAEALERMFITYPSTKTYFPHFDLS------HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_PHACO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.4   0.3   3.5e-63   3.5e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.4 bits;  conditional E-value: 3.5e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k++vk +++k+ ++a+e+G+eaLer+f++yP+tk+yF++Fd +      +gsa++k+hgkkv++al eav+++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v ++l+akY+
               HBA_PHACO   1 VLSAADKNNVKGIFTKIAGHAEEYGAEALERMFITYPSTKTYFPHFDLS------HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA2_BOSMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.2   0.3   3.8e-63   3.8e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.2 bits;  conditional E-value: 3.8e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k +vk++wgkv+++aae+G+eaLer+f ++P+tk+yF++Fd +      +gsa+vk+hg kv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls+ l+v+la+++p++ftp+v+a+ldk+l+ v+++l++kY+
              HBA2_BOSMU   1 VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA2_GALCR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.1   0.4   4.1e-63   4.1e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.1 bits;  conditional E-value: 4.1e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls  +k++vk++w+kv+a+a ++G+eaLer+f ++P+tk+yF++Fd +      +gs++vk+hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfkll ++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
              HBA2_GALCR   1 VLSPTDKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKYR 141
                             6999*******************************************96......9******************************************************************************************7 PP

>> HBB_TUPGL  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.1   0.0   4.1e-63   4.1e-63       3     147 ..       3     145 ..       1     146 [] 0.97

  Alignments for each domain:
  == domain 1  score: 203.1 bits;  conditional E-value: 4.1e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ls eek++v+ +wgkv+   +++G++ L  l++vyP+t+++Fd+F+dl+s+++v++++kvkahgkkvlt++++++++ld+lkg+++kLselH++kl+vdpenf+ll++vlv vla++f+ eftp+vqaa++k+++ vanala+kY
               HBB_TUPGL   3 LSGEEKAAVTGLWGKVDL--EKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKY 145
                             899*************75..567999*********************************************************************************************************************** PP

>> HBA_ANSSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  201.6   0.4   1.2e-62   1.2e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 201.6 bits;  conditional E-value: 1.2e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k +vk+v+gk++++a+e+G+e+L+r+f+++P+tk+yF++Fd +       gsa++kahgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfk+l+++++vvla ++p+ +tpev+a++dk+l++va++l+akY+
               HBA_ANSSE   1 VLSAADKGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQ------PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_PAGLA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  201.6   0.3   1.2e-62   1.2e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 201.6 bits;  conditional E-value: 1.2e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k+++k+ w+k++++a e+G+eaLer f+++P+tk+yF++Fd +      +gsa+vkahgkkv++al+ av +l+dl +al++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v++aldk++++v+++l++kY+
               HBA_PAGLA   1 VLSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLS------HGSAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKYR 141
                             69*********************************************96......9******************************************************************************************7 PP

>> HBA_ERIEU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.8   0.1   2.2e-62   2.2e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 200.8 bits;  conditional E-value: 2.2e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+ +k++vk+ wgk++++  e+G+eaL r+f+ +P+tk+yF++Fd         gsa+vk+hgkkv++al++av++ldd+ gal++Ls+lHa+kl+vdp+nfklls++l+v+la ++p++ftp+v+a+ldk+l++va++l++kY+
               HBA_ERIEU   1 VLSATDKANVKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLN------PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_PROLO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.7   0.0   2.3e-62   2.3e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 200.7 bits;  conditional E-value: 2.3e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls ++k+++k+ w+k++++a e+G+eaLer f ++P+tk+yF++Fd +       gsa+vkahgkkv++al+ av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+la+++p+eftp+v+a+ldk++++v+++l++kY+
               HBA_PROLO   1 VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKYR 141
                             699********************************************96......9******************************************************************************************7 PP

>> HBA_TRIOC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.7   0.4   4.6e-62   4.6e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 199.7 bits;  conditional E-value: 4.6e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k++vk+v++k++++a+++G+e+Ler+f++yP tk+yF++Fd +      +gsa++kahgkkv+ al eav+++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+ +tpev+a+ldk+l++v n+l+akY+
               HBA_TRIOC   1 VLSANDKTNVKTVFTKITGHAEDYGAETLERMFITYPPTKTYFPHFDLH------HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKYR 141
                             69*********************************************95......9******************************************************************************************7 PP

>> HBB1_VAREX  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.5   0.1   1.1e-61   1.1e-61       4     147 ..       4     145 ..       2     146 .] 0.97

  Alignments for each domain:
  == domain 1  score: 198.5 bits;  conditional E-value: 1.1e-61
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ++eekql+ s+wgk+++    iG+e+L+ l+v yP+t+++F++F++l+s+++++g+++vkahgkkvlt++g+a+k+ld++k++++kLselH++kl+vdp+nfkll++vlv+vla +++keftp+ +aa++kl+++v+++la++Y
              HBB1_VAREX   4 TAEEKQLICSLWGKIDVG--LIGGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRY 145
                             579************765..569************************************************************************************************************************* PP

>> HBAD_CHLME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.0   0.4   6.5e-61   6.5e-61       3     148 ..       2     141 .]       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 196.0 bits;  conditional E-value: 6.5e-61
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             l++++k+l++++w+kv ++++e+G+eaL+r+f +yP+tk+yF++Fd +       gs++v++hgkkv++alg+avk+ld+l++al++Ls+lHa++l+vdp nfkll++++ vvla++++k+++pe++aa+dk+l++va +la+kY+
              HBAD_CHLME   2 LTADDKKLLTQLWEKVAGHQEEFGSEALQRMFLTYPQTKTYFPHFDLH------PGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKYR 141
                             7899******************************************95......9******************************************************************************************7 PP

>> HBAZ_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.3   0.1   1.1e-60   1.1e-60       3     148 ..       2     141 .]       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 195.3 bits;  conditional E-value: 1.1e-60
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             l+++e+++v s+wgk++++a+++G+eaL+rlf +yP+tk+yF++Fd +      +gs++++ahg+kv++a+g+avk++d+++gal+kLselHa+ l+vdp+nfk+ls++l+v+la+++p++ft++++aa+dk+l++v+++l++kY+
              HBAZ_HORSE   2 LTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDLH------EGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR 141
                             7899******************************************95......9******************************************************************************************7 PP

>> HBA_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.1   0.2   2.5e-60   2.5e-60       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 194.1 bits;  conditional E-value: 2.5e-60
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   2 vlsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             vls+++k++vk+v++k++++a ++G+eaLerlf++yP+tk+yF++Fd +      +gsa++k+hgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a +fp+ +tpev+a+ldk++ +v ++l+akY+
               HBA_COLLI   1 VLSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS------HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKYR 141
                             69*********************************************96......9******************************************************************************************7 PP

>> HBAD_PASMO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  191.4   0.1   1.7e-59   1.7e-59       3     148 ..       2     141 .]       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 191.4 bits;  conditional E-value: 1.7e-59
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             l++e+k+l++++wgk+++ ++eiG++aL r+f++yP+tk+yF++Fd +      +gs+++++hgkkv++al++a+k+ld+l++al++Ls+lHa++l+vdp+nfk+ls++l v la++++ke++pev++a+dk++++va++la+kY+
              HBAD_PASMO   2 LTAEDKKLIQQIWGKLGGAEEEIGADALWRMFHSYPSTKTYFPHFDLS------QGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKYR 141
                             789*******************************************96......9******************************************************************************************7 PP

>> HBBL_RANCA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  185.0   0.2   1.6e-57   1.6e-57       4     147 ..       4     145 ..       2     146 .] 0.98

  Alignments for each domain:
  == domain 1  score: 185.0 bits;  conditional E-value: 1.6e-57
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ++eek++++svw+kv+++++  G+eaL+rlf+vyP+t++yF++F+dl+s+a+++g++kv+ahgkk+l a+++a+++ldd+kg+l++Lse Ha++l+vdpenf+ l+evl+vvl ak++k+f+p+vq++++k+++++  al++ Y
              HBBL_RANCA   4 TAEEKAVINSVWQKVDVEQD--GHEALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFIAVLVDALSHSY 145
                             579************99988..89**********************************************************************************************************************99 PP

>> HBB2_XENTR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.6   0.7   3.5e-56   3.5e-56       4     147 ..       4     145 ..       2     146 .] 0.98

  Alignments for each domain:
  == domain 1  score: 180.6 bits;  conditional E-value: 3.5e-56
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   4 sdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             ++eek+++ svwgkv+ +++  G++aL+rl+vvyP+t++yF++F++l++ ++v+g+ kvkahg+kvl+a+g+a+++ldd+k++lk Ls++Ha++l+vdpenfk l++vlv+vlaak++++ftp+vqa+++kl +++  al++ Y
              HBB2_XENTR   4 TAEEKATIASVWGKVDIEQD--GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVWEKLNATLVAALSHGY 145
                             579************99988..89********************************************************************************************************************9998 PP

>> MYG_MUSAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.5   0.4   3.2e-55   3.2e-55       7     154 .]       2     148 .]       1     148 [] 0.99

  Alignments for each domain:
  == domain 1  score: 177.5 bits;  conditional E-value: 3.2e-55
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   7 ekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             ++++v+svw+ ve+d ++iGq++L rlf++yPe++++F+kF++ ks  e+k++a++ka++++vl+alg++vkk++++++ +k+L+++H+t++k++p++f++++++ v vl++++p+e++++vqaa++ ++++++++++++Yk+++fqg
               MYG_MUSAN   2 DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEYKAANFQG 148
                             8*****************************************9.79*****************************************************************************************************8 PP

>> HBA4_SALIR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.2   0.1   8.3e-55   8.3e-55       3     148 ..       2     142 .]       1     142 [] 0.98

  Alignments for each domain:
  == domain 1  score: 176.2 bits;  conditional E-value: 8.3e-55
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakYk 148
                             ls+++k++vk++wgk+  +++eiG++aL+r++vvyP+tk yF+++  +       gsa vk+hg +++++++++v ++ddl g l+kLselHatkl+vdp+nfk+l++ l+vv+aa fp+eftpe++ ++dk+l+++a ala+kY+
              HBA4_SALIR   2 LSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASV-----APGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR 142
                             899***************************************999986.....69******************************************************************************************7 PP

>> HBB2_TRICR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  123.1   0.0   1.8e-38   1.8e-38       3     147 ..       3     145 .]       1     145 [] 0.97

  Alignments for each domain:
  == domain 1  score: 123.1 bits;  conditional E-value: 1.8e-38
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i1   3 lsdeekqlvksvwgkveadaaeiGqeaLerlfvvyPetkeyFdkFddlkseaevkgsakvkahgkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvlaakfpkeftpevqaaldkllelvanalaakY 147
                             l++e+++ + ++ gkv++d+  +G++ L+rl+vv P++++yF  F+dl+s +++  ++kv ahg kv+ ++ ea k+ld+l++  ++Ls +H  k+ vdpenfkl s +++v la  +  +f+ + q a++kl++ v++al + Y
              HBB2_TRICR   3 LTAEDRKEIAAILGKVNVDS--LGGQCLARLIVVNPWSRRYFHDFGDLSSCDAICRNPKVLAHGAKVMRSIVEATKHLDNLREYYADLSVTHSLKFYVDPENFKLFSGIVIVCLALTLQTDFSCHKQLAFEKLMKGVSHALGHGY 145
                             7899************9875..59*********************************************************************************************************************9988 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (154 nodes)
Target sequences:                         45  (6519 residues searched)
Passed MSV filter:                        45  (1); expected 0.9 (0.02)
Passed bias filter:                       45  (1); expected 0.9 (0.02)
Passed Vit filter:                        45  (1); expected 0.0 (0.001)
Passed Fwd filter:                        45  (1); expected 0.0 (1e-05)
Initial search space (Z):                 45  [actual number of targets]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.13u 0.00s 00:00:00.13 Elapsed: 00:00:00.13
# Mc/sec: 7.65

@@ New targets included:   1
@@ New alignment includes: 46 subseqs (was 45), including original query
@@ Continuing to next round.

@@
@@ Round:                  3
@@ Included in MSA:        46 subsequences (query + 45 subseqs from 45 targets)
@@ Model size:             154 positions
@@

Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-69  224.0   0.1    1.7e-69  223.9   0.1    1.0  1  HBB_MANSP   
    4.6e-69  222.5   0.2      5e-69  222.3   0.2    1.0  1  HBB_URSMA   
    2.5e-68  220.1   0.6    2.7e-68  220.0   0.6    1.0  1  HBB_RABIT   
    7.6e-68  218.5   0.0    8.3e-68  218.4   0.0    1.0  1  HBB_SUNMU   
    9.5e-68  218.2   0.0    1.1e-67  217.9   0.0    1.0  1  HBB_COLLI   
    1.4e-67  217.6   0.1    1.6e-67  217.5   0.1    1.0  1  HBB_EQUHE   
    1.5e-67  217.6   0.3    1.6e-67  217.4   0.3    1.0  1  HBB_TACAC   
    3.3e-67  216.5   0.7    3.6e-67  216.3   0.7    1.0  1  HBB_SPECI   
    3.4e-67  216.4   0.1    3.8e-67  216.3   0.1    1.0  1  HBB_CALAR   
    3.7e-67  216.3   0.4    4.1e-67  216.1   0.4    1.0  1  HBB_SPETO   
    6.6e-67  215.5   0.0    7.2e-67  215.3   0.0    1.0  1  HBB_ORNAN   
    8.4e-67  215.1   0.3    9.2e-67  215.0   0.3    1.0  1  HBE_PONPY   
    2.3e-66  213.7   1.7    2.6e-66  213.5   1.7    1.0  1  MYG_ESCGI   
    2.9e-66  213.4   0.1    3.2e-66  213.2   0.1    1.0  1  HBB_TRIIN   
    5.3e-66  212.5   0.0    6.4e-66  212.3   0.0    1.0  1  HBB_LARRI   
    8.7e-66  211.8   1.6    9.6e-66  211.7   1.6    1.0  1  MYG_LYCPI   
    1.8e-65  210.8   0.2      2e-65  210.6   0.2    1.0  1  MYG_PROGU   
    2.5e-65  210.3   0.9    2.8e-65  210.2   0.9    1.0  1  MYG_SAISC   
    2.6e-65  210.3   0.8    2.9e-65  210.1   0.8    1.0  1  MYG_HORSE   
    9.1e-65  208.5   0.2      1e-64  208.4   0.2    1.0  1  HBA_MESAU   
    1.3e-64  208.0   0.3    1.4e-64  207.9   0.3    1.0  1  MYG_MOUSE   
    1.5e-64  207.8   0.0    1.7e-64  207.6   0.0    1.0  1  HBB_TUPGL   
    1.3e-63  204.7   0.5    1.5e-63  204.6   0.5    1.0  1  HBA_PONPY   
    2.9e-63  203.6   0.2    3.2e-63  203.5   0.2    1.0  1  HBA_MACFA   
      4e-63  203.2   0.2    4.4e-63  203.0   0.2    1.0  1  HBA_MACSI   
      5e-63  202.9   0.1    5.9e-63  202.6   0.1    1.0  1  HBB1_VAREX  
    5.7e-63  202.7   0.1    6.4e-63  202.5   0.1    1.0  1  HBA_AILME   
    8.6e-63  202.1   0.3    9.6e-63  201.9   0.3    1.0  1  HBA2_BOSMU  
    1.8e-62  201.0   0.3      2e-62  200.9   0.3    1.0  1  HBA_FRAPO   
    1.9e-62  201.0   0.4    2.1e-62  200.8   0.4    1.0  1  HBA2_GALCR  
    2.1e-62  200.8   0.3    2.4e-62  200.7   0.3    1.0  1  HBA_PHACO   
      4e-62  199.9   0.3    4.4e-62  199.8   0.3    1.0  1  HBA_ANSSE   
      4e-62  199.9   0.1    4.5e-62  199.8   0.1    1.0  1  HBA_ERIEU   
    8.3e-62  198.9   0.3    9.2e-62  198.8   0.3    1.0  1  HBA_PAGLA   
    9.5e-62  198.7   0.0    1.1e-61  198.6   0.0    1.0  1  HBA_PROLO   
    2.2e-61  197.5   0.4    2.4e-61  197.4   0.4    1.0  1  HBA_TRIOC   
    1.2e-60  195.1   0.5    1.3e-60  195.0   0.5    1.0  1  HBAD_CHLME  
    4.1e-60  193.4   0.1    4.5e-60  193.3   0.1    1.0  1  HBAZ_HORSE  
      6e-60  192.9   0.2    6.7e-60  192.7   0.2    1.0  1  HBA_COLLI   
    1.7e-59  191.4   0.2      2e-59  191.2   0.2    1.0  1  HBBL_RANCA  
    2.2e-59  191.0   0.1    2.4e-59  190.9   0.1    1.0  1  HBAD_PASMO  
    1.1e-58  188.8   0.6    1.3e-58  188.6   0.6    1.0  1  HBB2_XENTR  
    5.3e-56  180.0   0.1    5.9e-56  179.9   0.1    1.0  1  HBA4_SALIR  
    2.5e-54  174.6   0.4    2.8e-54  174.5   0.4    1.0  1  MYG_MUSAN   
      2e-52  168.4   0.0    2.2e-52  168.3   0.0    1.0  1  HBB2_TRICR  


Domain annotation for each sequence (and alignments):
>> HBB_MANSP  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  223.9   0.1   1.7e-69   1.7e-69       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 223.9 bits;  conditional E-value: 1.7e-69
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+ eek++v+++wgkv+vd  e+G+eaL rllvvyP+t+r+Fd+F+dl+s+d+v+g++kvkahGkkvl a+++ +++ld+lkg++++LselH++kl+vdpenfkll++vlv+vLa++f+keftp+vqaa++k++++vanala+kY
               HBB_MANSP   3 LTPEEKTAVTTLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             89***************97..8*************************************************************************************************************************** PP

>> HBB_URSMA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.3   0.2     5e-69     5e-69       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 222.3 bits;  conditional E-value: 5e-69
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+ eek+lv+ +wgkv+vd  e+G+eaL rllvvyP+t+r+Fd+F+dl+s+d++++++kvkahGkkvl+++++ +k+ld+lkg+++kLselH++kl+vdpenfkll++vlv+vLa++f+keftp+vqaa++k++++vanala+kY
               HBB_URSMA   3 LTGEEKSLVTGLWGKVNVD--EVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             899**************97..8*************************************************************************************************************************** PP

>> HBB_RABIT  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.0   0.6   2.7e-68   2.7e-68       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 220.0 bits;  conditional E-value: 2.7e-68
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls+eek++v+a+wgkv+v+  e+G+eaL rllvvyP+t+r+F++F+dl+s+++v++++kvkahGkkvl+a++e +++ld+lkg+++kLselH++kl+vdpenf+ll++vlv+vL+++f+keftp+vqaa++k++++vanala+kY
               HBB_RABIT   3 LSSEEKSAVTALWGKVNVE--EVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKY 145
                             9****************96..8*************************************************************************************************************************** PP

>> HBB_SUNMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  218.4   0.0   8.3e-68   8.3e-68       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 218.4 bits;  conditional E-value: 8.3e-68
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls eek+ v+ +wgkv+ d  e+GaeaL rllvvyP+t+r+Fd+F+dl+s+++v+g++kvkahGkkvl++lge v +ld+lkg+++kLselH++kl+vdpenf+ll++vlvvvLa+kf+keftp vqaa++k++++vanala+kY
               HBB_SUNMU   3 LSGEEKACVTGLWGKVNED--EVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKY 145
                             99***************97..8*************************************************************************************************************************** PP

>> HBB_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.9   0.0   1.1e-67   1.1e-67       4     147 ..       4     145 ..       2     146 .] 0.99

  Alignments for each domain:
  == domain 1  score: 217.9 bits;  conditional E-value: 1.1e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             saeekql++++wgkv+v  +++GaeaL+rll+vyP+t+r+F++F++l+s+++++g+++vkahGkkvlt++g+avk+ld++kg++++LselH++kl+vdpenf+ll+++lv++Laa+f+k+ftpe+qaa++kl+++va+ala+kY
               HBB_COLLI   4 SAEEKQLITSIWGKVNV--ADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKY 145
                             89**************9..58*************************************************************************************************************************** PP

>> HBB_EQUHE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.5   0.1   1.6e-67   1.6e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 217.5 bits;  conditional E-value: 1.6e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls eek++v a+w+kv+ +  e+G+eaL rllvvyP+t+r+Fd+F+dl+++++v+g++kvkahGkkvl+++ge v++ld+lkg++++LselH++kl+vdpenf+ll++vlvvvLa++f+k+ftpe qa+++k++++vanala+kY
               HBB_EQUHE   3 LSGEEKAAVLALWDKVNEE--EVGGEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKY 145
                             99**************985..9*************************************************************************************************************************** PP

>> HBB_TACAC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.4   0.3   1.6e-67   1.6e-67       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 217.4 bits;  conditional E-value: 1.6e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls +ek++v+++wg+v+v+  elG+eaL rllvvyP+t+r+F++F+dl+s+d+v+g+akvkahG+kvlt++g+a+k+ld+lkg+++kLselH++kl+vdpenf+ l++vlvvvLa++f+keftpe+qaa++kl+++v++ala+kY
               HBB_TACAC   3 LSGSEKTAVTNLWGHVNVN--ELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKY 145
                             899**************96..8*************************************************************************************************************************** PP

>> HBB_SPECI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.3   0.7   3.6e-67   3.6e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 216.3 bits;  conditional E-value: 3.6e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls++ek++++++wgkv++  +e+GaeaL rllvvyP+t+r+Fd+F+dl+s+++v+g+akvkahGkkv++++++ +k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k++++vanala+kY
               HBB_SPECI   3 LSDGEKNAISTAWGKVHA--AEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKY 145
                             9***************76..69*************************************************************************************************************************** PP

>> HBB_CALAR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.3   0.1   3.8e-67   3.8e-67       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 216.3 bits;  conditional E-value: 3.8e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+ eek++v+a+wgkv+vd  e+G+eaL rllvvyP+t+r+F++F+dl+++d+v++++kvkahGkkvl a+++ +++ld+lkg++++LselH++kl+vdpenf+ll++vlv+vLa++f+keftp vqaa++k++++vanala+kY
               HBB_CALAR   3 LTGEEKSAVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKY 145
                             899**************97..8*************************************************************************************************************************** PP

>> HBB_SPETO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.1   0.4   4.1e-67   4.1e-67       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 216.1 bits;  conditional E-value: 4.1e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+++ek++++++wgkv++  +e+GaeaL rllvvyP+t+r+Fd+F+dl+s+++v+g+akvkahGkkv++++++ +k+ld+lkg++++LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k++++vanal++kY
               HBB_SPETO   3 LTDGEKNAISTAWGKVNA--AEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALSHKY 145
                             99**************98..59*************************************************************************************************************************** PP

>> HBB_ORNAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.3   0.0   7.2e-67   7.2e-67       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 215.3 bits;  conditional E-value: 7.2e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls +ek++v+++wgkv+++  elG+eaL rllvvyP+t+r+F+ F+dl+s+ +v+g++kvkahG+kvlt++g+a+k+lddlkg+++kLselH++kl+vdpenf+ l++vl+vvLa++f+k+f+pevqaa++kl+++va+al +kY
               HBB_ORNAN   3 LSGGEKSAVTNLWGKVNIN--ELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVSGVAHALGHKY 145
                             899**************96..8*************************************************************************************************************************** PP

>> HBE_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.0   0.3   9.2e-67   9.2e-67       4     147 ..       4     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 215.0 bits;  conditional E-value: 9.2e-67
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             +aeek++v+++w+k++v+  e G+eaL rllvvyP+t+r+Fd+F++l+s++++ g++kvkahGkkvlt++g+a+k++d+lk++++kLselH++kl+vdpenfkll++v+v++La++f+keftpevqaa++kl+++va ala+kY
               HBE_PONPY   4 TAEEKAAVTSLWSKMNVE--EAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 145
                             89**************97..78************************************************************************************************************************** PP

>> MYG_ESCGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.5   1.7   2.6e-66   2.6e-66       2     154 .]       1     153 []       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 213.5 bits;  conditional E-value: 2.6e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             vLs++e+qlv ++w+kve+d++++G+++L+rl++ +Pet ++FdkFk+lk+e+e+k+s+++k+hG++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vL++++p++f++++qaa++k+lel+++++aakYkelgfqg
               MYG_ESCGI   1 VLSDAEWQLVLNIWAKVEADVAGHGQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKYKELGFQG 153
                             79******************************************************************************************************************************************************8 PP

>> HBB_TRIIN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.2   0.1   3.2e-66   3.2e-66       3     147 ..       3     145 ..       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 213.2 bits;  conditional E-value: 3.2e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+ eek+lv  +w+kv+v+  e+G+eaL rllvvyP+t+r+F++F+dl+s++++++++kvkahG+kv+t++g+ +k+l+dlkga+++LselH++kl+vdpenf+ll++vlv+vLa++f+kef+pe+qaa++k++++vanala+kY
               HBB_TRIIN   3 LTPEEKALVIGLWAKVNVK--EYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKY 145
                             89***************96..8*************************************************************************************************************************** PP

>> HBB_LARRI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.3   0.0   6.4e-66   6.4e-66       4     147 ..       4     145 ..       2     146 .] 0.99

  Alignments for each domain:
  == domain 1  score: 212.3 bits;  conditional E-value: 6.4e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             saeekql++ +wgkv+v  +++GaeaL+rll+vyP+t+r+F +F++l+s+++++g++ v+ahGkkvlt++geavk+ld++k+++++LselH++kl+vdpenf+ll+++l++vLaa+f k+ftp+ qaa++kl+++va+ala+kY
               HBB_LARRI   4 SAEEKQLITGLWGKVNV--ADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKY 145
                             89**************9..58*************************************************************************************************************************** PP

>> MYG_LYCPI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.7   1.6   9.6e-66   9.6e-66       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 211.7 bits;  conditional E-value: 9.6e-66
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             Ls++e+q v ++wgkve+d++++G+e+L+rl++++Pet ++FdkFk+lk+ede+kgs+++k+hG++vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vL++k++++f+++++aa++k+lel++n++aakYkelgfqg
               MYG_LYCPI   2 LSDGEWQIVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> MYG_PROGU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.6   0.2     2e-65     2e-65       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 210.6 bits;  conditional E-value: 2e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             Ls++e+qlv +vwgkve+d++++G+e+L+rl++ +Pet ++FdkFk+lk+ede+++s+++k+hG++vltalg ++kk+++++++l++L+++Hatk+k+++++++++se++++vL++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_PROGU   2 LSDGEWQLVLNVWGKVEGDLSGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> MYG_SAISC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.2   0.9   2.8e-65   2.8e-65       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 210.2 bits;  conditional E-value: 2.8e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             Ls++e+qlv ++wgkve+d+ ++G+e+L+ l++ +Pet ++FdkFk+lksede+k+s+++k+hG++vltalg ++kk+++++++lk+L+++Hatk+k+++++++l+s+++v+vL++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_SAISC   2 LSDGEWQLVLNIWGKVEADIPSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> MYG_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  210.1   0.8   2.9e-65   2.9e-65       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 210.1 bits;  conditional E-value: 2.9e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             Ls++e+q+v +vwgkve+d++++G+e+L+rl++ +Pet ++FdkFk+lk+e+e+k+s+++k+hG+ vltalg ++kk+++++++lk+L+++Hatk+k+++++++++s+++++vL++k+p++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_HORSE   2 LSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBA_MESAU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.4   0.2     1e-64     1e-64       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 208.4 bits;  conditional E-value: 1e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++++++wgk++++a e+GaeaLer++ vyP+tk+yF++F+ +      +gsa+vk+hGkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p++ftp+v+a+ldk++++v+++l++kY+
               HBA_MESAU   1 VLSAKDKTNISEAWGKIGGHAGEYGAEALERMFFVYPTTKTYFPHFDVS------HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> MYG_MOUSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.9   0.3   1.4e-64   1.4e-64       3     154 .]       2     153 .]       1     153 [] 1.00

  Alignments for each domain:
  == domain 1  score: 207.9 bits;  conditional E-value: 1.4e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             Ls++e+qlv +vwgkve+d++++G+e+L+ l++++Pet ++FdkFk+lkse+++kgs+++k+hG +vltalg+++kk++++++++++L+++Hatk+k+++++++++se+++ vL+++++++f++++q+a++k+lel++n++aakYkelgfqg
               MYG_MOUSE   2 LSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG 153
                             89*****************************************************************************************************************************************************8 PP

>> HBB_TUPGL  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.6   0.0   1.7e-64   1.7e-64       3     147 ..       3     145 ..       1     146 [] 0.98

  Alignments for each domain:
  == domain 1  score: 207.6 bits;  conditional E-value: 1.7e-64
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             Ls eek++v+ +wgkv+ +  ++G++ L  ll+vyP+t+r+Fd+F+dl+s+++v++++kvkahGkkvlt++++ +++ld+lkg+++kLselH++kl+vdpenf+ll++vlv vLa++f+ eftp+vqaa++k++++vanala+kY
               HBB_TUPGL   3 LSGEEKAAVTGLWGKVDLE--KVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKY 145
                             99**************885..8*************************************************************************************************************************** PP

>> HBA_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  204.6   0.5   1.5e-63   1.5e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 204.6 bits;  conditional E-value: 1.5e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k++vk++wgkv+++a ++GaeaLer++ ++P+tk+yF++F+ +      +gsa+vk+hGkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_PONPY   1 VLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_MACFA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.5   0.2   3.2e-63   3.2e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.5 bits;  conditional E-value: 3.2e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k++vka+wgkv+++a e+GaeaLer++ ++P+tk+yF++F+ +      +gsa+vk+hGkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_MACFA   1 VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_MACSI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.0   0.2   4.4e-63   4.4e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 203.0 bits;  conditional E-value: 4.4e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k++vk++wgkv+++a e+GaeaLer++ ++P+tk+yF++F+ +      +gsa+vk+hGkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+l++v+++l++kY+
               HBA_MACSI   1 VLSPADKTNVKDAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBB1_VAREX  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  202.6   0.1   5.9e-63   5.9e-63       4     147 ..       4     145 ..       2     146 .] 0.98

  Alignments for each domain:
  == domain 1  score: 202.6 bits;  conditional E-value: 5.9e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             +aeekql+ ++wgk++v    +G+e+L+ llv yP+t+r+F++F++l+s+++++g+++vkahGkkvlt++g+a+k+ld++k++++kLselH++kl+vdp+nfkll++vlv+vLa +++keftp+++aa++kl+++v+++la++Y
              HBB1_VAREX   4 TAEEKQLICSLWGKIDVG--LIGGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRY 145
                             79*************996..69************************************************************************************************************************** PP

>> HBA_AILME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  202.5   0.1   6.4e-63   6.4e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 202.5 bits;  conditional E-value: 6.4e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k++vka w+k++++a e+G+eaLer + ++P+tk+yF++F+ +       gsa+vkahGkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v+a+ldk++++v+++l++kY+
               HBA_AILME   1 VLSPADKTNVKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA2_BOSMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  201.9   0.3   9.6e-63   9.6e-63       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 201.9 bits;  conditional E-value: 9.6e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k +vka+wgkv+++a+e+GaeaLer++ ++P+tk+yF++F+ +      +gsa+vk+hG+kv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls+ l+v+La+++p++ftp+v+a+ldk+l+ v+++l++kY+
              HBA2_BOSMU   1 VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLS------HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_FRAPO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.9   0.3     2e-62     2e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 200.9 bits;  conditional E-value: 2e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++vk ++gk++++ae++GaeaLer++++yP+tk+yF++F+ +      +gsa+vk+hGkkv++al ea +++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v n+l+akY+
               HBA_FRAPO   1 VLSAADKNNVKGIFGKISSHAEDYGAEALERMFITYPSTKTYFPHFDLS------HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA2_GALCR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.8   0.4   2.1e-62   2.1e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 200.8 bits;  conditional E-value: 2.1e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k++vka+w+kv+++a ++GaeaLer++ ++P+tk+yF++F+ +      +gs++vk+hGkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfkll ++l+v+La+++p+eftp+v+a+ldk++++v+++l++kY+
              HBA2_GALCR   1 VLSPTDKSNVKAAWEKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLS------HGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_PHACO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  200.7   0.3   2.4e-62   2.4e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 200.7 bits;  conditional E-value: 2.4e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++vk +++k+ ++aee+GaeaLer++++yP+tk+yF++F+ +      +gsa++k+hGkkv++al eav+++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l++v ++l+akY+
               HBA_PHACO   1 VLSAADKNNVKGIFTKIAGHAEEYGAEALERMFITYPSTKTYFPHFDLS------HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_ANSSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.8   0.3   4.4e-62   4.4e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 199.8 bits;  conditional E-value: 4.4e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k +vk+v+gk++++aee+Gae+L+r+++++P+tk+yF++F+ +       gsa++kahGkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfk+l+++++vvLa ++p+ +tpev+a++dk+l++va++l+akY+
               HBA_ANSSE   1 VLSAADKGNVKTVFGKIGGHAEEYGAETLQRMFQTFPQTKTYFPHFDLQ------PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_ERIEU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.8   0.1   4.5e-62   4.5e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 199.8 bits;  conditional E-value: 4.5e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++vk+ wgk++++  e+G+eaL r+++ +P+tk+yF++F+         gsa+vk+hGkkv++al++av++ldd+ gal++Ls+lHa+kl+vdp+nfklls++l+v+La ++p++ftp+v+a+ldk+l++va++l++kY+
               HBA_ERIEU   1 VLSATDKANVKTFWGKLGGHGGEYGGEALDRMFQAHPTTKTYFPHFDLN------PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_PAGLA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.8   0.3   9.2e-62   9.2e-62       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 198.8 bits;  conditional E-value: 9.2e-62
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs+++k+++ka w+k++++a e+GaeaLer ++++P+tk+yF++F+ +      +gsa+vkahGkkv++al+ av +l+dl +al++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v++aldk++++v+++l++kY+
               HBA_PAGLA   1 VLSSADKNNIKATWDKIGSHAGEYGAEALERTFISFPTTKTYFPHFDLS------HGSAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_PROLO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.6   0.0   1.1e-61   1.1e-61       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 198.6 bits;  conditional E-value: 1.1e-61
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLs ++k+++ka w+k++++a e+G+eaLer + ++P+tk+yF++F+ +       gsa+vkahGkkv++al+ av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v+a+ldk++++v+++l++kY+
               HBA_PROLO   1 VLSPADKANIKATWDKIGGHAGEYGGEALERTFASFPTTKTYFPHFDLS------PGSAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBA_TRIOC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  197.4   0.4   2.4e-61   2.4e-61       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 197.4 bits;  conditional E-value: 2.4e-61
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++vk+v++k++++ae++Gae+Ler++++yP tk+yF++F+ +      +gsa++kahGkkv+ al eav+++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+ +tpev+a+ldk+l++v n+l+akY+
               HBA_TRIOC   1 VLSANDKTNVKTVFTKITGHAEDYGAETLERMFITYPPTKTYFPHFDLH------HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBAD_CHLME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.0   0.5   1.3e-60   1.3e-60       3     148 ..       2     141 .]       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 195.0 bits;  conditional E-value: 1.3e-60
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             L+a++k+l++++w+kv +++ee+G+eaL+r++ +yP+tk+yF++F+ +       gs++v++hGkkv++alg+avk+ld+l++al++Ls+lHa++l+vdp nfkll++++ vvLa++++k+++pe++aa+dk+l++va++la+kY+
              HBAD_CHLME   2 LTADDKKLLTQLWEKVAGHQEEFGSEALQRMFLTYPQTKTYFPHFDLH------PGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKYR 141
                             99*********************************************9......*******************************************************************************************8 PP

>> HBAZ_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  193.3   0.1   4.5e-60   4.5e-60       3     148 ..       2     141 .]       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 193.3 bits;  conditional E-value: 4.5e-60
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             L+++e+++v ++wgk++++a+++G+eaL+rl+ +yP+tk+yF++F+ +      +gs++++ahG+kv++a+g+avk++d+++gal+kLselHa+ l+vdp+nfk+ls++l+v+La+++p++ft++++aa+dk+l++v+++l++kY+
              HBAZ_HORSE   2 LTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDLH------EGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR 141
                             89*********************************************9......*******************************************************************************************8 PP

>> HBA_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.7   0.2   6.7e-60   6.7e-60       2     148 ..       1     141 []       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 192.7 bits;  conditional E-value: 6.7e-60
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   2 vLsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             vLsa++k++vkav++k++++a +lG+eaLerl+++yP+tk+yF++F+ +      +gsa++k+hGkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a +fp+ +tpev+a+ldk++ +v ++l+akY+
               HBA_COLLI   1 VLSANDKSNVKAVFAKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLS------HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKYR 141
                             79**********************************************9......*******************************************************************************************8 PP

>> HBBL_RANCA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  191.2   0.2     2e-59     2e-59       4     147 ..       4     145 ..       2     146 .] 0.98

  Alignments for each domain:
  == domain 1  score: 191.2 bits;  conditional E-value: 2e-59
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             +aeek+ +++vw+kv+v+++  G+eaL+rl++vyP+t+ryF++F+dl+s+++++g++kv+ahGkk+l a+++a+++ldd+kg+l++Lse Ha++l+vdpenf+ l+evl+vvL ak++k+f+p+vq++++k+++++ +al++ Y
              HBBL_RANCA   4 TAEEKAVINSVWQKVDVEQD--GHEALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFIAVLVDALSHSY 145
                             79***************876..************************************************************************************************************************** PP

>> HBAD_PASMO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  190.9   0.1   2.4e-59   2.4e-59       3     148 ..       2     141 .]       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 190.9 bits;  conditional E-value: 2.4e-59
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             L+ae+k+l++++wgk+++ +ee+Ga+aL r++++yP+tk+yF++F+ +      +gs+++++hGkkv++al++a+k+ld+l++al++Ls+lHa++l+vdp+nfk+ls++l v La++++ke++pev++a+dk++++va++la+kY+
              HBAD_PASMO   2 LTAEDKKLIQQIWGKLGGAEEEIGADALWRMFHSYPSTKTYFPHFDLS------QGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKYR 141
                             9**********************************************9......*******************************************************************************************8 PP

>> HBB2_XENTR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  188.6   0.6   1.3e-58   1.3e-58       4     147 ..       4     145 ..       2     146 .] 0.98

  Alignments for each domain:
  == domain 1  score: 188.6 bits;  conditional E-value: 1.3e-58
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   4 saeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             +aeek+++++vwgkv+++++  G++aL+rllvvyP+t+ryF++F++l++ ++v+g+ kvkahG+kvl+a+g+a+++ldd+k++lk Ls++Ha++l+vdpenfk l++vlv+vLaak++++ftp+vqa+++kl +++ +al++ Y
              HBB2_XENTR   4 TAEEKATIASVWGKVDIEQD--GHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVWEKLNATLVAALSHGY 145
                             79**************9876..*************************************************************************************************************************9 PP

>> HBA4_SALIR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  179.9   0.1   5.9e-56   5.9e-56       3     148 ..       2     142 .]       1     142 [] 0.99

  Alignments for each domain:
  == domain 1  score: 179.9 bits;  conditional E-value: 5.9e-56
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYk 148
                             Lsa++k++vka+wgk+  +++e+G++aL+r+lvvyP+tk yF+++ ++       gsa vk+hG +++++++++v ++ddl g l+kLselHatkl+vdp+nfk+l++ l+vv+aa fp+eftpe++ ++dk+l+++a ala+kY+
              HBA4_SALIR   2 LSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASV-----APGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKYR 142
                             9**********************************************9.....9*******************************************************************************************8 PP

>> MYG_MUSAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  174.5   0.4   2.8e-54   2.8e-54       7     154 .]       2     148 .]       1     148 [] 0.99

  Alignments for each domain:
  == domain 1  score: 174.5 bits;  conditional E-value: 2.8e-54
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   7 ekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakYkelgfqg 154
                             ++++v++vw+ ve+d++++G+++L rl+++yPe++++F+kFk+ ks  e+k++a++ka++++vl+alg++vkk++++++ +k+L+++H+t++k++p++f+ ++++ v vL++++p+e++++vqaa++ ++++++++++++Yk+++fqg
               MYG_MUSAN   2 DWEKVNSVWSAVESDLTAIGQNILLRLFEQYPESQNHFPKFKN-KSLGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEYKAANFQG 148
                             8******************************************.5******************************************************************************************************8 PP

>> HBB2_TRICR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  168.3   0.0   2.2e-52   2.2e-52       3     147 ..       3     145 .]       1     145 [] 0.99

  Alignments for each domain:
  == domain 1  score: 168.3 bits;  conditional E-value: 2.2e-52
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02185|MYG_PHYCD-i2   3 LsaeekqlvkavwgkvevdaeelGaeaLerllvvyPetkryFdkFkdlksedevkgsakvkahGkkvltalgeavkklddlkgalkkLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllelvanalaakY 147
                             L+ae++++++a++gkv+vd  +lG+++L+rl+vv+P+++ryF++F+dl+s+d++++++kv ahG+kv++++ ea+k+ld+l++ +++Ls +H+ k+ vdpenfkl+s +++v+La +++++f+++ q a++kl+++v++al + Y
              HBB2_TRICR   3 LTAEDRKEIAAILGKVNVD--SLGGQCLARLIVVNPWSRRYFHDFGDLSSCDAICRNPKVLAHGAKVMRSIVEATKHLDNLREYYADLSVTHSLKFYVDPENFKLFSGIVIVCLALTLQTDFSCHKQLAFEKLMKGVSHALGHGY 145
                             9*****************8..69************************************************************************************************************************99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (154 nodes)
Target sequences:                         45  (6519 residues searched)
Passed MSV filter:                        45  (1); expected 0.9 (0.02)
Passed bias filter:                       45  (1); expected 0.9 (0.02)
Passed Vit filter:                        45  (1); expected 0.0 (0.001)
Passed Fwd filter:                        45  (1); expected 0.0 (1e-05)
Initial search space (Z):                 45  [actual number of targets]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.14u 0.00s 00:00:00.14 Elapsed: 00:00:00.13
# Mc/sec: 7.59

@@ New targets included:   0
@@ New alignment includes: 46 subseqs (was 46), including original query
@@
@@ CONVERGED (in 3 rounds). 
@@

//
Query:       sp|P02024|HBB_GORGO  [L=147]
Description: Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2

Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
+   1.5e-97  314.8   0.6    1.6e-97  314.6   0.6    1.0  1  HBB_MANSP   
+   6.6e-97  312.7   0.9    7.3e-97  312.5   0.9    1.0  1  HBB_CALAR   
+   8.2e-92  296.1   0.5    9.2e-92  296.0   0.5    1.0  1  HBB_URSMA   
+   8.7e-91  292.8   0.6    9.6e-91  292.7   0.6    1.0  1  HBB_RABIT   
+   1.3e-83  269.5   0.5    1.4e-83  269.4   0.5    1.0  1  HBB_SUNMU   
+   1.8e-83  269.1   0.5      2e-83  268.9   0.5    1.0  1  HBB_EQUHE   
+   1.8e-82  265.8   0.5      2e-82  265.7   0.5    1.0  1  HBB_TRIIN   
+     2e-82  265.7   0.2    2.2e-82  265.5   0.2    1.0  1  HBB_TUPGL   
+   4.5e-81  261.3   0.5      5e-81  261.1   0.5    1.0  1  HBB_SPETO   
+   2.7e-80  258.8   0.7      3e-80  258.6   0.7    1.0  1  HBB_SPECI   
+   3.5e-79  255.2   0.2    3.9e-79  255.0   0.2    1.0  1  HBE_PONPY   
+   4.3e-78  251.6   0.5    4.7e-78  251.5   0.5    1.0  1  HBB_TACAC   
+   2.8e-77  249.0   0.5    3.2e-77  248.8   0.5    1.0  1  HBB_ORNAN   
+   2.3e-70  226.5   0.1    2.6e-70  226.4   0.1    1.0  1  HBB_COLLI   
+   2.2e-68  220.1   0.1    2.5e-68  220.0   0.1    1.0  1  HBB_LARRI   
+   9.7e-66  211.5   0.3    1.1e-65  211.4   0.3    1.0  1  HBB1_VAREX  
+   1.1e-55  179.0   0.3    1.2e-55  178.8   0.3    1.0  1  HBBL_RANCA  
+   8.7e-52  166.3   0.3    9.6e-52  166.1   0.3    1.0  1  HBB2_XENTR  
+   1.1e-44  143.2   0.0    1.2e-44  143.0   0.0    1.0  1  HBB2_TRICR  
+   1.5e-33  107.1   0.4    1.7e-33  106.9   0.4    1.0  1  HBA_MESAU   
+   2.4e-33  106.4   0.3    2.7e-33  106.3   0.3    1.0  1  HBA_AILME   
+   4.9e-33  105.4   0.0    5.4e-33  105.3   0.0    1.0  1  HBA4_SALIR  
+   2.1e-32  103.3   0.3    2.4e-32  103.2   0.3    1.0  1  HBA_PONPY   
+   4.1e-32  102.4   0.2    4.5e-32  102.3   0.2    1.0  1  HBA_PROLO   
+   7.3e-32  101.6   0.4    8.1e-32  101.5   0.4    1.0  1  HBA_MACFA   
+   7.6e-32  101.6   0.1    8.6e-32  101.4   0.1    1.0  1  HBAD_CHLME  
+   8.5e-32  101.4   0.5    9.3e-32  101.3   0.5    1.0  1  HBA2_BOSMU  
+   2.9e-31   99.7   0.2    3.2e-31   99.5   0.2    1.0  1  HBA2_GALCR  
+   3.7e-31   99.3   0.0    4.1e-31   99.2   0.0    1.0  1  HBAD_PASMO  
+   4.2e-31   99.2   0.3    4.6e-31   99.0   0.3    1.0  1  HBA_COLLI   
+   4.9e-31   98.9   0.3    5.5e-31   98.8   0.3    1.0  1  HBA_MACSI   
+   5.1e-31   98.9   0.3    5.6e-31   98.7   0.3    1.0  1  HBA_FRAPO   
+   1.8e-30   97.1   0.4      2e-30   97.0   0.4    1.0  1  HBA_ERIEU   
+   5.3e-30   95.6   0.0      6e-30   95.4   0.0    1.0  1  HBAZ_HORSE  
+   8.3e-30   94.9   0.2    9.1e-30   94.8   0.2    1.0  1  HBA_TRIOC   
+   1.5e-29   94.1   0.2    1.9e-29   93.8   0.2    1.0  1  HBA_PHACO   
+   2.1e-29   93.6   0.2    2.3e-29   93.5   0.2    1.0  1  HBA_PAGLA   
+   3.3e-28   89.8   0.2    3.6e-28   89.6   0.2    1.0  1  HBA_ANSSE   
+   3.1e-14   44.4   0.2    3.7e-14   44.2   0.2    1.0  1  MYG_LYCPI   
+   4.5e-12   37.4   0.2    5.4e-12   37.1   0.2    1.0  1  MYG_SAISC   
+   7.9e-12   36.6   0.1    9.5e-12   36.3   0.1    1.0  1  MYG_PROGU   
+   1.7e-11   35.6   0.1      2e-11   35.3   0.1    1.0  1  MYG_MOUSE   
+   5.4e-11   33.9   0.3    6.4e-11   33.7   0.3    1.0  1  MYG_HORSE   
+   2.2e-10   31.9   0.2    2.7e-10   31.6   0.2    1.0  1  MYG_ESCGI   
+   4.3e-08   24.5   0.0    4.9e-08   24.3   0.0    1.0  1  MYG_MUSAN   


Domain annotation for each sequence (and alignments):
>> HBB_MANSP  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  314.6   0.6   1.6e-97   1.6e-97       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 314.6 bits;  conditional E-value: 1.6e-97
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhltpeek+avt lwgkvnvdevggealgrllvvypwtqrff+sfgdls+pdavmgnpkvkahgkkvlgafsdgl hldnlkgtfa lselhcdklhvdpenfkllgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
            HBB_MANSP   1 VHLTPEEKTAVTTLWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                          8************************************************************************************************************************************************9 PP

>> HBB_CALAR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  312.5   0.9   7.3e-97   7.3e-97       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 312.5 bits;  conditional E-value: 7.3e-97
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhlt eeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavm+npkvkahgkkvlgafsdgl hldnlkgtfa lselhcdklhvdpenf+llgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
            HBB_CALAR   1 VHLTGEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKYH 146
                          8************************************************************************************************************************************************9 PP

>> HBB_URSMA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  296.0   0.5   9.2e-92   9.2e-92       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 296.0 bits;  conditional E-value: 9.2e-92
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhlt eeks vt lwgkvnvdevggealgrllvvypwtqrff+sfgdls+ da+m+npkvkahgkkvl++fsdgl +ldnlkgtfa lselhcdklhvdpenfkllgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
            HBB_URSMA   1 VHLTGEEKSLVTGLWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                          8************************************************************************************************************************************************9 PP

>> HBB_RABIT  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  292.7   0.6   9.6e-91   9.6e-91       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 292.7 bits;  conditional E-value: 9.6e-91
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+ eeksavtalwgkvnv+evggealgrllvvypwtqrffesfgdls+ +avm+npkvkahgkkvl+afs+gl+hldnlkgtfa lselhcdklhvdpenf+llgnvlv vl+hhfgkeftp vqaayqkvvagvanalahkyh
            HBB_RABIT   1 VHLSSEEKSAVTALWGKVNVEEVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBB_SUNMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  269.4   0.5   1.4e-83   1.4e-83       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 269.4 bits;  conditional E-value: 1.4e-83
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+ eek+ vt lwgkvn devg+ealgrllvvypwtqrff+sfgdls+  avmgnpkvkahgkkvl ++ +g+a+ldnlkgtfa lselhcdklhvdpenf+llgnvlv vla  fgkeftppvqaa+qkvvagvanalahkyh
            HBB_SUNMU   1 VHLSGEEKACVTGLWGKVNEDEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBB_EQUHE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  268.9   0.5     2e-83     2e-83       2     147 .]       1     146 []       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 268.9 bits;  conditional E-value: 2e-83
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          v+l+ eek+av alw kvn +evggealgrllvvypwtqrff+sfgdls p avmgnpkvkahgkkvl +f +g+ hldnlkgtfa lselhcdklhvdpenf+llgnvlv vla+hfgk+ftp +qa+yqkvvagvanalahkyh
            HBB_EQUHE   1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146
                          57899********************************************************************************************************************************************9 PP

>> HBB_TRIIN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  265.7   0.5     2e-82     2e-82       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 265.7 bits;  conditional E-value: 2e-82
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhltpeek+ v  lw+kvnv e ggealgrllvvypwtqrffe fgdls+  a+m+npkvkahg+kv+ +f dgl hl++lkg fa lselhcdklhvdpenf+llgnvlvcvla+hfgkef+p  qaayqkvvagvanalahkyh
            HBB_TRIIN   1 VHLTPEEKALVIGLWAKVNVKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKYH 146
                          8************************************************************************************************************************************************9 PP

>> HBB_TUPGL  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  265.5   0.2   2.2e-82   2.2e-82       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 265.5 bits;  conditional E-value: 2.2e-82
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+ eek+avt lwgkv++++vgg++lg ll+vypwtqrff+sfgdls+p avm+npkvkahgkkvl +fsdgl hldnlkgtfa lselhcdklhvdpenf+llgnvlv vla +fg eftp vqaa+qkvvagvanalahkyh
            HBB_TUPGL   1 VHLSGEEKAAVTGLWGKVDLEKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBB_SPETO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  261.1   0.5     5e-81     5e-81       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 261.1 bits;  conditional E-value: 5e-81
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhlt  ek+a++  wgkvn  e+g+ealgrllvvypwtqrff+sfgdls+  avmgn kvkahgkkv+ +fs+gl hldnlkgtfa+lselhcdklhvdpenfkllgn++v v+ahh+gk+ftp  qaa+qkvvagvanal+hkyh
            HBB_SPETO   1 VHLTDGEKNAISTAWGKVNAAEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALSHKYH 146
                          8************************************************************************************************************************************************9 PP

>> HBB_SPECI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  258.6   0.7     3e-80     3e-80       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 258.6 bits;  conditional E-value: 3e-80
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+  ek+a++  wgkv+  evg+ealgrllvvypwtqrff+sfgdls+  avmgn kvkahgkkv+ +fs+gl hldnlkgtfa+lselhcdklhvdpenfkllgn++v v+ahh+gk+ftp  qaa+qkvvagvanalahkyh
            HBB_SPECI   1 VHLSDGEKNAISTAWGKVHAAEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBE_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  255.0   0.2   3.9e-79   3.9e-79       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 255.0 bits;  conditional E-value: 3.9e-79
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vh+t eek+avt+lw+k+nv+e ggealgrllvvypwtqrff+sfg+ls+p a++gnpkvkahgkkvl +f d++ ++dnlk tfa lselhcdklhvdpenfkllgnv+v +la hfgkeftp vqaa+qk+v++va alahkyh
            HBE_PONPY   1 VHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBB_TACAC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  251.5   0.5   4.7e-78   4.7e-78       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 251.5 bits;  conditional E-value: 4.7e-78
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+  ek+avt lwg vnv+e+ggealgrllvvypwtqrffesfgdls+ davmgn kvkahg kvl +f d+l +ldnlkgtfa lselhcdklhvdpenf  lgnvlv vla+hf+keftp  qaa+qk+v+gv++alahkyh
            HBB_TACAC   1 VHLSGSEKTAVTNLWGHVNVNELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKYH 146
                          7************************************************************************************************************************************************9 PP

>> HBB_ORNAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  248.8   0.5   3.2e-77   3.2e-77       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 248.8 bits;  conditional E-value: 3.2e-77
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vhl+  eksavt lwgkvn++e+ggealgrllvvypwtqrffe+fgdls+  avmgnpkvkahg kvl +f d+l +ld+lkgtfa lselhcdklhvdpenf  lgnvl+ vla+hf+k+f+p vqaa+qk+v+gva+al hkyh
            HBB_ORNAN   1 VHLSGGEKSAVTNLWGKVNINELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVSGVAHALGHKYH 146
                          79***********************************************************************************************************************************************9 PP

>> HBB_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  226.4   0.1   2.6e-70   2.6e-70       2     147 .]       1     146 []       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 226.4 bits;  conditional E-value: 2.6e-70
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vh + eek  +t++wgkvnv + g+eal+rll+vypwtqrff sfg+ls+  a+ gnp vkahgkkvl +f d++ +ldn+kgtfa lselhcdklhvdpenf+llg++lv +la hfgk+ftp  qaa+qk+v  va+ala+kyh
            HBB_COLLI   1 VHWSAEEKQLITSIWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKYH 146
                          7999*********************************************************************************************************************************************9 PP

>> HBB_LARRI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.0   0.1   2.5e-68   2.5e-68       2     147 .]       1     146 []       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 220.0 bits;  conditional E-value: 2.5e-68
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vh + eek  +t lwgkvnv + g+eal+rll+vypwtqrff sfg+ls+p a+ gnp v+ahgkkvl +f +++ +ldn+k+tfa lselhcdklhvdpenf+llg++l+ vla hf+k+ftp  qaa+qk+v  va+ala+kyh
            HBB_LARRI   1 VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKYH 146
                          7999*********************************************************************************************************************************************9 PP

>> HBB1_VAREX  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.4   0.3   1.1e-65   1.1e-65       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 211.4 bits;  conditional E-value: 1.1e-65
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vh t eek  + +lwgk++v  +gge l+ llv+ypwtqr f  fg+ls+p a+ gnp+vkahgkkvl +f d++ +ldn+k tfa lselhcdklhvdp nfkllgnvlv vla h gkeftp   aayqk+v  v+++la++yh
           HBB1_VAREX   1 VHWTAEEKQLICSLWGKIDVGLIGGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRYH 146
                          799**********************************************************************************************************************************************9 PP

>> HBBL_RANCA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  178.8   0.3   1.2e-55   1.2e-55       2     147 .]       1     146 []       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 178.8 bits;  conditional E-value: 1.2e-55
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahkyh 147
                          vh t eek+ + ++w kv+v++ g eal rl++vypwtqr+f +fgdls+p a+ gnpkv ahgkk+lga+ +++ +ld++kgt+  lse h+++lhvdpenf+ lg vl+ vl   +gk f+p vq  ++k +a + +al+h yh
           HBBL_RANCA   1 VHWTAEEKAVINSVWQKVDVEQDGHEALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFIAVLVDALSHSYH 146
                          799**********************************************************************************************************************************************9 PP

>> HBB2_XENTR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  166.1   0.3   9.6e-52   9.6e-52       2     146 ..       1     145 [.       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 166.1 bits;  conditional E-value: 9.6e-52
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          vh t eek+ + ++wgkv++++ g +al+rllvvypwtqr+f sfg+ls   av gn kvkahg kvl+a   ++ hld++k+ +  ls+ h++ lhvdpenfk l++vlv vla  +g  ftp vqa ++k+ a +  al+h y
           HBB2_XENTR   1 VHWTAEEKATIASVWGKVDIEQDGHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVWEKLNATLVAALSHGY 145
                          799********************************************************************************************************************************************98 PP

>> HBB2_TRICR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.0   0.0   1.2e-44   1.2e-44       2     146 ..       1     145 []       1     145 [] 0.98

  Alignments for each domain:
  == domain 1  score: 143.0 bits;  conditional E-value: 1.2e-44
  sp|P02024|HBB_GORGO   2 vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          vhlt e++  + a+ gkvnvd +gg+ l+rl+vv pw++r+f  fgdls+ da+  npkv ahg kv+ ++ ++  hldnl+  +a ls  h  k++vdpenfkl++ +++  la  +  +f+   q a++k++ gv++al h y
           HBB2_TRICR   1 VHLTAEDRKEIAAILGKVNVDSLGGQCLARLIVVNPWSRRYFHDFGDLSSCDAICRNPKVLAHGAKVMRSIVEATKHLDNLREYYADLSVTHSLKFYVDPENFKLFSGIVIVCLALTLQTDFSCHKQLAFEKLMKGVSHALGHGY 145
                          8*********************************************************************************************************999888899****************************87 PP

>> HBA_MESAU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.9   0.4   1.7e-33   1.7e-33       5     146 ..       3     140 ..       1     141 [] 0.94

  Alignments for each domain:
  == domain 1  score: 106.9 bits;  conditional E-value: 1.7e-33
  sp|P02024|HBB_GORGO   5 tpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          + ++k+ ++  wgk+  +  e g+eal r++ vyp t+ +f  f      d   g+ +vk hgkkv  a+++++ hld+l g ++ ls+lh+ kl+vdp nfkll++ l+  la+h   +ftp v a+  k  a+v+  l  ky
            HBA_MESAU   3 SAKDKTNISEAWGKIggHAGEYGAEALERMFFVYPTTKTYFPHF------DVSHGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKY 140
                          6789999*******944478*********************999......4557999************************************************************************************999 PP

>> HBA_AILME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.3   0.3   2.7e-33   2.7e-33       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 106.3 bits;  conditional E-value: 2.7e-33
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +k+ v a w k+  +  e ggeal r +  +p t+ +f  f dls      g+ +vkahgkkv  a++ ++ hld+l g ++ ls+lh+ kl+vdp nfkll++ l+  la h   eftp v a+  k  ++v+  l  ky
            HBA_AILME   2 LSPADKTNVKATWDKIggHAGEYGGEALERTFASFPTTKTYFPHF-DLS-----PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKY 140
                          789************944478*********************999.777.....48889***********************************************************************************999 PP

>> HBA4_SALIR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.3   0.0   5.4e-33   5.4e-33       4     146 ..       2     141 ..       1     142 [] 0.94

  Alignments for each domain:
  == domain 1  score: 105.3 bits;  conditional E-value: 5.4e-33
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+ ++k+ v a+wgk+    de+g +al+r+lvvyp t+ +f  ++ ++      g+  vk hg  +++ + d + h+d+l g +  lselh+ kl+vdp nfk+l++ l+ v+a +f  eftp +  +  k +  +a ala+ky
           HBA4_SALIR   2 LSAKDKANVKAIWGKIlpKSDEIGEQALSRMLVVYPQTKAYFSHWASVA-----PGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKY 141
                          5678999********95568**********************9998764.....58889*************************************************************************************9 PP

>> HBA_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  103.2   0.3   2.4e-32   2.4e-32       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 103.2 bits;  conditional E-value: 2.4e-32
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkvnv..devggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +k+ v   wgkv     + g+eal r+++ +p t+ +f  f dls      g+ +vk hgkkv  a+++++ah+d++ + ++ ls+lh+ kl+vdp nfkll++ l+  la h+  eftp v a+  k +a+v+  l  ky
            HBA_PONPY   2 LSPADKTNVKTAWGKVGAhaGDYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          7899***********97522799*******************999.676.....58899***********************************************************************************999 PP

>> HBA_PROLO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.3   0.2   4.5e-32   4.5e-32       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 102.3 bits;  conditional E-value: 4.5e-32
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +k+ + a w k+  +  e ggeal r +  +p t+ +f  f dls      g+ +vkahgkkv  a++ ++ hld+l g ++ ls+lh+ kl+vdp nfkll++ l+  la h   eftp v a+  k   +v+  l  ky
            HBA_PROLO   2 LSPADKANIKATWDKIggHAGEYGGEALERTFASFPTTKTYFPHF-DLS-----PGSAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKY 140
                          789************944478*********************999.777.....48889***********************************************************************************999 PP

>> HBA_MACFA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.5   0.4   8.1e-32   8.1e-32       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 101.5 bits;  conditional E-value: 8.1e-32
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +k+ v a wgkv  +  e g+eal r+++ +p t+ +f  f dls      g+ +vk hgkkv  a++ ++ h+d++   ++ ls+lh+ kl+vdp nfkll++ l+  la h+  eftp v a+  k +a+v+  l  ky
            HBA_MACFA   2 LSPADKTNVKAAWGKVggHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          789************944478*********************999.676.....58999***********************************************************************************999 PP

>> HBAD_CHLME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.4   0.1   8.6e-32   8.6e-32       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 101.4 bits;  conditional E-value: 8.6e-32
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          lt ++k  +t lw kv  + +e g+eal r+++ yp t+ +f  f dl       g+ +v+ hgkkv +a+ +++  ldnl   ++ ls lh+  l+vdp nfkll+  +  vla h+gk+++p + aa+ k +++va  la+ky
           HBAD_CHLME   2 LTADDKKLLTQLWEKVagHQEEFGSEALQRMFLTYPQTKTYFPHF-DL-----HPGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKY 140
                          7999***********9555799********************999.55.....46999**************************************************************************************9 PP

>> HBA2_BOSMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.3   0.5   9.3e-32   9.3e-32       5     146 ..       3     140 ..       1     141 [] 0.94

  Alignments for each domain:
  == domain 1  score: 101.3 bits;  conditional E-value: 9.3e-32
  sp|P02024|HBB_GORGO   5 tpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          +  +k  v a wgkv  +  e g+eal r+++ +p t+ +f  f dls      g+ +vk hg kv +a++ ++ hld+l g ++ ls+lh+ kl+vdp nfkll++ l+  la h+  +ftp v a+  k +a+v+  l  ky
           HBA2_BOSMU   3 SAADKGNVKAAWGKVggHAAEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKY 140
                          5668999********444789********************999.676.....58999***********************************************************************************999 PP

>> HBA2_GALCR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.5   0.2   3.2e-31   3.2e-31       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 99.5 bits;  conditional E-value: 3.2e-31
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkvn..vdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +ks v a w kv     + g+eal r+++ +p t+ +f  f dls      g+ +vk hgkkv  a+++++ h+d++ + ++ ls+lh+ kl+vdp nfkll + l+  la h   eftp v a+  k +a+v+  l  ky
           HBA2_GALCR   2 LSPTDKSNVKAAWEKVGahAGDYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKY 140
                          789************97225799*******************999.676.....6999************************************************************************************999 PP

>> HBAD_PASMO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.2   0.0   4.1e-31   4.1e-31       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 99.2 bits;  conditional E-value: 4.1e-31
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkvn..vdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          lt e+k  +  +wgk+    +e+g++al r++  yp t+ +f  f dls     +g+ +++ hgkkv++a+s+++ +ldnl   ++ ls lh+  l+vdp nfk+l+  l   la ++gke++p v +a  k +++va+ la+ky
           HBAD_PASMO   2 LTAEDKKLIQQIWGKLGgaEEEIGADALWRMFHSYPSTKTYFPHF-DLS-----QGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKY 140
                          799************9733589********************999.666.....7999**************************************************************************************9 PP

>> HBA_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.0   0.3   4.6e-31   4.6e-31       5     146 ..       3     140 ..       1     141 [] 0.94

  Alignments for each domain:
  == domain 1  score: 99.0 bits;  conditional E-value: 4.6e-31
  sp|P02024|HBB_GORGO   5 tpeeksavtalwgkvn..vdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          +  +ks v a+++k+     ++ggeal rl++ yp t+ +f  f dls      g+ ++k hgkkv  a+ ++  h+d++ g ++ ls+lh+ kl+vdp nfkllg+ ++ v+a hf   +tp v a+  k v +v   l  ky
            HBA_COLLI   3 SANDKSNVKAVFAKIGgqAGDLGGEALERLFITYPQTKTYFPHF-DLS-----HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKY 140
                          6678999******99633679********************999.676.....58899**********************************************************************************9999 PP

>> HBA_MACSI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.8   0.3   5.5e-31   5.5e-31       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 98.8 bits;  conditional E-value: 5.5e-31
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          l+p +k+ v   wgkv  +  e g+eal r+++ +p t+ +f  f dls      g+ +vk hgkkv  a++ ++ h+d++   ++ ls+lh+ kl+vdp nfkll++ l+  la h+  eftp v a+  k +a+v+  l  ky
            HBA_MACSI   2 LSPADKTNVKDAWGKVggHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                          7899***********944478*********************999.676.....58999***********************************************************************************999 PP

>> HBA_FRAPO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.7   0.3   5.6e-31   5.6e-31       6     146 ..       4     140 ..       1     141 [] 0.93

  Alignments for each domain:
  == domain 1  score: 98.7 bits;  conditional E-value: 5.6e-31
  sp|P02024|HBB_GORGO   6 peeksavtalwgkvn..vdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            +k+ v  ++gk++   ++ g+eal r+++ yp t+ +f  f dls      g+ +vk hgkkv++a+ ++  h+d++ gt++ ls+lh+ kl+vdp nfkllg  ++ v+a h    +tp v a+  k + +v n l  ky
            HBA_FRAPO   4 AADKNNVKGIFGKISshAEDYGAEALERMFITYPSTKTYFPHF-DLS-----HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKY 140
                          56899999*****9633789********************999.676.....58999**************************************************9999999999***********************999 PP

>> HBA_ERIEU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.0   0.4     2e-30     2e-30       6     146 ..       4     140 ..       1     141 [] 0.93

  Alignments for each domain:
  == domain 1  score: 97.0 bits;  conditional E-value: 2e-30
  sp|P02024|HBB_GORGO   6 peeksavtalwgkvn..vdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            +k+ v  +wgk+     e ggeal r++  +p t+ +f  f dl+      g+ +vk hgkkv  a++ ++ +ld++ g ++ ls+lh+ kl+vdp nfkll++ l+  la h   +ftp v a+  k +a va  l  ky
            HBA_ERIEU   4 ATDKANVKTFWGKLGghGGEYGGEALDRMFQAHPTTKTYFPHF-DLN-----PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKY 140
                          56899999*****962257*********************999.665.....48899***********************************************************************************999 PP

>> HBAZ_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   95.4   0.0     6e-30     6e-30       4     146 ..       2     140 ..       1     141 [] 0.95

  Alignments for each domain:
  == domain 1  score: 95.4 bits;  conditional E-value: 6e-30
  sp|P02024|HBB_GORGO   4 ltpeeksavtalwgkvnv..devggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          lt  e++ v ++wgk+++  d vg eal rl+  yp t+ +f  f dl       g+p+++ahg kv +a  d++  +dn+ g +a lselh+  l+vdp nfk+l++ l+  la ++  +ft    aa+ k ++ v++ l +ky
           HBAZ_HORSE   2 LTKAERTMVVSIWGKISMqaDAVGTEALQRLFSSYPQTKTYFPHF-DL-----HEGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKY 140
                          78999**********9753399********************999.44.....579***************************************************************************************99 PP

>> HBA_TRIOC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.8   0.2   9.1e-30   9.1e-30       8     146 ..       6     140 ..       1     141 [] 0.90

  Alignments for each domain:
  == domain 1  score: 94.8 bits;  conditional E-value: 9.1e-30
  sp|P02024|HBB_GORGO   8 eksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          +k+ v  ++ k+  + ++ g+e l r+++ yp t+ +f  f d        g+ ++kahgkkv+ga+ +++ h+d++ g ++ ls+lh+ kl+vdp nfkllg  ++ v+a h    +tp v a+  k + +v n l+ ky
            HBA_TRIOC   6 DKTNVKTVFTKItgHAEDYGAETLERMFITYPPTKTYFPHF-D-----LHHGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKY 140
                          566666666666334789********************999.4.....457999***************************************************9999999999***********************999 PP

>> HBA_PHACO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.8   0.2   1.9e-29   1.9e-29       8     146 ..       6     140 ..       2     141 .] 0.91

  Alignments for each domain:
  == domain 1  score: 93.8 bits;  conditional E-value: 1.9e-29
  sp|P02024|HBB_GORGO   8 eksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          +k+ v  ++ k+  + +e g+eal r+++ yp t+ +f  f dls      g+ ++k hgkkv++a+ +++ h+d++ gt++ ls+lh+ kl+vdp nfkllg  ++ v+a h    +tp v a+  k + +v   l  ky
            HBA_PHACO   6 DKNNVKGIFTKIagHAEEYGAEALERMFITYPSTKTYFPHF-DLS-----HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKY 140
                          56666666666644689*********************999.676.....58899**************************************************9999999999**********************9999 PP

>> HBA_PAGLA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.5   0.2   2.3e-29   2.3e-29       5     146 ..       3     140 ..       1     141 [] 0.94

  Alignments for each domain:
  == domain 1  score: 93.5 bits;  conditional E-value: 2.3e-29
  sp|P02024|HBB_GORGO   5 tpeeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          +  +k+ + a w k+  +  e g+eal r ++ +p t+ +f  f dls      g+ +vkahgkkv  a++ ++ hl++l + ++ ls+lh+ kl+vdp nfkll++ l+  la h   eftp v +a  k  ++v+  l  ky
            HBA_PAGLA   3 SSADKNNIKATWDKIgsHAGEYGAEALERTFISFPTTKTYFPHF-DLS-----HGSAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKY 140
                          56689999******943478*********************999.676.....58999***********************************************************************************999 PP

>> HBA_ANSSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.6   0.2   3.6e-28   3.6e-28       6     146 ..       4     140 ..       1     141 [] 0.93

  Alignments for each domain:
  == domain 1  score: 89.6 bits;  conditional E-value: 3.6e-28
  sp|P02024|HBB_GORGO   6 peeksavtalwgkv..nvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            +k  v  ++gk+  + +e g+e l r++  +p t+ +f  f dl       g+ ++kahgkkv +a+ ++  h+d++ g ++ ls+lh+ kl+vdp nfk+lg+ ++ vla h    +tp v a+  k + +va  l  ky
            HBA_ANSSE   4 AADKGNVKTVFGKIggHAEEYGAETLQRMFQTFPQTKTYFPHF-DL-----QPGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKY 140
                          56788899999**944589*********************999.55.....458999**********************************************************************************9999 PP

>> MYG_LYCPI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.2   0.2   3.7e-14   3.7e-14      10     146 ..       8     146 ..       2     147 .. 0.93

  Alignments for each domain:
  == domain 1  score: 44.2 bits;  conditional E-value: 3.7e-14
  sp|P02024|HBB_GORGO  10 savtalwgkvnvdevg..gealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            v  +wgkv  d  g   e l rl+  +p t   f+ f  l t d + g+  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + ++++++ ++ vl +  + +f    +aa +k +    n +a ky
            MYG_LYCPI   8 QIVLNIWGKVETDLAGhgQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKY 146
                          567889******987532699*********************************************9999999****************99999999************99999**************99999999998 PP

>> MYG_SAISC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.1   0.2   5.4e-12   5.4e-12      10     146 ..       8     146 ..       2     147 .. 0.92

  Alignments for each domain:
  == domain 1  score: 37.1 bits;  conditional E-value: 5.4e-12
  sp|P02024|HBB_GORGO  10 savtalwgkvnvd..evggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            v  +wgkv  d    g e l  l+  +p t + f+ f  l + d + ++ ++k hg  vl a+   l      ++ +  l++ h+ k  +  + ++l+++ +v vl      +f    q a +k +    n +a ky
            MYG_SAISC   8 QLVLNIWGKVEADipSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKY 146
                          567889****887336799**********************************************9999999999**************99999999***********998899**************99999999998 PP

>> MYG_PROGU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.3   0.1   9.5e-12   9.5e-12      10     146 ..       8     146 ..       2     147 .. 0.91

  Alignments for each domain:
  == domain 1  score: 36.3 bits;  conditional E-value: 9.5e-12
  sp|P02024|HBB_GORGO  10 savtalwgkvnvdev..ggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            v  +wgkv  d    g e l rl+  +p t + f+ f  l   d + ++ ++k hg  vl a+   l       + +a l++ h+ k  +  + +++++  ++ vl      +f    q a  k +    n +a ky
            MYG_PROGU   8 QLVLNVWGKVEGDLSghGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKY 146
                          567889****98865116799********************************************999999999999************99999999***********9888889*************99999999998 PP

>> MYG_MOUSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.3   0.1     2e-11     2e-11      10     146 ..       8     146 ..       2     147 .. 0.92

  Alignments for each domain:
  == domain 1  score: 35.3 bits;  conditional E-value: 2e-11
  sp|P02024|HBB_GORGO  10 savtalwgkvnvdevg..gealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            v  +wgkv  d  g   e l  l+  +p t   f+ f +l + + + g+  +k hg  vl a+   l       + +  l++ h+ k  +  + +++++ +++ vl  + + +f    q a  k +    n +a ky
            MYG_MOUSE   8 QLVLNVWGKVEADLAGhgQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKY 146
                          567889******987632689999*********************************************999999999***********99999999***********999999**************99999999998 PP

>> MYG_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.7   0.3   6.4e-11   6.4e-11      10     146 ..       8     146 ..       2     147 .. 0.91

  Alignments for each domain:
  == domain 1  score: 33.7 bits;  conditional E-value: 6.4e-11
  sp|P02024|HBB_GORGO  10 savtalwgkvnvdevg..gealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                            v  +wgkv  d  g   e l rl+  +p t + f+ f  l t   + ++  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + ++++++ ++ vl       f    q a  k +    n +a ky
            MYG_HORSE   8 QQVLNVWGKVEADIAGhgQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKY 146
                          567889*****9987532699************************9999*****************9999999****************99999999**********987777789***********999999999998 PP

>> MYG_ESCGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.6   0.2   2.7e-10   2.7e-10       8     146 ..       6     146 ..       2     147 .. 0.89

  Alignments for each domain:
  == domain 1  score: 31.6 bits;  conditional E-value: 2.7e-10
  sp|P02024|HBB_GORGO   8 eksavtalwgkvnvdevg..gealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvvagvanalahky 146
                          e   v  +w+kv  d  g   + l rl+  +p t + f+ f  l t   + ++  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + ++++++ ++ vl  +   +f    qaa  k +      +a ky
            MYG_ESCGI   6 EWQLVLNIWAKVEADVAGhgQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKY 146
                          55678889*****998763157899**********************9999*****************9999999****************99999999***********8888889**********99887777777776 PP

>> MYG_MUSAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.3   0.0   4.9e-08   4.9e-08      12     135 ..       6     130 ..       2     142 .. 0.87

  Alignments for each domain:
  == domain 1  score: 24.3 bits;  conditional E-value: 4.9e-08
  sp|P02024|HBB_GORGO  12 vtalwgkvnvd..evggealgrllvvypwtqrffesfgdlstpdavmgnpkvkahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfkllgnvlvcvlahhfgkeftppvqaayqkvv 135
                          v ++w+ v  d   +g   l rl+  yp +q+ f  f + s  + +     +ka++  vl+a+ + +    +       l+  h     + p  f  +  + v vl++ +  e+   vqaa+    
            MYG_MUSAN   6 VNSVWSAVESDltAIGQNILLRLFEQYPESQNHFPKFKNKSLGE-LKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAF 130
                          778999887663378999*********************99876.678999***********999998888888889999999**9999********************************98655 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (147 nodes)
Target sequences:                         45  (6519 residues searched)
Passed MSV filter:                        45  (1); expected 0.9 (0.02)
Passed bias filter:                       45  (1); expected 0.9 (0.02)
Passed Vit filter:                        45  (1); expected 0.0 (0.001)
Passed Fwd filter:                        45  (1); expected 0.0 (1e-05)
Initial search space (Z):                 45  [actual number of targets]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 33.36

@@ New targets included:   45
@@ New alignment includes: 46 subseqs (was 1), including original query
@@ Continuing to next round.

@@
@@ Round:                  2
@@ Included in MSA:        46 subsequences (query + 45 subseqs from 45 targets)
@@ Model size:             147 positions
@@

Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.3e-75  242.8   0.1    2.6e-75  242.6   0.1    1.0  1  HBB_MANSP   
    1.1e-74  240.6   0.3    1.2e-74  240.5   0.3    1.0  1  HBB_URSMA   
    1.4e-73  237.0   0.9    1.5e-73  236.9   0.9    1.0  1  HBB_RABIT   
    4.1e-73  235.5   0.2    4.5e-73  235.4   0.2    1.0  1  HBB_CALAR   
    4.2e-73  235.4   0.1    4.7e-73  235.3   0.1    1.0  1  HBB_SUNMU   
    7.8e-73  234.6   0.0    8.7e-73  234.4   0.0    1.0  1  HBB_COLLI   
    1.9e-72  233.3   0.4    2.1e-72  233.2   0.4    1.0  1  HBB_TACAC   
    3.1e-72  232.6   0.4    3.4e-72  232.5   0.4    1.0  1  HBE_PONPY   
    3.5e-72  232.5   0.2    3.8e-72  232.3   0.2    1.0  1  HBB_EQUHE   
    1.1e-71  230.8   1.0    1.3e-71  230.7   1.0    1.0  1  HBB_SPECI   
    1.6e-71  230.3   0.6    1.7e-71  230.2   0.6    1.0  1  HBB_SPETO   
    2.6e-71  229.6   0.1    2.9e-71  229.5   0.1    1.0  1  HBB_TRIIN   
    2.9e-71  229.5   0.0    3.2e-71  229.4   0.0    1.0  1  HBB_ORNAN   
    5.2e-71  228.7   0.0    5.7e-71  228.5   0.0    1.0  1  HBB_LARRI   
    1.1e-69  224.3   0.0    1.3e-69  224.2   0.0    1.0  1  HBB_TUPGL   
    1.5e-68  220.7   0.1    1.6e-68  220.5   0.1    1.0  1  HBB1_VAREX  
    7.6e-65  208.7   0.3    8.5e-65  208.5   0.3    1.0  1  HBBL_RANCA  
    2.5e-63  203.7   0.9    2.8e-63  203.6   0.9    1.0  1  HBB2_XENTR  
    6.9e-63  202.3   0.3    7.5e-63  202.2   0.3    1.0  1  HBA_MESAU   
    1.1e-61  198.4   0.7    1.2e-61  198.3   0.7    1.0  1  HBA_PONPY   
    1.8e-61  197.7   0.3    1.9e-61  197.6   0.3    1.0  1  HBA_MACFA   
    2.6e-61  197.2   0.3    2.8e-61  197.1   0.3    1.0  1  HBA_MACSI   
    3.6e-61  196.8   0.1    3.9e-61  196.6   0.1    1.0  1  HBA_AILME   
    1.2e-60  195.1   0.4    1.3e-60  194.9   0.4    1.0  1  HBA_PHACO   
    1.2e-60  195.1   0.4    1.3e-60  194.9   0.4    1.0  1  HBA2_BOSMU  
    1.2e-60  195.0   0.4    1.4e-60  194.9   0.4    1.0  1  HBA_FRAPO   
    1.4e-60  194.8   0.6    1.6e-60  194.7   0.6    1.0  1  HBA2_GALCR  
    4.5e-60  193.2   0.1    4.9e-60  193.1   0.1    1.0  1  HBA_ERIEU   
    5.1e-60  193.0   0.0    5.6e-60  192.9   0.0    1.0  1  HBA_PROLO   
    7.4e-60  192.5   0.4    8.1e-60  192.3   0.4    1.0  1  HBA_ANSSE   
    7.4e-60  192.5   0.5    8.1e-60  192.3   0.5    1.0  1  HBA_PAGLA   
    4.5e-59  189.9   0.5      5e-59  189.8   0.5    1.0  1  HBA_TRIOC   
      6e-59  189.5   0.5    6.6e-59  189.4   0.5    1.0  1  HBAD_CHLME  
    2.2e-58  187.7   0.1    2.5e-58  187.5   0.1    1.0  1  HBAZ_HORSE  
    2.4e-58  187.6   0.1    2.7e-58  187.4   0.1    1.0  1  HBAD_PASMO  
    2.5e-58  187.5   0.2    2.8e-58  187.4   0.2    1.0  1  HBA_COLLI   
    1.9e-56  181.4   0.0    2.2e-56  181.2   0.0    1.0  1  HBB2_TRICR  
    5.3e-56  180.0   0.1    5.8e-56  179.8   0.1    1.0  1  HBA4_SALIR  
    9.5e-56  179.1   1.8    1.1e-55  179.0   1.8    1.0  1  MYG_LYCPI   
    1.3e-55  178.7   1.0    1.4e-55  178.6   1.0    1.0  1  MYG_SAISC   
    3.1e-55  177.5   2.2    3.4e-55  177.3   2.2    1.0  1  MYG_ESCGI   
    5.1e-55  176.8   0.2    5.7e-55  176.6   0.2    1.0  1  MYG_PROGU   
    9.3e-55  175.9   1.0      1e-54  175.8   1.0    1.0  1  MYG_HORSE   
    1.4e-54  175.3   0.3    1.6e-54  175.2   0.3    1.0  1  MYG_MOUSE   
    1.6e-44  142.7   0.3    1.8e-44  142.6   0.3    1.0  1  MYG_MUSAN   


Domain annotation for each sequence (and alignments):
>> HBB_MANSP  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  242.6   0.1   2.6e-75   2.6e-75       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 242.6 bits;  conditional E-value: 2.6e-75
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhl++eek++v+++wgkv++devG+eaL rllvvyP+t+r+Fd+Fgdlss+dav+g++kvkahgkkvl a+++++++ld+lkg++a+LselH++kl+vdpenfkll++vlv+vLa++f+keftp+vqaa++k++a+vanala+kYh
               HBB_MANSP   1 VHLTPEEKTAVTTLWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_URSMA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  240.5   0.3   1.2e-74   1.2e-74       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 240.5 bits;  conditional E-value: 1.2e-74
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhl+ eek+lv+ +wgkv++devG+eaL rllvvyP+t+r+Fd+Fgdlss+da+++++kvkahgkkvl+++++++k+ld+lkg++akLselH++kl+vdpenfkll++vlv+vLa++f+keftp+vqaa++k++a+vanala+kYh
               HBB_URSMA   1 VHLTGEEKSLVTGLWGKVNVDEVGGEALGRLLVVYPWTQRFFDSFGDLSSADAIMNNPKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_RABIT  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  236.9   0.9   1.5e-73   1.5e-73       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 236.9 bits;  conditional E-value: 1.5e-73
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls+eek++v+a+wgkv+++evG+eaL rllvvyP+t+r+F++Fgdlss++av++++kvkahgkkvl+a++e++++ld+lkg++akLselH++kl+vdpenf+ll++vlv+vL+++f+keftp+vqaa++k++a+vanala+kYh
               HBB_RABIT   1 VHLSSEEKSAVTALWGKVNVEEVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_CALAR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  235.4   0.2   4.5e-73   4.5e-73       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 235.4 bits;  conditional E-value: 4.5e-73
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhl+ eek++v+a+wgkv++devG+eaL rllvvyP+t+r+F++Fgdls++dav++++kvkahgkkvl a+++++++ld+lkg++a+LselH++kl+vdpenf+ll++vlv+vLa++f+keftp vqaa++k++a+vanala+kYh
               HBB_CALAR   1 VHLTGEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMNNPKVKAHGKKVLGAFSDGLTHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPVVQAAYQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_SUNMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  235.3   0.1   4.7e-73   4.7e-73       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 235.3 bits;  conditional E-value: 4.7e-73
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls eeka v+ +wgkv++devGaeaL rllvvyP+t+r+Fd+Fgdlss++av+g++kvkahgkkvl++lge+v +ld+lkg++akLselH++kl+vdpenf+ll++vlvvvLa+kf+keftp vqaa++k++a+vanala+kYh
               HBB_SUNMU   1 VHLSGEEKACVTGLWGKVNEDEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNPKVKAHGKKVLHSLGEGVANLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLASKFGKEFTPPVQAAFQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  234.4   0.0   8.7e-73   8.7e-73       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 234.4 bits;  conditional E-value: 8.7e-73
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vh+saeek+l++++wgkv++ ++GaeaL+rll+vyP+t+r+F++Fg+lss++a++g+++vkahgkkvlt++g+avk+ld++kg++a+LselH++kl+vdpenf+ll+++lv++Laa+f+k+ftpe+qaa++kl+++va+ala+kYh
               HBB_COLLI   1 VHWSAEEKQLITSIWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSSATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDPENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_TACAC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  233.2   0.4   2.1e-72   2.1e-72       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 233.2 bits;  conditional E-value: 2.1e-72
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls +ek++v+++wg+v+++e+G+eaL rllvvyP+t+r+F++Fgdlss+dav+g+akvkahg+kvlt++g+a+k+ld+lkg++akLselH++kl+vdpenf+ l++vlvvvLa++f+keftpe+qaa++kl+++v++ala+kYh
               HBB_TACAC   1 VHLSGSEKTAVTNLWGHVNVNELGGEALGRLLVVYPWTQRFFESFGDLSSADAVMGNAKVKAHGAKVLTSFGDALKNLDNLKGTFAKLSELHCDKLHVDPENFNRLGNVLVVVLARHFSKEFTPEAQAAWQKLVSGVSHALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBE_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  232.5   0.4   3.4e-72   3.4e-72       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 232.5 bits;  conditional E-value: 3.4e-72
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vh++aeeka+v+++w+k++++e+G+eaL rllvvyP+t+r+Fd+Fg+lss++a+ g++kvkahgkkvlt++g+a+k++d+lk+++akLselH++kl+vdpenfkll++v+v++La++f+keftpevqaa++kl++ava ala+kYh
               HBE_PONPY   1 VHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_EQUHE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  232.3   0.2   3.8e-72   3.8e-72       2     147 .]       1     146 []       1     146 [] 0.99

  Alignments for each domain:
  == domain 1  score: 232.3 bits;  conditional E-value: 3.8e-72
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             v+ls eeka+v a+w+kv+++evG+eaL rllvvyP+t+r+Fd+Fgdls+++av+g++kvkahgkkvl+++ge+v++ld+lkg++a+LselH++kl+vdpenf+ll++vlvvvLa++f+k+ftpe qa+++k++a+vanala+kYh
               HBB_EQUHE   1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPAAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAQLSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146
                             789**********************************************************************************************************************************************8 PP

>> HBB_SPECI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.7   1.0   1.3e-71   1.3e-71       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 230.7 bits;  conditional E-value: 1.3e-71
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls+ ek++++++wgkv+a evGaeaL rllvvyP+t+r+Fd+Fgdlss++av+g+akvkahgkkv++++++++k+ld+lkg++a+LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k++a+vanala+kYh
               HBB_SPECI   1 VHLSDGEKNAISTAWGKVHAAEVGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_SPETO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.2   0.6   1.7e-71   1.7e-71       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 230.2 bits;  conditional E-value: 1.7e-71
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhl++ ek++++++wgkv+a e+GaeaL rllvvyP+t+r+Fd+Fgdlss++av+g+akvkahgkkv++++++++k+ld+lkg++a+LselH++kl+vdpenfkll++++v+v+a++++k+ftpe+qaa++k++a+vanal++kYh
               HBB_SPETO   1 VHLTDGEKNAISTAWGKVNAAEIGAEALGRLLVVYPWTQRFFDSFGDLSSASAVMGNAKVKAHGKKVIDSFSNGLKHLDNLKGTFASLSELHCDKLHVDPENFKLLGNMIVIVMAHHLGKDFTPEAQAAFQKVVAGVANALSHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_TRIIN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.5   0.1   2.9e-71   2.9e-71       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 229.5 bits;  conditional E-value: 2.9e-71
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhl++eekalv  +w kv+++e+G+eaL rllvvyP+t+r+F++Fgdlss++a+++++kvkahg+kv+t++g+++k+l+dlkga+a+LselH++kl+vdpenf+ll++vlv+vLa++f+kef+pe+qaa++k++a+vanala+kYh
               HBB_TRIIN   1 VHLTPEEKALVIGLWAKVNVKEYGGEALGRLLVVYPWTQRFFEHFGDLSSASAIMNNPKVKAHGEKVFTSFGDGLKHLEDLKGAFAELSELHCDKLHVDPENFRLLGNVLVCVLARHFGKEFSPEAQAAYQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_ORNAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.4   0.0   3.2e-71   3.2e-71       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 229.4 bits;  conditional E-value: 3.2e-71
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls  ek++v+++wgkv+++e+G+eaL rllvvyP+t+r+F+ Fgdlss+ av+g++kvkahg+kvlt++g+a+k+lddlkg++akLselH++kl+vdpenf+ l++vl+vvLa++f+k+f+pevqaa++kl+++va+al++kYh
               HBB_ORNAN   1 VHLSGGEKSAVTNLWGKVNINELGGEALGRLLVVYPWTQRFFEAFGDLSSAGAVMGNPKVKAHGAKVLTSFGDALKNLDDLKGTFAKLSELHCDKLHVDPENFNRLGNVLIVVLARHFSKDFSPEVQAAWQKLVSGVAHALGHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_LARRI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  228.5   0.0   5.7e-71   5.7e-71       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 228.5 bits;  conditional E-value: 5.7e-71
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vh+saeek+l++ +wgkv++ ++GaeaL+rll+vyP+t+r+F +Fg+lss++a++g++ v+ahgkkvlt++geavk+ld++k+++a+LselH++kl+vdpenf+ll+++l++vLaa+f k+ftp+ qaa++kl+++va+ala+kYh
               HBB_LARRI   1 VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAINGNPMVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKDFTPDSQAAWQKLVRVVAHALARKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB_TUPGL  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  224.2   0.0   1.3e-69   1.3e-69       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 224.2 bits;  conditional E-value: 1.3e-69
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vhls eeka+v+ +wgkv+ ++vG++ L  ll+vyP+t+r+Fd+Fgdlss++av++++kvkahgkkvlt++++++++ld+lkg++akLselH++kl+vdpenf+ll++vlv vLa++f+ eftp+vqaa++k++a+vanala+kYh
               HBB_TUPGL   1 VHLSGEEKAAVTGLWGKVDLEKVGGQSLGSLLIVYPWTQRFFDSFGDLSSPSAVMSNPKVKAHGKKVLTSFSDGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVRVLACNFGPEFTPQVQAAFQKVVAGVANALAHKYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB1_VAREX  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.5   0.1   1.6e-68   1.6e-68       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 220.5 bits;  conditional E-value: 1.6e-68
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vh++aeek+l+ ++wgk++++ +G+e+L+ llv yP+t+r+F++Fg+lss++a++g+++vkahgkkvlt++g+a+k+ld++k+++akLselH++kl+vdp+nfkll++vlv+vLa +++keftp+++aa++kl+++v+++la++Yh
              HBB1_VAREX   1 VHWTAEEKQLICSLWGKIDVGLIGGETLAGLLVIYPWTQRQFSHFGNLSSPTAIAGNPRVKAHGKKVLTSFGDAIKNLDNIKDTFAKLSELHCDKLHVDPTNFKLLGNVLVIVLADHHGKEFTPAHHAAYQKLVNVVSHSLARRYH 146
                             8************************************************************************************************************************************************8 PP

>> HBBL_RANCA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.5   0.3   8.5e-65   8.5e-65       2     147 .]       1     146 []       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 208.5 bits;  conditional E-value: 8.5e-65
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakYh 147
                             vh++aeeka +++vw+kv++++ G+eaL+rl++vyP+t+ryF++Fgdlss++a++g++kv+ahgkk+l a+++a+++ldd+kg+l++Lse Ha++l+vdpenf+ l+evl+vvL ak++k+f+p+vq++++k++a++ +al++ Yh
              HBBL_RANCA   1 VHWTAEEKAVINSVWQKVDVEQDGHEALTRLFIVYPWTQRYFSTFGDLSSPAAIAGNPKVHAHGKKILGAIDNAIHNLDDVKGTLHDLSEEHANELHVDPENFRRLGEVLIVVLGAKLGKAFSPQVQHVWEKFIAVLVDALSHSYH 146
                             8************************************************************************************************************************************************8 PP

>> HBB2_XENTR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  203.6   0.9   2.8e-63   2.8e-63       2     146 ..       1     145 [.       1     146 [] 1.00

  Alignments for each domain:
  == domain 1  score: 203.6 bits;  conditional E-value: 2.8e-63
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             vh++aeeka++++vwgkv++++ G++aL+rllvvyP+t+ryF++Fg+ls+ +av+g+ kvkahg+kvl+a+g+a+++ldd+k++l+ Ls++Ha++l+vdpenfk l++vlv+vLaak++++ftp+vqa+++kl a++ +al++ Y
              HBB2_XENTR   1 VHWTAEEKATIASVWGKVDIEQDGHDALSRLLVVYPWTQRYFSSFGNLSNVSAVSGNVKVKAHGNKVLSAVGSAIQHLDDVKSHLKGLSKSHAEDLHVDPENFKRLADVLVIVLAAKLGSAFTPQVQAVWEKLNATLVAALSHGY 145
                             8***********************************************************************************************************************************************9 PP

>> HBA_MESAU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  202.2   0.3   7.5e-63   7.5e-63       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 202.2 bits;  conditional E-value: 7.5e-63
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k++++++wgk+  +a+e+GaeaLer++ vyP+tk+yF++F d+s     +gsa+vk+hgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p++ftp+v+a+ldk++a+v+++l++kY
               HBA_MESAU   2 LSAKDKTNISEAWGKIggHAGEYGAEALERMFFVYPTTKTYFPHF-DVS-----HGSAQVKGHGKKVADALTNAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPADFTPAVHASLDKFFASVSTVLTSKY 140
                             89**************9889*************************.999.....******************************************************************************************* PP

>> HBA_PONPY  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.3   0.7   1.2e-61   1.2e-61       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 198.3 bits;  conditional E-value: 1.2e-61
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k++vk++wgkv  +a+++GaeaLer++ ++P+tk+yF++F dls     +gsa+vk hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+la+v+++l++kY
               HBA_PONPY   2 LSPADKTNVKTAWGKVgaHAGDYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKDHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                             799*************87789************************.**9.....******************************************************************************************* PP

>> HBA_MACFA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  197.6   0.3   1.9e-61   1.9e-61       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 197.6 bits;  conditional E-value: 1.9e-61
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k++vka+wgkv  +a+e+GaeaLer++ ++P+tk+yF++F dls     +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+la+v+++l++kY
               HBA_MACFA   2 LSPADKTNVKAAWGKVggHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                             799*************9889*************************.**9.....******************************************************************************************* PP

>> HBA_MACSI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  197.1   0.3   2.8e-61   2.8e-61       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 197.1 bits;  conditional E-value: 2.8e-61
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k++vk++wgkv  +a+e+GaeaLer++ ++P+tk+yF++F dls     +gsa+vk+hgkkv++al+ av ++dd+ +al++Ls+lHa+kl+vdp+nfklls++l+v+Laa++p+eftp+v+a+ldk+la+v+++l++kY
               HBA_MACSI   2 LSPADKTNVKDAWGKVggHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 140
                             799*************9889*************************.**9.....******************************************************************************************* PP

>> HBA_AILME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.6   0.1   3.9e-61   3.9e-61       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 196.6 bits;  conditional E-value: 3.9e-61
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k++vka w+k+  +a+e+G+eaLer + ++P+tk+yF++F dls      gsa+vkahgkkv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v+a+ldk+++av+++l++kY
               HBA_AILME   2 LSPADKTNVKATWDKIggHAGEYGGEALERTFASFPTTKTYFPHF-DLS-----PGSAQVKAHGKKVADALTTAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFSAVSTVLTSKY 140
                             799*************9889*************************.**9.....9****************************************************************************************** PP

>> HBA_PHACO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.9   0.4   1.3e-60   1.3e-60       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 194.9 bits;  conditional E-value: 1.3e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k++vk +++k+  +a+e+GaeaLer++++yP+tk+yF++F dls     +gsa++k+hgkkv++al eav+++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l+av ++l+akY
               HBA_PHACO   2 LSAADKNNVKGIFTKIagHAEEYGAEALERMFITYPSTKTYFPHF-DLS-----HGSAQIKGHGKKVVAALIEAVNHIDDITGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKY 140
                             89**************988**************************.**9.....******************************************************************************************* PP

>> HBA2_BOSMU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.9   0.4   1.3e-60   1.3e-60       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 194.9 bits;  conditional E-value: 1.3e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k +vka+wgkv  +a e+GaeaLer++ ++P+tk+yF++F dls     +gsa+vk+hg+kv++al++av +lddl gal++Ls+lHa+kl+vdp+nfklls+ l+v+La+++p++ftp+v+a+ldk+la+v+++l++kY
              HBA2_BOSMU   2 LSAADKGNVKAAWGKVggHAAEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKY 140
                             79**************88899************************.**9.....******************************************************************************************* PP

>> HBA_FRAPO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.9   0.4   1.4e-60   1.4e-60       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 194.9 bits;  conditional E-value: 1.4e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k++vk ++gk+  +a+++GaeaLer++++yP+tk+yF++F dls     +gsa+vk+hgkkv++al ea +++dd++g+l+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+++tpev+a+ldk+l+av n+l+akY
               HBA_FRAPO   2 LSAADKNNVKGIFGKIssHAEDYGAEALERMFITYPSTKTYFPHF-DLS-----HGSAQVKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPSALTPEVHASLDKFLCAVGNVLTAKY 140
                             89**************87799************************.**9.....******************************************************************************************* PP

>> HBA2_GALCR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.7   0.6   1.6e-60   1.6e-60       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 194.7 bits;  conditional E-value: 1.6e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k++vka+w+kv  +a+++GaeaLer++ ++P+tk+yF++F dls     +gs++vk+hgkkv++al++av ++dd+ +al++Ls+lHa+kl+vdp+nfkll ++l+v+La+++p+eftp+v+a+ldk++a+v+++l++kY
              HBA2_GALCR   2 LSPTDKSNVKAAWEKVgaHAGDYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSTQVKGHGKKVADALTNAVLHVDDMPSALSALSDLHAHKLRVDPVNFKLLRHCLLVTLACHHPAEFTPAVHASLDKFMASVSTVLTSKY 140
                             799*************87789************************.**9.....******************************************************************************************* PP

>> HBA_ERIEU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  193.1   0.1   4.9e-60   4.9e-60       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 193.1 bits;  conditional E-value: 4.9e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++ka+vk+ wgk+  + +e+G+eaL r+++ +P+tk+yF++F dl+      gsa+vk+hgkkv++al++av++ldd+ gal++Ls+lHa+kl+vdp+nfklls++l+v+La ++p++ftp+v+a+ldk+la+va++l++kY
               HBA_ERIEU   2 LSATDKANVKTFWGKLggHGGEYGGEALDRMFQAHPTTKTYFPHF-DLN-----PGSAQVKGHGKKVADALTTAVNNLDDVPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLALHHPADFTPAVHASLDKFLATVATVLTSKY 140
                             79**************87789************************.998.....9****************************************************************************************** PP

>> HBA_PROLO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.9   0.0   5.6e-60   5.6e-60       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 192.9 bits;  conditional E-value: 5.6e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++ka++ka w+k+  +a+e+G+eaLer + ++P+tk+yF++F dls      gsa+vkahgkkv++al+ av +lddl gal++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v+a+ldk++++v+++l++kY
               HBA_PROLO   2 LSPADKANIKATWDKIggHAGEYGGEALERTFASFPTTKTYFPHF-DLS-----PGSAQVKAHGKKVADALTLAVGHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHASLDKFFTSVSTVLTSKY 140
                             799*************9889*************************.**9.....9****************************************************************************************** PP

>> HBA_ANSSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.3   0.4   8.1e-60   8.1e-60       4     146 ..       2     140 ..       1     141 [] 0.99

  Alignments for each domain:
  == domain 1  score: 192.3 bits;  conditional E-value: 8.1e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k +vk+v+gk+  +a+e+Gae+L+r+++++P+tk+yF++F dl+      gsa++kahgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfk+l+++++vvLa ++p+ +tpev+a++dk+l+ava++l+akY
               HBA_ANSSE   2 LSAADKGNVKTVFGKIggHAEEYGAETLQRMFQTFPQTKTYFPHF-DLQ-----PGSAQIKAHGKKVAAALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVLAIHHPSLLTPEVHASMDKFLCAVATVLTAKY 140
                             79**************988**************************.998.....9****************************************************************************************** PP

>> HBA_PAGLA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  192.3   0.5   8.1e-60   8.1e-60       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 192.3 bits;  conditional E-value: 8.1e-60
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+++k+++ka w+k+  +a+e+GaeaLer ++++P+tk+yF++F dls     +gsa+vkahgkkv++al+ av +l+dl +al++Ls+lHa+kl+vdp+nfklls++l+v+La+++p+eftp+v++aldk+++av+++l++kY
               HBA_PAGLA   2 LSSADKNNIKATWDKIgsHAGEYGAEALERTFISFPTTKTYFPHF-DLS-----HGSAQVKAHGKKVADALTLAVGHLEDLPNALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFTPAVHSALDKFFSAVSTVLTSKY 140
                             799*************88899************************.**9.....******************************************************************************************* PP

>> HBA_TRIOC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  189.8   0.5     5e-59     5e-59       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 189.8 bits;  conditional E-value: 5e-59
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k++vk+v++k+  +a+++Gae+Ler++++yP tk+yF++F dl      +gsa++kahgkkv+ al eav+++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a ++p+ +tpev+a+ldk+l+av n+l+akY
               HBA_TRIOC   2 LSANDKTNVKTVFTKItgHAEDYGAETLERMFITYPPTKTYFPHF-DLH-----HGSAQIKAHGKKVVGALIEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSVLTPEVHASLDKFLCAVGNVLSAKY 140
                             89**************8889*************************.996.....******************************************************************************************* PP

>> HBAD_CHLME  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  189.4   0.5   6.6e-59   6.6e-59       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 189.4 bits;  conditional E-value: 6.6e-59
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             l+a++k+l++++w+kv  +++e+G+eaL+r++ +yP+tk+yF++F dl       gs++v++hgkkv++alg+avk+ld+l++al++Ls+lHa++l+vdp nfkll++++ vvLa++++k+++pe++aa+dk+l+ava++la+kY
              HBAD_CHLME   2 LTADDKKLLTQLWEKVagHQEEFGSEALQRMFLTYPQTKTYFPHF-DLH-----PGSEQVRGHGKKVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPANFKLLAQCFQVVLATHLGKDYSPEMHAAFDKFLSAVAAVLAEKY 140
                             89**************8889*************************.996.....9****************************************************************************************** PP

>> HBAZ_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.5   0.1   2.5e-58   2.5e-58       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 187.5 bits;  conditional E-value: 2.5e-58
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             l+++e+++v ++wgk+  +ad+vG+eaL+rl+ +yP+tk+yF++F dl      +gs++++ahg+kv++a+g+avk++d+++galakLselHa+ l+vdp+nfk+ls++l+v+La+++p++ft++++aa+dk+l+ v+++l++kY
              HBAZ_HORSE   2 LTKAERTMVVSIWGKIsmQADAVGTEALQRLFSSYPQTKTYFPHF-DLH-----EGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKY 140
                             899*************66689************************.996.....9****************************************************************************************** PP

>> HBAD_PASMO  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.4   0.1   2.7e-58   2.7e-58       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 187.4 bits;  conditional E-value: 2.7e-58
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             l+ae+k+l++++wgk+   ++e+Ga+aL r++++yP+tk+yF++F dls     +gs+++++hgkkv++al++a+k+ld+l++al++Ls+lHa++l+vdp+nfk+ls++l v La++++ke++pev++a+dk+++ava++la+kY
              HBAD_PASMO   2 LTAEDKKLIQQIWGKLggAEEEIGADALWRMFHSYPSTKTYFPHF-DLS-----QGSDQIRGHGKKVVAALSNAIKNLDNLSQALSELSNLHAYNLRVDPVNFKFLSQCLQVSLATRLGKEYSPEVHSAVDKFMSAVASVLAEKY 140
                             89**************65578************************.**9.....9****************************************************************************************** PP

>> HBA_COLLI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.4   0.2   2.8e-58   2.8e-58       4     146 ..       2     140 ..       1     141 [] 0.98

  Alignments for each domain:
  == domain 1  score: 187.4 bits;  conditional E-value: 2.8e-58
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++k++vkav+ k+  +a+++G+eaLerl+++yP+tk+yF++F dls     +gsa++k+hgkkv++al ea +++dd++gal+kLs+lHa+kl+vdp+nfkll+++++vv+a +fp+ +tpev+a+ldk++ av ++l+akY
               HBA_COLLI   2 LSANDKSNVKAVFAKIggQAGDLGGEALERLFITYPQTKTYFPHF-DLS-----HGSAQIKGHGKKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTPEVHASLDKFVLAVGTVLTAKY 140
                             89**************77799************************.**9.....******************************************************************************************* PP

>> HBB2_TRICR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  181.2   0.0   2.2e-56   2.2e-56       2     146 ..       1     145 []       1     145 [] 1.00

  Alignments for each domain:
  == domain 1  score: 181.2 bits;  conditional E-value: 2.2e-56
                             xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   2 vhlsaeekalvkavwgkveadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             vhl+ae++++++a++gkv++d++G+++L+rl+vv+P+++ryF++Fgdlss+da+++++kv ahg+kv++++ ea+k+ld+l++ +a+Ls +H+ k+ vdpenfkl+s +++v+La +++++f+++ q a++kl+++v++al++ Y
              HBB2_TRICR   1 VHLTAEDRKEIAAILGKVNVDSLGGQCLARLIVVNPWSRRYFHDFGDLSSCDAICRNPKVLAHGAKVMRSIVEATKHLDNLREYYADLSVTHSLKFYVDPENFKLFSGIVIVCLALTLQTDFSCHKQLAFEKLMKGVSHALGHGY 145
                             8**********************************************************************************************************************************************99 PP

>> HBA4_SALIR  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  179.8   0.1   5.8e-56   5.8e-56       4     146 ..       2     141 ..       1     142 [] 0.98

  Alignments for each domain:
  == domain 1  score: 179.8 bits;  conditional E-value: 5.8e-56
                             xxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkv..eadevGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             lsa++ka+vka+wgk+  ++de+G++aL+r+lvvyP+tk yF+++++++      gsa vk+hg +++++++++v ++ddl g l+kLselHatkl+vdp+nfk+l++ l+vv+aa fp+eftpe++ ++dk+l+++a ala+kY
              HBA4_SALIR   2 LSAKDKANVKAIWGKIlpKSDEIGEQALSRMLVVYPQTKAYFSHWASVA-----PGSAPVKKHGITIMNQIDDCVGHMDDLFGFLTKLSELHATKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHLSVDKFLQQLALALAEKY 141
                             89**************999**************************7765.....9****************************************************************************************** PP

>> MYG_LYCPI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  179.0   1.8   1.1e-55   1.1e-55       4     146 ..       2     146 ..       1     147 [. 0.97

  Alignments for each domain:
  == domain 1  score: 179.0 bits;  conditional E-value: 1.1e-55
                             xxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkveadevG..aeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+ e++ v ++wgkve+d +G  +e+L+rl++++Pet ++FdkF++l++ed++kgs+++k+hg++vltalg ++kk+++++++l++L+++Hatk+k+++++++++s+++++vL++k++++f+++++aa++k+l++++n++aakY
               MYG_LYCPI   2 LSDGEWQIVLNIWGKVETDLAGhgQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQNKHSGDFHADTEAAMKKALELFRNDIAAKY 146
                             7889************99966544************************************************************************************************************************* PP

>> MYG_SAISC  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  178.6   1.0   1.4e-55   1.4e-55       4     146 ..       2     146 ..       1     147 [. 0.98

  Alignments for each domain:
  == domain 1  score: 178.6 bits;  conditional E-value: 1.4e-55
                             xxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkvead..evGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+ e++lv ++wgkvead  ++G+e+L+ l++ +Pet ++FdkF++l+sed++k+s+++k+hg++vltalg ++kk+++++++l++L+++Hatk+k+++++++l+s+++v+vL++k+p++f++++q a++k+l++++n++aakY
               MYG_SAISC   2 LSDGEWQLVLNIWGKVEADipSHGQEVLISLFKGHPETLEKFDKFKHLKSEDEMKASEELKKHGTTVLTALGGILKKKGQHEAELKPLAQSHATKHKIPVKYLELISDAIVHVLQKKHPGDFGADAQGAMKKALELFRNDMAAKY 146
                             7899************9998899************************************************************************************************************************** PP

>> MYG_ESCGI  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.3   2.2   3.4e-55   3.4e-55       4     146 ..       2     146 ..       1     147 [. 0.97

  Alignments for each domain:
  == domain 1  score: 177.3 bits;  conditional E-value: 3.4e-55
                             xxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkveadevG..aeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls++e++lv ++w kvead +G  +++L+rl++ +Pet ++FdkF++l++e+++k+s+++k+hg++vltalg ++kk+++++++l++L+++Hatk+k+++++++++s+++++vL++++p++f++++qaa++k+l+++++++aakY
               MYG_ESCGI   2 LSDAEWQLVLNIWAKVEADVAGhgQDILIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQAAMNKALELFRKDIAAKY 146
                             7999************99866444************************************************************************************************************************* PP

>> MYG_PROGU  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.6   0.2   5.7e-55   5.7e-55       4     146 ..       2     146 ..       1     147 [. 0.97

  Alignments for each domain:
  == domain 1  score: 176.6 bits;  conditional E-value: 5.7e-55
                             xxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkvead..evGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+ e++lv +vwgkve d   +G+e+L+rl++ +Pet ++FdkF++l++ed++++s+++k+hg++vltalg ++kk+++++++la+L+++Hatk+k+++++++++se++++vL++k+p++f++++q a++k+l++++n++aakY
               MYG_PROGU   2 LSDGEWQLVLNVWGKVEGDlsGHGQEVLIRLFKGHPETLEKFDKFKHLKAEDEMRASEELKKHGTTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDIAAKY 146
                             7899************98833567************************************************************************************************************************* PP

>> MYG_HORSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  175.8   1.0     1e-54     1e-54       4     146 ..       2     146 ..       1     147 [. 0.97

  Alignments for each domain:
  == domain 1  score: 175.8 bits;  conditional E-value: 1e-54
                             xxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkveadevG..aeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+ e+++v +vwgkvead +G  +e+L+rl++ +Pet ++FdkF++l++e+++k+s+++k+hg+ vltalg ++kk+++++++l++L+++Hatk+k+++++++++s+++++vL++k+p++f++++q a++k+l++++n++aakY
               MYG_HORSE   2 LSDGEWQQVLNVWGKVEADIAGhgQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGNFGADAQGAMTKALELFRNDIAAKY 146
                             7899************99965444************************************************************************************************************************* PP

>> MYG_MOUSE  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  175.2   0.3   1.6e-54   1.6e-54       4     146 ..       2     146 ..       1     147 [. 0.97

  Alignments for each domain:
  == domain 1  score: 175.2 bits;  conditional E-value: 1.6e-54
                             xxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   4 lsaeekalvkavwgkveadevG..aeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ls+ e++lv +vwgkvead +G  +e+L+ l++++Pet ++FdkF++l+se+++kgs+++k+hg +vltalg+++kk++++++++++L+++Hatk+k+++++++++se+++ vL+++++++f++++q a++k+l++++n++aakY
               MYG_MOUSE   2 LSDGEWQLVLNVWGKVEADLAGhgQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKY 146
                             7899*************9966544************************************************************************************************************************* PP

>> MYG_MUSAN  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  142.6   0.3   1.8e-44   1.8e-44       8     146 ..       2     141 ..       1     142 [. 0.96

  Alignments for each domain:
  == domain 1  score: 142.6 bits;  conditional E-value: 1.8e-44
                             xxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
  sp|P02024|HBB_GORGO-i1   8 ekalvkavwgkvead..evGaeaLerllvvyPetkryFdkFgdlssedavkgsakvkahgkkvltalgeavkklddlkgalakLselHatklkvdpenfkllsevlvvvLaakfpkeftpevqaaldkllaavanalaakY 146
                             ++++v++vw+ ve+d  ++G+++L rl+++yPe++++F+kF+++s   ++k++a++ka++++vl+alg++vkk++++++ +++L+++H+t++k++p++f+ ++++ v vL++++p+e++++vqaa++ +++ + +++ ++Y
               MYG_MUSAN   2 DWEKVNSVWSAVESDltAIGQNILLRLFEQYPESQNHFPKFKNKS-LGELKDTADIKAQADTVLSALGNIVKKKGSHSQPVKALAATHITTHKIPPHYFTKITTIAVDVLSEMYPSEMNAQVQAAFSGAFKIICSDIEKEY 141
                             7899********9886699**********************9998.667****************************************************************************************9999 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (147 nodes)
Target sequences:                         45  (6519 residues searched)
Passed MSV filter:                        45  (1); expected 0.9 (0.02)
Passed bias filter:                       45  (1); expected 0.9 (0.02)
Passed Vit filter:                        45  (1); expected 0.0 (0.001)
Passed Fwd filter:                        45  (1); expected 0.0 (1e-05)
Initial search space (Z):                 45  [actual number of targets]
Domain search space  (domZ):              45  [number of targets reported over threshold]
# CPU time: 0.13u 0.00s 00:00:00.13 Elapsed: 00:00:00.12
# Mc/sec: 7.64

@@ New targets included:   0
@@ New alignment includes: 46 subseqs (was 46), including original query
@@
@@ CONVERGED (in 2 rounds). 
@@

//
[ok]