view test-data/phmmer.out @ 7:b28e8ed99424 draft default tip

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
author iuc
date Wed, 21 Jul 2021 14:11:12 +0000
parents be0cc39776f9
children
line wrap: on
line source

# phmmer :: search a protein sequence against a protein database
# HMMER 3.3.2 (Nov 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /tmp/tmpzdnl83p_/files/f/3/7/dataset_f37673ce-2825-4214-827f-9fd8798aa730.dat
# target sequence database:        /tmp/tmpzdnl83p_/files/4/8/e/dataset_48ee2b1d-0f10-4a66-bc8d-a3f4938d2e4a.dat
# max ASCII text line length:      unlimited
# Vit filter P threshold:       <= 0.001
# Fwd filter P threshold:       <= 1e-05
# random number seed set to:       4
# number of worker threads:        0
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       MYG_ESCGI  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.9e-97  310.4   5.6    2.1e-97  310.3   5.6    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    3.2e-11   30.7   0.1    3.5e-11   30.6   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  310.3   5.6   2.1e-97   2.1e-97       1     153 []       2     154 .]       2     154 .] 1.00

  Alignments for each domain:
  == domain 1  score: 310.3 bits;  conditional E-value: 2.1e-97
            MYG_ESCGI   1 vlsdaewqlvlniwakveadvaghgqdilirlfkghpetlekfdkfkhlkteaemkasedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpgdfgadaqaamnkalelfrkdiaakykelgfqg 153
                          vls+ ewqlvl++wakveadvaghgqdilirlfk+hpetlekfd+fkhlkteaemkasedlkkhg tvltalg+ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhsrhpgdfgadaq amnkalelfrkdiaakykelg+qg
  sp|P02185|MYG_PHYCD   2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          79******************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.6   0.1   3.5e-11   3.5e-11       6     146 ..       8     146 ..       3     147 .] 0.91

  Alignments for each domain:
  == domain 1  score: 30.6 bits;  conditional E-value: 3.5e-11
            MYG_ESCGI   6 ewqlvlniwakveadvaghgqdilirlfkghpetlekfdkfkhlkteaemkasedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpgdfgadaqaamnkalelfrkdiaaky 146
                          e   v  +w kv  d  g   + l rl+  +p t   f+ f  l t   +  +  +k hg  vl a++  l    + +  +  l++ h  k  +  + ++++ + ++ vl  +   +f    qaa  k +      +a ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          6677889******99876..57899**********************9999*****************9999999****************99999999***********8888889**********99887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.88
//
Query:       MYG_HORSE  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    7.1e-93  295.7   5.0    7.9e-93  295.6   5.0    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    7.5e-12   32.7   0.1      9e-12   32.5   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  295.6   5.0   7.9e-93   7.9e-93       2     153 .]       3     154 .]       2     154 .] 0.99

  Alignments for each domain:
  == domain 1  score: 295.6 bits;  conditional E-value: 7.9e-93
            MYG_HORSE   2 lsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkasedlkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhpgnfgadaqgamtkalelfrndiaakykelgfqg 153
                          ls+gewq vl+vw+kvead+aghgq++lirlf +hpetlekfd+fkhlkteaemkasedlkkhg  vltalg+ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhs+hpg+fgadaqgam kalelfr diaakykelg+qg
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          89*****************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.5   0.1     9e-12     9e-12       7     146 ..       9     146 ..       4     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 32.5 bits;  conditional E-value: 9e-12
            MYG_HORSE   7 wqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkasedlkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhpgnfgadaqgamtkalelfrndiaaky 146
                             v  +wgkv  d  g   e l rl+  +p t   f+ f  l t   +  +  +k hg  vl a++  l    + +  +  l++ h  k  +  + ++++ + ++ vl       f    q+a  k +    n +a ky
  sp|P02024|HBB_GORGO   9 KSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          5668889*****99875..699************************9999*****************9999999****************99999999**********987777789***********999999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.02
//
Query:       MYG_PROGU  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    7.4e-88  279.4   3.7    8.3e-88  279.2   3.7    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    1.5e-12   35.0   0.1    1.6e-12   34.9   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  279.2   3.7   8.3e-88   8.3e-88       2     153 .]       3     154 .]       2     154 .] 0.99

  Alignments for each domain:
  == domain 1  score: 279.2 bits;  conditional E-value: 8.3e-88
            MYG_PROGU   2 lsdgewqlvlnvwgkvegdlsghgqevlirlfkghpetlekfdkfkhlkaedemraseelkkhgttvltalggilkkkgqhaaelaplaqshatkhkipvkylefiseaiiqvlqskhpgdfgadaqgamskalelfrndiaakykelgfqg 153
                          ls+gewqlvl+vw+kve+d++ghgq++lirlfk+hpetlekfd+fkhlk e em+ase+lkkhg tvltalg+ilkkkg h ael plaqshatkhkip+kylefiseaii vl s+hpgdfgadaqgam+kalelfr diaakykelg+qg
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          89*****************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.9   0.1   1.6e-12   1.6e-12       6     146 ..       8     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 34.9 bits;  conditional E-value: 1.6e-12
            MYG_PROGU   6 ewqlvlnvwgkvegdlsghgqevlirlfkghpetlekfdkfkhlkaedemraseelkkhgttvltalggilkkkgqhaaelaplaqshatkhkipvkylefiseaiiqvlqskhpgdfgadaqgamskalelfrndiaaky 146
                          e   v  +wgkv  d    g e l rl+  +p t   f+ f  l   d +  + ++k hg  vl a++  l         +a l++ h  k  +  + ++++   ++ vl      +f    q+a  k +    n +a ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKVNVDEV--GGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          56678889****98865..6799********************************************999999999999************99999999***********9888889*************99999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.01
//
Query:       MYG_SAISC  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      5e-87  276.6   4.6    5.5e-87  276.5   4.6    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
      1e-12   35.5   0.1    1.1e-12   35.3   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  276.5   4.6   5.5e-87   5.5e-87       2     153 .]       3     154 .]       2     154 .] 0.99

  Alignments for each domain:
  == domain 1  score: 276.5 bits;  conditional E-value: 5.5e-87
            MYG_SAISC   2 lsdgewqlvlniwgkveadipshgqevlislfkghpetlekfdkfkhlksedemkaseelkkhgttvltalggilkkkgqheaelkplaqshatkhkipvkylelisdaivhvlqkkhpgdfgadaqgamkkalelfrndmaakykelgfqg 153
                          ls+gewqlvl++w+kvead+  hgq++li lfk+hpetlekfd+fkhlk+e emkase+lkkhg tvltalg+ilkkkg heaelkplaqshatkhkip+kyle+is+ai+hvl  +hpgdfgadaqgam kalelfr d+aakykelg+qg
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          89*****************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.3   0.1   1.1e-12   1.1e-12       6     146 ..       8     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 35.3 bits;  conditional E-value: 1.1e-12
            MYG_SAISC   6 ewqlvlniwgkveadipshgqevlislfkghpetlekfdkfkhlksedemkaseelkkhgttvltalggilkkkgqheaelkplaqshatkhkipvkylelisdaivhvlqkkhpgdfgadaqgamkkalelfrndmaaky 146
                          e   v  +wgkv  d    g e l  l+  +p t   f+ f  l + d +  + ++k hg  vl a++  l      +  +  l++ h  k  +  + ++l+ + +v vl      +f    q+a +k +    n +a ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          5667889*****877..6799**********************************************9999999999**************99999999***********998899**************99999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.04
//
Query:       MYG_LYCPI  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      7e-86  272.9   4.1    7.8e-86  272.8   4.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    5.6e-15   42.8   0.0    6.1e-15   42.7   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  272.8   4.1   7.8e-86   7.8e-86       2     153 .]       3     154 .]       2     154 .] 0.99

  Alignments for each domain:
  == domain 1  score: 272.8 bits;  conditional E-value: 7.8e-86
            MYG_LYCPI   2 lsdgewqivlniwgkvetdlaghgqevlirlfknhpetldkfdkfkhlktedemkgsedlkkhgntvltalggilkkkghheaelkplaqshatkhkipvkylefisdaiiqvlqnkhsgdfhadteaamkkalelfrndiaakykelgfqg 153
                          ls+gewq+vl++w+kve d+aghgq++lirlfk+hpetl+kfd+fkhlkte emk+sedlkkhg tvltalg+ilkkkghheaelkplaqshatkhkip+kylefis+aii vl ++h gdf ad + am kalelfr diaakykelg+qg
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          89*****************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.7   0.0   6.1e-15   6.1e-15       6     146 ..       8     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 42.7 bits;  conditional E-value: 6.1e-15
            MYG_LYCPI   6 ewqivlniwgkvetdlaghgqevlirlfknhpetldkfdkfkhlktedemkgsedlkkhgntvltalggilkkkghheaelkplaqshatkhkipvkylefisdaiiqvlqnkhsgdfhadteaamkkalelfrndiaaky 146
                          e   v  +wgkv  d  g   e l rl+  +p t   f+ f  l t d + g+  +k hg  vl a++  l    + +  +  l++ h  k  +  + ++++ + ++ vl +    +f    +aa +k +    n +a ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          5667889*******9875..699*********************************************9999999****************99999999************99999***************9999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.06
//
Query:       MYG_MOUSE  [L=153]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      6e-85  270.1   2.6    6.7e-85  269.9   2.6    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    3.2e-12   34.0   0.0    3.5e-12   33.9   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  269.9   2.6   6.7e-85   6.7e-85       2     153 .]       3     154 .]       2     154 .] 0.99

  Alignments for each domain:
  == domain 1  score: 269.9 bits;  conditional E-value: 6.7e-85
            MYG_MOUSE   2 lsdgewqlvlnvwgkveadlaghgqevliglfkthpetldkfdkfknlkseedmkgsedlkkhgctvltalgtilkkkgqhaaeiqplaqshatkhkipvkylefiseiiievlkkrhsgdfgadaqgamskalelfrndiaakykelgfqg 153
                          ls+gewqlvl+vw+kvead+aghgq++li lfk+hpetl+kfd+fk+lk+e +mk+sedlkkhg tvltalg ilkkkg h ae++plaqshatkhkip+kylefise ii vl  rh gdfgadaqgam+kalelfr diaakykelg+qg
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          89*****************************************************************************************************************************************************8 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.9   0.0   3.5e-12   3.5e-12       6     146 ..       8     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 33.9 bits;  conditional E-value: 3.5e-12
            MYG_MOUSE   6 ewqlvlnvwgkveadlaghgqevliglfkthpetldkfdkfknlkseedmkgsedlkkhgctvltalgtilkkkgqhaaeiqplaqshatkhkipvkylefiseiiievlkkrhsgdfgadaqgamskalelfrndiaaky 146
                          e   v  +wgkv  d  g   e l  l+  +p t   f+ f +l + + + g+  +k hg  vl a++  l         +  l++ h  k  +  + ++++  +++ vl  +   +f    q+a  k +    n +a ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKVNVDEVG--GEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          56678889******9876..589999*********************************************999999999***********99999999***********999999**************99999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (153 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.08
//
Query:       MYG_MUSAN  [L=148]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      1e-35  110.0   0.1    1.1e-35  109.9   0.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
    8.3e-09   22.9   0.0    9.1e-09   22.7   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.9   0.1   1.1e-35   1.1e-35       2     148 .]       7     154 .]       6     154 .] 0.98

  Alignments for each domain:
  == domain 1  score: 109.9 bits;  conditional E-value: 1.1e-35
            MYG_MUSAN   2 dwekvnsvwsavesdltaigqnillrlfeqypesqnhfpkfkn.kslgelkdtadikaqadtvlsalgnivkkkgshsqpvkalaathitthkipphyftkittiavdvlsemypsemnaqvqaafsgafkiicsdiekeykaanfqg 148
                          +w+ v  vw+ ve+d+   gq+il+rlf+ +pe+   f +fk+ k+ +e+k + d+k    tvl+alg i+kkkg h   +k la +h t hkip  y+  i+   + vl   +p ++ a  q a++ a++++  di  +yk   +qg
  sp|P02185|MYG_PHYCD   7 EWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHlKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG 154
                          7*****************************************867889************************************************************************************************9998 PP

>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.7   0.0   9.1e-09   9.1e-09       6     131 ..      12     136 ..       7     147 .] 0.87

  Alignments for each domain:
  == domain 1  score: 22.7 bits;  conditional E-value: 9.1e-09
            MYG_MUSAN   6 vnsvwsavesdltaigqnillrlfeqypesqnhfpkfknkslge.lkdtadikaqadtvlsalgnivkkkgshsqpvkalaathitthkipphyftkittiavdvlsemypsemnaqvqaafsgafk 131
                          v ++w  v  d   +g   l rl+  yp +q  f  f + s  + +     +ka    vl a+++ +    +       l+  h     + p+ f  +  + v vl+  +  e+   vqaa+     
  sp|P02024|HBB_GORGO  12 VTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTPDaVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVA 136
                          77899988766..78999*********************998762678999***********999998888888888999999**9999********************************986655 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (148 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.08
//
Query:       HBA_AILME  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.4e-34  106.1   0.2    1.7e-34  105.9   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.4e-11   29.8   0.5    6.4e-11   29.6   0.5    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.9   0.2   1.7e-34   1.7e-34       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 105.9 bits;  conditional E-value: 1.7e-34
            HBA_AILME   2 lspadktnvkatwdkigghageyggealertfasfpttktyfphf.dlsp.....gsaqvkahgkkvadalttavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpaeftpavhasldkffsavstvltsky 140
                          l+p +k+ v a w k++    e ggeal r +  +p t+ +f  f dls      g+ +vkahgkkv  a++  ++hld+l g ++ ls+lh  kl+vdp nfkll + l+  la h   eftp v+a+  k  + v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLSTpdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************95..78*********************99977774244448889***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.6   0.5   6.4e-11   6.4e-11       3     140 ..       4     147 ..       2     148 .. 0.77

  Alignments for each domain:
  == domain 1  score: 29.6 bits;  conditional E-value: 6.4e-11
            HBA_AILME   3 spadktnvkatwdkigghageyggealertfasfpttktyfphfdlspgsaqvka......hgkkvadalttavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpaeftpavhasldkffsavstvltsky 140
                          s  +   v   w k+ +  + +g + l r f s p t   f +f      a++ka      hg  v  al   +       + l  l+  ha k ++    ++++s++++  l s+hp +f    + +++k +      + +ky
  sp|P02185|MYG_PHYCD   4 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKAsedlkkHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          55555667789*******999****************9999888766555555542211116666666666665555666678999******999997777799*****************99999999998887777777777 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.00
//
Query:       HBA_PROLO  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.9e-33  102.5   0.2    2.2e-33  102.3   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    6.3e-10   26.3   0.3    7.5e-10   26.0   0.3    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.3   0.2   2.2e-33   2.2e-33       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 102.3 bits;  conditional E-value: 2.2e-33
            HBA_PROLO   2 lspadkanikatwdkigghageyggealertfasfpttktyfphf.dlsp.....gsaqvkahgkkvadaltlavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhasldkfftsvstvltsky 140
                          l+p +k+ + a w k++    e ggeal r +  +p t+ +f  f dls      g+ +vkahgkkv  a++  ++hld+l g ++ ls+lh  kl+vdp nfkll + l+  la h   eftp v+a+  k    v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLSTpdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************95..78*********************99977774244448889***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.0   0.3   7.5e-10   7.5e-10       8     140 ..       9     147 ..       2     148 .. 0.78

  Alignments for each domain:
  == domain 1  score: 26.0 bits;  conditional E-value: 7.5e-10
            HBA_PROLO   8 anikatwdkigghageyggealertfasfpttktyfphfdlsp......gsaqvkahgkkvadaltlavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhasldkfftsvstvltsky 140
                            +   w k+ +  + +g + l r f s p t   f +f          +s  +k hg  v  al   +       + l  l+  ha k ++    ++++s++++  l  +hp +f    + +++k +      + +ky
  sp|P02185|MYG_PHYCD   9 QLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKteaemkASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          556678*******999****************9988887654401111145556778888888888777777778889************997777899*****************99999999887766666666665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.00
//
Query:       HBA_PAGLA  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      1e-30   93.5   0.2    1.2e-30   93.3   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.4e-10   27.7   0.5      3e-10   27.4   0.5    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.3   0.2   1.2e-30   1.2e-30       4     140 ..       6     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 93.3 bits;  conditional E-value: 1.2e-30
            HBA_PAGLA   4 sadknnikatwdkigshageygaealertfisfpttktyfphf.dls.....hgsaqvkahgkkvadaltlavghledlpnalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhsaldkffsavstvltsky 140
                            +k+ + a w k++    e g eal r ++ +p t+ +f  f dls      g+ +vkahgkkv  a++  ++hl++l   ++ ls+lh  kl+vdp nfkll + l+  la h   eftp v++a  k  + v+  l  ky
  sp|P02024|HBB_GORGO   6 PEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          5689999******95..78*********************99977773333358899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.4   0.5     3e-10     3e-10       2     140 ..       3     147 ..       2     148 .. 0.78

  Alignments for each domain:
  == domain 1  score: 27.4 bits;  conditional E-value: 3e-10
            HBA_PAGLA   2 lssadknnikatwdkigshageygaealertfisfpttktyfphfdlsh......gsaqvkahgkkvadaltlavghledlpnalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhsaldkffsavstvltsky 140
                          ls  +   +   w k+ +  + +g + l r f s p t   f +f          +s  +k hg  v  al   +         l  l+  ha k ++    ++++s++++  l  +hp +f    + a++k +      + +ky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKteaemkASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          566666677789**************************99888886544001111455567788888888776655445555679999********997777899*******************999999999888777777777 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.03
//
Query:       HBA_MACFA  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      4e-33  101.4   0.3    4.8e-33  101.1   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.4e-09   25.2   0.9    1.7e-09   24.9   0.9    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.1   0.3   4.8e-33   4.8e-33       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 101.1 bits;  conditional E-value: 4.8e-33
            HBA_MACFA   2 lspadktnvkaawgkvgghageygaealermflsfpttktyfphf.dls.....hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          l+p +k+ v a wgkv+    e g eal r+++ +p t+ +f  f dls      g+ +vk+hgkkv  a++  ++h+d++   ++ ls+lh  kl+vdp nfkll + l+  la h+  eftp v+a+  k +a v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************95..78*********************99977773333358899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.9   0.9   1.7e-09   1.7e-09       3     140 ..       4     147 ..       2     148 .. 0.81

  Alignments for each domain:
  == domain 1  score: 24.9 bits;  conditional E-value: 1.7e-09
            HBA_MACFA   3 spadktnvkaawgkvgghageygaealermflsfpttktyfphfdls......hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          s  +   v   w+kv +  + +g + l r+f s p t   f +f          +s  +k hg  v  al   +         l  l+  ha k ++    ++++s++++  l ++ p +f    + +++k l      + +ky
  sp|P02185|MYG_PHYCD   4 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          55555667789**************************988887754301111135667889999999999888877778888999*******999997677799******************9999999999988777777777 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.00
//
Query:       HBA_MACSI  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.9e-32   98.6   0.3    3.4e-32   98.4   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.1e-09   25.5   0.8    1.3e-09   25.3   0.8    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.4   0.3   3.4e-32   3.4e-32       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 98.4 bits;  conditional E-value: 3.4e-32
            HBA_MACSI   2 lspadktnvkdawgkvgghageygaealermflsfpttktyfphf.dls.....hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          l+p +k+ v   wgkv+    e g eal r+++ +p t+ +f  f dls      g+ +vk+hgkkv  a++  ++h+d++   ++ ls+lh  kl+vdp nfkll + l+  la h+  eftp v+a+  k +a v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************95..78*********************99977773333358899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.3   0.8   1.3e-09   1.3e-09       2     140 ..       3     147 ..       2     148 .. 0.81

  Alignments for each domain:
  == domain 1  score: 25.3 bits;  conditional E-value: 1.3e-09
            HBA_MACSI   2 lspadktnvkdawgkvgghageygaealermflsfpttktyfphfdls......hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          ls  +   v   w+kv +  + +g + l r+f s p t   f +f          +s  +k hg  v  al   +         l  l+  ha k ++    ++++s++++  l ++ p +f    + +++k l      + +ky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          556666667889**************************988887754301111135667889999999999888877778888999*******999997677799******************9999999999988777777777 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.03
//
Query:       HBA_PONPY  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.4e-33  103.0   0.2    1.6e-33  102.8   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
      3e-10   27.5   0.6    3.5e-10   27.3   0.6    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  102.8   0.2   1.6e-33   1.6e-33       2     140 ..       4     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 102.8 bits;  conditional E-value: 1.6e-33
            HBA_PONPY   2 lspadktnvktawgkvgahagdygaealermflsfpttktyfphf.dls.....hgsaqvkdhgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          l+p +k+ v   wgkv+    + g eal r+++ +p t+ +f  f dls      g+ +vk hgkkv  a+++ +ah+d++   ++ ls+lh  kl+vdp nfkll + l+  la h+  eftp v+a+  k +a v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************97..5799*******************99977773333358899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.3   0.6   3.5e-10   3.5e-10       3     140 ..       4     147 ..       2     148 .. 0.82

  Alignments for each domain:
  == domain 1  score: 27.3 bits;  conditional E-value: 3.5e-10
            HBA_PONPY   3 spadktnvktawgkvgahagdygaealermflsfpttktyfphfdls......hgsaqvkdhgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
                          s  +   v   w+kv a  + +g + l r+f s p t   f +f          +s  +k hg  v  al   +         l  l+  ha k ++    ++++s++++  l ++ p +f    + +++k l      + +ky
  sp|P02185|MYG_PHYCD   4 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          55556667789**************************988877753301111145667899******9998888888888889*********999997777799******************9999999999988777777777 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.97
//
Query:       HBA2_GALCR  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.4e-32   99.7   0.2    1.7e-32   99.4   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    9.9e-11   28.9   0.7    1.2e-10   28.7   0.7    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   99.4   0.2   1.7e-32   1.7e-32       2     140 ..       4     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 99.4 bits;  conditional E-value: 1.7e-32
           HBA2_GALCR   2 lsptdksnvkaawekvgahagdygaealermflsfpttktyfphf.dls.....hgstqvkghgkkvadaltnavlhvddmpsalsalsdlhahklrvdpvnfkllrhcllvtlachhpaeftpavhasldkfmasvstvltsky 140
                          l+p +ks v a w kv+    + g eal r+++ +p t+ +f  f dls      g+ +vk+hgkkv  a+++ + h+d++   ++ ls+lh  kl+vdp nfkll + l+  la h   eftp v+a+  k +a v+  l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          789************97..5799*******************9997676333336999************************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.7   0.7   1.2e-10   1.2e-10       8     140 ..       9     147 ..       2     148 .. 0.80

  Alignments for each domain:
  == domain 1  score: 28.7 bits;  conditional E-value: 1.2e-10
           HBA2_GALCR   8 snvkaawekvgahagdygaealermflsfpttktyfphfd...l...shgstqvkghgkkvadaltnavlhvddmpsalsalsdlhahklrvdpvnfkllrhcllvtlachhpaeftpavhasldkfmasvstvltsky 140
                            v   w kv a  + +g + l r+f s p t   f +f          +s  +k hg  v  al   +       + l  l+  ha k ++    ++++ ++++  l  +hp +f    + +++k +      + +ky
  sp|P02185|MYG_PHYCD   9 QLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKhlkTeaeMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          556779*************************9988777642112111346788999*******997655566777889*********9999976677899****************99999999998877766666666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.01
//
Query:       HBA_MESAU  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.9e-35  107.0   0.4    8.1e-35  106.7   0.4    1.1  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.2e-10   28.4   0.6    1.4e-10   28.2   0.6    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.7   0.4   8.1e-35   8.1e-35       3     140 ..       5     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 106.7 bits;  conditional E-value: 8.1e-35
            HBA_MESAU   3 sakdktniseawgkigghageygaealermffvypttktyfphf......dvshgsaqvkghgkkvadaltnavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpadftpavhasldkffasvstvltsky 140
                          + ++k+ ++  wgk++    e g eal r++ vyp t+ +f  f      d   g+ +vk+hgkkv  a+++ ++hld+l g ++ ls+lh  kl+vdp nfkll + l+  la+h   +ftp v+a+  k  a v+  l  ky
  sp|P02024|HBB_GORGO   5 TPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgdlstpDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          6789999*******95..78*********************9997444444557999************************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.2   0.6   1.4e-10   1.4e-10       9     140 ..      10     147 ..       2     148 .. 0.78

  Alignments for each domain:
  == domain 1  score: 28.2 bits;  conditional E-value: 1.4e-10
            HBA_MESAU   9 niseawgkigghageygaealermffvypttktyfphfdvs......hgsaqvkghgkkvadaltnavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpadftpavhasldkffasvstvltsky 140
                           +   w+k+ +  + +g + l r+f  +p t   f +f          +s  +k hg  v  al   +       + l  l+  ha k ++    ++++s++++  l ++hp df    + +++k +      + +ky
  sp|P02185|MYG_PHYCD  10 LVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          56789*************************998877775430001114566778899999988877777777778899********999997777799*****************99999999887766666666665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.00
//
Query:       HBA2_BOSMU  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.5e-33  100.8   0.3    7.6e-33  100.6   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.1e-11   31.2   1.0    2.6e-11   30.9   1.0    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.6   0.3   7.6e-33   7.6e-33       4     140 ..       6     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 100.6 bits;  conditional E-value: 7.6e-33
           HBA2_BOSMU   4 aadkgnvkaawgkvgghaaeygaealermflsfpttktyfphf.dls.....hgsaqvkghgakvaaaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpavhasldkflanvstvltsky 140
                            +k+ v a wgkv+    e g eal r+++ +p t+ +f  f dls      g+ +vk+hg kv  a++  ++hld+l g ++ ls+lh  kl+vdp nfkll + l+  la h+  +ftp v+a+  k +a v+  l  ky
  sp|P02024|HBB_GORGO   6 PEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          678999********6..789********************99977773333358899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.9   1.0   2.6e-11   2.6e-11       8     140 ..       9     147 ..       2     148 .. 0.79

  Alignments for each domain:
  == domain 1  score: 30.9 bits;  conditional E-value: 2.6e-11
           HBA2_BOSMU   8 gnvkaawgkvgghaaeygaealermflsfpttktyfphfdls......hgsaqvkghgakvaaaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpavhasldkflanvstvltsky 140
                            v   w+kv +  a +g + l r+f s p t   f +f          +s  +k hg  v  al   +       + l  l+  ha k ++    ++++s++++  l s+ p df    + +++k l      + +ky
  sp|P02185|MYG_PHYCD   9 QLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          556779**************************988877754301111145667899***9998877666666666789999******999997667799******************9999999999887777777766 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.02
//
Query:       HBA_ERIEU  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.1e-31   97.0   0.4    1.3e-31   96.8   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.4e-12   33.2   0.3    6.4e-12   32.9   0.3    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.8   0.4   1.3e-31   1.3e-31       4     140 ..       6     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 96.8 bits;  conditional E-value: 1.3e-31
            HBA_ERIEU   4 atdkanvktfwgklgghggeyggealdrmfqahpttktyfphf.dln.p....gsaqvkghgkkvadalttavnnlddvpgalsalsdlhahklrvdpvnfkllshcllvtlalhhpadftpavhasldkflatvatvltsky 140
                            +k+ v  +wgk++    e ggeal r++  +p t+ +f  f dl+ p    g+ +vk+hgkkv  a++  + +ld++ g ++ ls+lh  kl+vdp nfkll + l+  la h   +ftp v+a+  k +a va  l  ky
  sp|P02024|HBB_GORGO   6 PEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStPdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          56899999*****96..57*********************99976653233448899***********************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.9   0.3   6.4e-12   6.4e-12      10     140 ..      11     147 ..       2     148 .. 0.83

  Alignments for each domain:
  == domain 1  score: 32.9 bits;  conditional E-value: 6.4e-12
            HBA_ERIEU  10 vktfwgklgghggeyggealdrmfqahpttktyfphfdln......pgsaqvkghgkkvadalttavnnlddvpgalsalsdlhahklrvdpvnfkllshcllvtlalhhpadftpavhasldkflatvatvltsky 140
                          v   w+k+ +  + +g + l r+f++hp t   f +f          +s  +k hg  v  al   +       + l  l+  ha k ++    ++++s++++  l  +hp df    + +++k l      + +ky
  sp|P02185|MYG_PHYCD  11 VLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          566899999999999**************9988877753301111235667899***********9***99**************999997777799*******************999999999998888888887 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.92
//
Query:       HBA_FRAPO  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      3e-32   98.8   0.2    3.5e-32   98.6   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    6.8e-09   23.2   0.6    8.3e-09   22.9   0.6    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.6   0.2   3.5e-32   3.5e-32       4     140 ..       6     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 98.6 bits;  conditional E-value: 3.5e-32
            HBA_FRAPO   4 aadknnvkgifgkisshaedygaealermfitypstktyfphf.dls.....hgsaqvkghgkkvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgnvltaky 140
                            +k+ v +++gk++   ++ g eal r+++ yp t+ +f  f dls      g+ +vk+hgkkv+ a+ +   h+d++ gt++ ls+lh  kl+vdp nfkllg  ++ v+a h    +tp v+a+  k ++ v+n l  ky
  sp|P02024|HBB_GORGO   6 PEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          66899999*****96..789********************99977773333358899**************************************************9999999999***********************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.9   0.6   8.3e-09   8.3e-09       2     141 .]       3     148 ..       2     148 .. 0.83

  Alignments for each domain:
  == domain 1  score: 22.9 bits;  conditional E-value: 8.3e-09
            HBA_FRAPO   2 lsaadknnvkgifgkisshaedygaealermfitypstktyfphfdls......hgsaqvkghgkkvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgnvltakyr 141
                          ls  +   v  +++k+ +    +g + l r+f ++p t   f +f          +s  +k hg  v+ al           + l  l+  ha k ++    +++++++++ v+  +hp  +  + + +++k l      + aky+
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          56666667788999************************998887754301111145667889***99999887777777788999********999997667799***************************99999888889885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.60
//
Query:       HBA_PHACO  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    8.6e-31   94.0   0.2    9.8e-31   93.8   0.2    1.1  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    9.6e-09   22.6   0.6    1.1e-08   22.4   0.6    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   93.8   0.2   9.8e-31   9.8e-31       6     140 ..       8     146 ..       3     147 .] 0.90

  Alignments for each domain:
  == domain 1  score: 93.8 bits;  conditional E-value: 9.8e-31
            HBA_PHACO   6 dknnvkgiftkiaghaeeygaealermfitypstktyfphf.dls.....hgsaqikghgkkvvaalieavnhidditgtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgtvltaky 140
                          +k+ v +++ k+  + +e g eal r+++ yp t+ +f  f dls      g+ ++k+hgkkv+ a+ + + h+d++ gt++ ls+lh  kl+vdp nfkllg  ++ v+a h    +tp v+a+  k ++ v+  l  ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          666677777776..689*********************99977773333358899**************************************************9999999999**********************9999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.4   0.6   1.1e-08   1.1e-08       3     141 .]       4     148 ..       2     148 .. 0.83

  Alignments for each domain:
  == domain 1  score: 22.4 bits;  conditional E-value: 1.1e-08
            HBA_PHACO   3 saadknnvkgiftkiaghaeeygaealermfitypstktyfphfdls......hgsaqikghgkkvvaalieavnhidditgtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgtvltakyr 141
                          s  +   v  ++ k+ +    +g + l r+f ++p t   f +f          +s  +k hg  v+ al   +       + l  l+  ha k ++    +++++++++ v+  +hp  +  + + +++k l      + aky+
  sp|P02185|MYG_PHYCD   4 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          5566666778899999999999***************998877753301111245677899******999999999999999**********999997677799***************************99888888888885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.51
//
Query:       HBA_TRIOC  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    4.4e-31   95.0   0.2    5.2e-31   94.7   0.2    1.1  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    4.8e-09   23.6   0.4      6e-09   23.3   0.4    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.7   0.2   5.2e-31   5.2e-31       6     140 ..       8     146 ..       3     147 .] 0.89

  Alignments for each domain:
  == domain 1  score: 94.7 bits;  conditional E-value: 5.2e-31
            HBA_TRIOC   6 dktnvktvftkitghaedygaetlermfitypptktyfphf......dlhhgsaqikahgkkvvgalieavnhiddiagalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpsvltpevhasldkflcavgnvlsaky 140
                          +k+ v  ++ k+  + ++ g e l r+++ yp t+ +f  f      d   g+ ++kahgkkv+ga+ + + h+d++ g ++ ls+lh  kl+vdp nfkllg  ++ v+a h    +tp v+a+  k ++ v+n l+ ky
  sp|P02024|HBB_GORGO   8 EKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFgdlstpDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          566666666666..5789********************9997333334457999***************************************************9999999999***********************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.3   0.4     6e-09     6e-09       4     141 .]       5     148 ..       2     148 .. 0.81

  Alignments for each domain:
  == domain 1  score: 23.3 bits;  conditional E-value: 6e-09
            HBA_TRIOC   4 andktnvktvftkitghaedygaetlermfitypptktyfphfdlh......hgsaqikahgkkvvgalieavnhiddiagalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpsvltpevhasldkflcavgnvlsakyr 141
                            +   v  v+ k+ +    +g + l r+f ++p t   f +f          +s  +k hg  v+ al   +       + l  l+  ha k ++    +++++++++ v+  +hp  +  + + +++k l      ++aky+
  sp|P02185|MYG_PHYCD   5 EGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          5555667789999999999*****************99888775431111123566788899999877766666666677899************97777899***************************99999999999985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.58
//
Query:       HBA_ANSSE  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.5e-29   90.0   0.2    1.7e-29   89.8   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.2e-10   28.0   0.6    2.7e-10   27.7   0.6    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.8   0.2   1.7e-29   1.7e-29       4     140 ..       6     146 ..       3     147 .] 0.91

  Alignments for each domain:
  == domain 1  score: 89.8 bits;  conditional E-value: 1.7e-29
            HBA_ANSSE   4 aadkgnvktvfgkigghaeeygaetlqrmfqtfpqtktyfphf.dlq.p....gsaqikahgkkvaaalveaanhiddiagalsklsdlhaqklrvdpvnfkflghcflvvlaihhpslltpevhasmdkflcavatvltaky 140
                            +k+ v  ++gk+  + +e g e l r++  +p t+ +f  f dl  p    g+ ++kahgkkv  a+ +   h+d++ g ++ ls+lh  kl+vdp nfk+lg+ ++ vla h    +tp v+a+  k ++ va  l  ky
  sp|P02024|HBB_GORGO   6 PEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFgDLStPdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          56788899999**9..589*********************99975542233338999**********************************************************************************9999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.7   0.6   2.7e-10   2.7e-10       9     141 .]      10     148 ..       2     148 .. 0.82

  Alignments for each domain:
  == domain 1  score: 27.7 bits;  conditional E-value: 2.7e-10
            HBA_ANSSE   9 nvktvfgkigghaeeygaetlqrmfqtfpqtktyfphfdl...q...pgsaqikahgkkvaaalveaanhiddiagalsklsdlhaqklrvdpvnfkflghcflvvlaihhpslltpevhasmdkflcavatvltakyr 141
                           v  v++k+ +    +g + l r+f++ p+t   f +f     +    +s  +k hg  v  al           + l  l+  ha k ++    ++f++++++ vl  +hp  +  + + +m+k l      + aky+
  sp|P02185|MYG_PHYCD  10 LVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHlktEaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          566789999999999****************9888777531112111456678889999999988888888888899*************9777789*****************************9999999999985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.51
//
Query:       HBA_COLLI  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.7e-32   98.9   0.2    3.2e-32   98.7   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.1e-07   17.1   0.5    6.2e-07   16.8   0.5    1.2  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.7   0.2   3.2e-32   3.2e-32       3     140 ..       5     146 ..       3     147 .] 0.92

  Alignments for each domain:
  == domain 1  score: 98.7 bits;  conditional E-value: 3.2e-32
            HBA_COLLI   3 sandksnvkavfakiggqagdlggealerlfitypqtktyfphf.dls.....hgsaqikghgkkvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpevhasldkfvlavgtvltaky 140
                          +  +ks v a++ k++    ++ggeal rl++ yp t+ +f  f dls      g+ ++k+hgkkv  a+ +   h+d++ g ++ ls+lh  kl+vdp nfkllg+ ++ v+a hf   +tp v+a+  k v  v+  l  ky
  sp|P02024|HBB_GORGO   5 TPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          56799999*****996..679********************99977773333358899**********************************************************************************9999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   16.8   0.5   6.2e-07   6.2e-07       2     140 ..       3     147 ..       2     148 .. 0.77

  Alignments for each domain:
  == domain 1  score: 16.8 bits;  conditional E-value: 6.2e-07
            HBA_COLLI   2 lsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdls......hgsaqikghgkkvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpevhasldkfvlavgtvltaky 140
                          ls  +   v  v+ak+ +  +  g + l rlf ++p+t   f +f          +s  +k hg  v  al           + l  l+  ha k ++    +++++++++ v+  + p  +  + + +++k +      + aky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLkteaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          566666778889*****999999***************9988877543011111456678999*9999999888888888889999*********99966667889999888888888888888888888777666666666666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.44
//
Query:       HBAD_CHLME  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      6e-33  101.1   0.0    7.2e-33  100.8   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
      2e-11   31.4   0.4    2.6e-11   31.1   0.4    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  100.8   0.0   7.2e-33   7.2e-33       2     140 ..       4     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 100.8 bits;  conditional E-value: 7.2e-33
           HBAD_CHLME   2 ltaddkklltqlwekvaghqeefgsealqrmfltypqtktyfphf......dlhpgseqvrghgkkvaaalgnavksldnlsqalselsnlhaynlrvdpanfkllaqcfqvvlathlgkdyspemhaafdkflsavaavlaeky 140
                          lt ++k  +t lw kv  + +e g eal r+++ yp t+ +f  f      d   g+ +v++hgkkv  a+++ +  ldnl   ++ ls lh   l+vdp nfkll   +  vla h+gk+++p ++aa+ k ++ va  la ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFgdlstpDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          7999***********9..5799********************9997333333346999**************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.1   0.4   2.6e-11   2.6e-11       5     141 .]       6     148 ..       2     148 .. 0.85

  Alignments for each domain:
  == domain 1  score: 31.1 bits;  conditional E-value: 2.6e-11
           HBAD_CHLME   5 ddkklltqlwekvaghqeefgsealqrmfltypqtktyfphfd...lh...pgseqvrghgkkvaaalgnavksldnlsqalselsnlhaynlrvdpanfkllaqcfqvvlathlgkdyspemhaafdkflsavaavlaekyr 141
                           + +l+  +w kv +     g + l r+f ++p+t   f +f     +    +se ++ hg  v  alg  +k   +    l  l+  ha   ++    ++++++++  vl ++   d+  + + a++k l      +a ky+
  sp|P02185|MYG_PHYCD   6 GEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKhlkTEaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          56678999***************************988776642113222257999**************************************99999999*9998877776666699**********99999998888885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.83
//
Query:       HBAD_PASMO  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    3.4e-32   98.5   0.0    4.1e-32   98.3   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    4.5e-12   33.4   0.1    5.1e-12   33.2   0.1    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.3   0.0   4.1e-32   4.1e-32       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 98.3 bits;  conditional E-value: 4.1e-32
           HBAD_PASMO   2 ltaedkkliqqiwgklggaeeeigadalwrmfhsypstktyfphf.dls.....qgsdqirghgkkvvaalsnaiknldnlsqalselsnlhaynlrvdpvnfkflsqclqvslatrlgkeyspevhsavdkfmsavasvlaeky 140
                          lt e+k  +  +wgk++   +e+g +al r++  yp t+ +f  f dls      g+ ++++hgkkv+ a+s+ + +ldnl   ++ ls lh   l+vdp nfk+l   l   la ++gke++p v++a  k ++ va+ la ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgDLStpdavMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          899************97..579********************9997666333336999**************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.2   0.1   5.1e-12   5.1e-12       6     141 .]       7     148 ..       1     148 [. 0.87

  Alignments for each domain:
  == domain 1  score: 33.2 bits;  conditional E-value: 5.1e-12
           HBAD_PASMO   6 dkkliqqiwgklggaeeeigadalwrmfhsypstktyfphfd...l...sqgsdqirghgkkvvaalsnaiknldnlsqalselsnlhaynlrvdpvnfkflsqclqvslatrlgkeyspevhsavdkfmsavasvlaekyr 141
                          + +l+  +w+k+ +     g d l r+f s+p t   f +f         ++s+ ++ hg  v+ al   +k   +    l  l+  ha   ++    ++f+s+++   l +r   ++  + + a++k +      +a ky+
  sp|P02185|MYG_PHYCD   7 EWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKhlkTeaeMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          568999******999999****************988776642112222368999************************************999777789******999********************9999999999985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.91
//
Query:       HBAZ_HORSE  [L=141]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    3.3e-31   95.4   0.0    3.9e-31   95.2   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.5e-18   54.5   0.2    1.8e-18   54.3   0.2    1.1  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   95.2   0.0   3.9e-31   3.9e-31       2     140 ..       4     146 ..       3     147 .] 0.94

  Alignments for each domain:
  == domain 1  score: 95.2 bits;  conditional E-value: 3.9e-31
           HBAZ_HORSE   2 ltkaertmvvsiwgkismqadavgtealqrlfssypqtktyfphf......dlhegspqlrahgskvaaavgdavksidnvagalaklselhayilrvdpvnfkflshcllvtlasrlpadftadahaawdkflsivssvlteky 140
                          lt  e++ v ++wgk++   d vg eal rl+  yp t+ +f  f      d   g+p+++ahg kv  a +d +  +dn+ g +a lselh   l+vdp nfk+l + l+  la ++  +ft   +aa+ k ++ v++ l  ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKVN--VDEVGGEALGRLLVVYPWTQRFFESFgdlstpDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          7899***********97..599********************99973333344579**************************************************************************************999 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.3   0.2   1.8e-18   1.8e-18       2     141 .]       3     148 ..       2     148 .. 0.88

  Alignments for each domain:
  == domain 1  score: 54.3 bits;  conditional E-value: 1.8e-18
           HBAZ_HORSE   2 ltkaertmvvsiwgkismqadavgtealqrlfssypqtktyfphfd...lh...egspqlrahgskvaaavgdavksidnvagalaklselhayilrvdpvnfkflshcllvtlasrlpadftadahaawdkflsivssvltekyr 141
                          l++ e  +v+ +w+k+       g + l rlf s+p+t   f +f     +   ++s  l+ hg  v  a+g  +k   +  + l  l++ ha   ++    ++f+s++++  l sr p df ada+ a +k l +    +  ky+
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKhlkTEaemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          56788899********9999999***************9888776421122222578999*********************************99999777789*******************************99988888885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (141 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.95
//
Query:       HBA4_SALIR  [L=142]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.7e-34  105.3   0.0      3e-34  105.1   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    8.3e-11   29.2   0.2    9.8e-11   29.0   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.1   0.0     3e-34     3e-34       2     141 ..       4     146 ..       3     147 .] 0.93

  Alignments for each domain:
  == domain 1  score: 105.1 bits;  conditional E-value: 3e-34
           HBA4_SALIR   2 lsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasva.p....gsapvkkhgitimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftpeihlsvdkflqqlalalaeky 141
                          l+ ++k+ v a+wgk+    de+g +al r+lvvyp t+ +f  +  ++ p    g+  vk hg  ++  + d ++h+d+l g +  lselh  kl+vdp nfk+l + l+ v+a +f  eftp ++ +  k +  +a ala ky
  sp|P02024|HBB_GORGO   4 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLStPdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          567899*********9..57**********************99987642233337889*************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.0   0.2   9.8e-11   9.8e-11      10     142 .]      11     148 ..       3     148 .. 0.86

  Alignments for each domain:
  == domain 1  score: 29.0 bits;  conditional E-value: 9.8e-11
           HBA4_SALIR  10 vkaiwgkilpksdeigeqalsrmlvvypqtkay...fshwasva..pgsapvkkhgitimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftpeihlsvdkflqqlalalaekyr 142
                          v  +w+k+       g+  l r++  +p+t      f h  + a   +s  +kkhg+t++  +   +       + l  l++ hatk ++    ++++++ +i v+ +  p +f  + + +++k l+ +   +a ky+
  sp|P02185|MYG_PHYCD  11 VLHVWAKVEADVAGHGQDILIRLFKSHPETLEKfdrFKHLKTEAemKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
                          55689999988888999*************876122456666552246789***********99999888888899**************99999*******************************999999999986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (142 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.98
//
Query:       HBB_ORNAN  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.6e-78  248.9   0.3    1.8e-78  248.8   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.8e-14   39.5   0.1    6.3e-14   39.4   0.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  248.8   0.3   1.8e-78   1.8e-78       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 248.8 bits;  conditional E-value: 1.8e-78
            HBB_ORNAN   1 vhlsggeksavtnlwgkvninelggealgrllvvypwtqrffeafgdlssagavmgnpkvkahgakvltsfgdalknlddlkgtfaklselhcdklhvdpenfnrlgnvlivvlarhfskdfspevqaawqklvsgvahalghkyh 146
                          vhl+  eksavt lwgkvn++e+ggealgrllvvypwtqrffe+fgdls+  avmgnpkvkahg kvl +f+d l +ld+lkgtfa lselhcdklhvdpenf  lgnvl+ vla+hf k+f+p vqaa+qk+v+gva+al+hkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          79***********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   39.4   0.1   6.3e-14   6.3e-14       3     135 ..       3     137 ..       1     148 [. 0.89

  Alignments for each domain:
  == domain 1  score: 39.4 bits;  conditional E-value: 6.3e-14
            HBB_ORNAN   3 lsggeksavtnlwgkvninelg..gealgrllvvypwtqrffeafgdlssagavmgnpkvkahgakvltsfgdalknlddlkgtfaklselhcdklhvdpenfnrlgnvlivvlarhfskdfspevqaawqklvs 135
                          ls ge   v ++w+kv  +  g   + l rl+  +p t + f+ f  l + + + ++  +k hg  vlt++g  lk     ++ +  l++ h+ k  +  + +  ++  +i vl  +   df  + q a  k + 
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALE 137
                          7899************8776643167899******************************************************************8888888899999999999888899*********999776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.92
//
Query:       HBB_TACAC  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.2e-79  251.4   0.3    2.4e-79  251.3   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.3e-12   34.1   0.2    2.5e-12   34.0   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  251.3   0.3   2.4e-79   2.4e-79       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 251.3 bits;  conditional E-value: 2.4e-79
            HBB_TACAC   1 vhlsgsektavtnlwghvnvnelggealgrllvvypwtqrffesfgdlssadavmgnakvkahgakvltsfgdalknldnlkgtfaklselhcdklhvdpenfnrlgnvlvvvlarhfskeftpeaqaawqklvsgvshalahkyh 146
                          vhl+  ek+avt lwg vnv+e+ggealgrllvvypwtqrffesfgdls+ davmgn kvkahg kvl +f+d l +ldnlkgtfa lselhcdklhvdpenf  lgnvlv vla+hf keftp  qaa+qk+v+gv++alahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.0   0.2   2.5e-12   2.5e-12       3     145 ..       3     147 ..       1     148 [. 0.87

  Alignments for each domain:
  == domain 1  score: 34.0 bits;  conditional E-value: 2.5e-12
            HBB_TACAC   3 lsgsektavtnlwghvnvnelg..gealgrllvvypwtqrffesfgdlssadavmgnakvkahgakvltsfgdalknldnlkgtfaklselhcdklhvdpenfnrlgnvlvvvlarhfskeftpeaqaawqklvsgvshalahky 145
                          ls  e   v ++w+ v  +  g   + l rl+  +p t + f+ f  l +   + ++  +k hg  vlt++g  lk   + ++ +  l++ h+ k  +  + +  ++  ++ vl  +   +f  +aq a  k +      +a ky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          566677789999*9998766542168899*******************9999999999*************************************8888888899999999999877889**********999887777777666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 3.01
//
Query:       HBE_PONPY  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.9e-80  254.8   0.2    2.2e-80  254.6   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.8e-13   37.8   0.2    2.1e-13   37.6   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  254.6   0.2   2.2e-80   2.2e-80       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 254.6 bits;  conditional E-value: 2.2e-80
            HBE_PONPY   1 vhftaeekaavtslwskmnveeaggealgrllvvypwtqrffdsfgnlsspsailgnpkvkahgkkvltsfgdaiknmdnlkttfaklselhcdklhvdpenfkllgnvmviilathfgkeftpevqaawqklvsavaialahkyh 146
                          vh+t eek+avt+lw k+nv+e ggealgrllvvypwtqrff+sfg+ls+p a++gnpkvkahgkkvl +f+d + ++dnlk tfa lselhcdklhvdpenfkllgnv+v +la hfgkeftp vqaa+qk+v+ va alahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.6   0.2   2.1e-13   2.1e-13      10     145 ..      10     147 ..       3     148 .. 0.90

  Alignments for each domain:
  == domain 1  score: 37.6 bits;  conditional E-value: 2.1e-13
            HBE_PONPY  10 avtslwskmnveeag..gealgrllvvypwtqrffdsfgnlsspsailgnpkvkahgkkvltsfgdaiknmdnlkttfaklselhcdklhvdpenfkllgnvmviilathfgkeftpevqaawqklvsavaialahky 145
                           v  +w+k+  + ag   + l rl+  +p t + fd f +l + + + ++  +k hg  vlt++g  +k   + +  +  l++ h+ k  +  + +++++  ++ +l ++   +f  + q a  k +      +a ky
  sp|P02185|MYG_PHYCD  10 LVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          57789***99998864157899******************************************************************99999999********9999988899**********99888777777766 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 3.03
//
Query:       HBB_SPECI  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    1.1e-81  258.7   0.4    1.3e-81  258.5   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    4.9e-13   36.3   0.8    5.4e-13   36.1   0.8    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  258.5   0.4   1.3e-81   1.3e-81       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 258.5 bits;  conditional E-value: 1.3e-81
            HBB_SPECI   1 vhlsdgeknaistawgkvhaaevgaealgrllvvypwtqrffdsfgdlssasavmgnakvkahgkkvidsfsnglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgkdftpeaqaafqkvvagvanalahkyh 146
                          vhl+  ek+a++  wgkv+  evg ealgrllvvypwtqrff+sfgdls+  avmgn kvkahgkkv+ +fs+gl hldnlkgtfa+lselhcdklhvdpenfkllgn++v v+ahh+gk+ftp  qaa+qkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.1   0.8   5.4e-13   5.4e-13       3     145 ..       3     147 ..       1     148 [. 0.90

  Alignments for each domain:
  == domain 1  score: 36.1 bits;  conditional E-value: 5.4e-13
            HBB_SPECI   3 lsdgeknaistawgkvha..aevgaealgrllvvypwtqrffdsfgdlssasavmgnakvkahgkkvidsfsnglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgkdftpeaqaafqkvvagvanalahky 145
                          ls+ge   +   w+kv+a  a  g + l rl+  +p t + fd f  l + + + ++  +k hg  v+ ++   lk   + ++ +  l++ h+ k  +  + +++++  i+ v+  +   df  +aq a+ k +      +a ky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEAdvAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          89**************98334557899********************************************************************9999999999*99999887655566************9987777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.97
//
Query:       HBB_SPETO  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.1e-82  261.0   0.3    2.3e-82  260.9   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.7e-12   34.5   0.4    1.8e-12   34.4   0.4    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  260.9   0.3   2.3e-82   2.3e-82       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 260.9 bits;  conditional E-value: 2.3e-82
            HBB_SPETO   1 vhltdgeknaistawgkvnaaeigaealgrllvvypwtqrffdsfgdlssasavmgnakvkahgkkvidsfsnglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgkdftpeaqaafqkvvagvanalshkyh 146
                          vhlt  ek+a++  wgkvn  e+g ealgrllvvypwtqrff+sfgdls+  avmgn kvkahgkkv+ +fs+gl hldnlkgtfa+lselhcdklhvdpenfkllgn++v v+ahh+gk+ftp  qaa+qkvvagvanal+hkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.4   0.4   1.8e-12   1.8e-12       3     141 ..       3     143 ..       1     148 [. 0.88

  Alignments for each domain:
  == domain 1  score: 34.4 bits;  conditional E-value: 1.8e-12
            HBB_SPETO   3 ltdgeknaistawgkvna..aeigaealgrllvvypwtqrffdsfgdlssasavmgnakvkahgkkvidsfsnglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgkdftpeaqaafqkvvagvanal 141
                          l++ge   +   w+kv a  a  g + l rl+  +p t + fd f  l + + + ++  +k hg  v+ ++   lk   + ++ +  l++ h+ k  +  + +++++  i+ v+  +   df  +aq a+ k +      +
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEAdvAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
                          7899999********987335668999********************************************************************9999999999*99999887655566**********99876555555 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.97
//
Query:       HBB_EQUHE  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    9.8e-85  268.8   0.4    1.1e-84  268.7   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.7e-11   31.2   0.5    1.8e-11   31.1   0.5    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  268.7   0.4   1.1e-84   1.1e-84       1     146 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 268.7 bits;  conditional E-value: 1.1e-84
            HBB_EQUHE   1 vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpaavmgnpkvkahgkkvlhsfgegvhhldnlkgtfaqlselhcdklhvdpenfrllgnvlvvvlarhfgkdftpelqasyqkvvagvanalahkyh 146
                          v l+ eek+av alw kvn +evggealgrllvvypwtqrff+sfgdls p avmgnpkvkahgkkvl +f++g+ hldnlkgtfa lselhcdklhvdpenf+llgnvlv vla+hfgk+ftp +qa+yqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          57899********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.1   0.5   1.8e-11   1.8e-11       4     145 ..       4     147 ..       1     148 [. 0.86

  Alignments for each domain:
  == domain 1  score: 31.1 bits;  conditional E-value: 1.8e-11
            HBB_EQUHE   4 sgeekaavlalwdkvneeevg..gealgrllvvypwtqrffdsfgdlsnpaavmgnpkvkahgkkvlhsfgegvhhldnlkgtfaqlselhcdklhvdpenfrllgnvlvvvlarhfgkdftpelqasyqkvvagvanalahky 145
                          s  e   vl +w kv  +  g   + l rl+  +p t + fd f  l   a + ++  +k hg  vl ++g  +    + ++ +  l++ h+ k  +  + +++++  ++ vl  +   df  + q +  k +      +a ky
  sp|P02185|MYG_PHYCD   4 SEGEWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          555667899******8776643146799********************************************9999999999999*********9998899999*999998885545559******999998877777777766 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.98
//
Query:       HBB_SUNMU  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.6e-85  269.2   0.4    7.4e-85  269.0   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.5e-12   33.8   0.2    2.7e-12   33.7   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  269.0   0.4   7.4e-85   7.4e-85       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 269.0 bits;  conditional E-value: 7.4e-85
            HBB_SUNMU   1 vhlsgeekacvtglwgkvnedevgaealgrllvvypwtqrffdsfgdlssasavmgnpkvkahgkkvlhslgegvanldnlkgtfaklselhcdklhvdpenfrllgnvlvvvlaskfgkeftppvqaafqkvvagvanalahkyh 146
                          vhl+ eek++vt+lwgkvn devg ealgrllvvypwtqrff+sfgdls+  avmgnpkvkahgkkvl ++++g+a+ldnlkgtfa lselhcdklhvdpenf+llgnvlv vla  fgkeftppvqaa+qkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.7   0.2   2.7e-12   2.7e-12       6     145 ..       6     147 ..       1     148 [. 0.91

  Alignments for each domain:
  == domain 1  score: 33.7 bits;  conditional E-value: 2.7e-12
            HBB_SUNMU   6 eekacvtglwgkvnedevg..aealgrllvvypwtqrffdsfgdlssasavmgnpkvkahgkkvlhslgegvanldnlkgtfaklselhcdklhvdpenfrllgnvlvvvlaskfgkeftppvqaafqkvvagvanalahky 145
                           e   v  +w+kv  d  g   + l rl+  +p t + fd f  l + + + ++  +k hg  vl +lg  +    + ++ +  l++ h+ k  +  + +++++  ++ vl s+   +f    q a+ k +      +a ky
  sp|P02185|MYG_PHYCD   6 GEWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          455678899******987532789********************************************************************99999999****************************99887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.91
//
Query:       HBB_CALAR  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.6e-98  312.9   0.8    2.9e-98  312.7   0.8    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.2e-09   25.3   0.3    1.3e-09   25.1   0.3    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  312.7   0.8   2.9e-98   2.9e-98       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 312.7 bits;  conditional E-value: 2.9e-98
            HBB_CALAR   1 vhltgeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmnnpkvkahgkkvlgafsdglthldnlkgtfahlselhcdklhvdpenfrllgnvlvcvlahhfgkeftpvvqaayqkvvagvanalahkyh 146
                          vhlt eeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavm npkvkahgkkvlgafsdgl hldnlkgtfa lselhcdklhvdpenf+llgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.1   0.3   1.3e-09   1.3e-09       9     145 ..       9     147 ..       2     148 .. 0.88

  Alignments for each domain:
  == domain 1  score: 25.1 bits;  conditional E-value: 1.3e-09
            HBB_CALAR   9 savtalwgkvnvdevg..gealgrllvvypwtqrffesfgdlstpdavmnnpkvkahgkkvlgafsdglthldnlkgtfahlselhcdklhvdpenfrllgnvlvcvlahhfgkeftpvvqaayqkvvagvanalahky 145
                            v  +w+kv  d  g   + l rl+  +p t + f+ f  l t   +  +  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + +++++  ++ vl  +   +f    q a  k +      +a ky
  sp|P02185|MYG_PHYCD   9 QLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          567889*****998763157899*********************99999999*************************************999999999*********98877789999999999998877777777666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.78
//
Query:       HBB_MANSP  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.1e-99  314.8   0.6    6.8e-99  314.6   0.6    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.1e-10   28.5   0.2    1.2e-10   28.3   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  314.6   0.6   6.8e-99   6.8e-99       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 314.6 bits;  conditional E-value: 6.8e-99
            HBB_MANSP   1 vhltpeektavttlwgkvnvdevggealgrllvvypwtqrffdsfgdlsspdavmgnpkvkahgkkvlgafsdglnhldnlkgtfaqlselhcdklhvdpenfkllgnvlvcvlahhfgkeftpqvqaayqkvvagvanalahkyh 146
                          vhltpeek+avt lwgkvnvdevggealgrllvvypwtqrff+sfgdls+pdavmgnpkvkahgkkvlgafsdgl hldnlkgtfa lselhcdklhvdpenfkllgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.3   0.2   1.2e-10   1.2e-10       9     145 ..       9     147 ..       2     148 .. 0.89

  Alignments for each domain:
  == domain 1  score: 28.3 bits;  conditional E-value: 1.2e-10
            HBB_MANSP   9 tavttlwgkvnvdevg..gealgrllvvypwtqrffdsfgdlsspdavmgnpkvkahgkkvlgafsdglnhldnlkgtfaqlselhcdklhvdpenfkllgnvlvcvlahhfgkeftpqvqaayqkvvagvanalahky 145
                            v  +w+kv  d  g   + l rl+  +p t + fd f  l +   + ++  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + +++++  ++ vl  +   +f    q a  k +      +a ky
  sp|P02185|MYG_PHYCD   9 QLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          567789*****998763157899*********************99999****************************************99999999**********98888889********9999887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.75
//
Query:       HBB_URSMA  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      4e-93  296.0   0.4    4.5e-93  295.8   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.1e-11   31.9   0.2    1.3e-11   31.6   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  295.8   0.4   4.5e-93   4.5e-93       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 295.8 bits;  conditional E-value: 4.5e-93
            HBB_URSMA   1 vhltgeekslvtglwgkvnvdevggealgrllvvypwtqrffdsfgdlssadaimnnpkvkahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgkeftpqvqaayqkvvagvanalahkyh 146
                          vhlt eeks vt+lwgkvnvdevggealgrllvvypwtqrff+sfgdls+ da+m npkvkahgkkvl +fsdgl +ldnlkgtfa lselhcdklhvdpenfkllgnvlvcvlahhfgkeftp vqaayqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.6   0.2   1.3e-11   1.3e-11       7     145 ..       7     147 ..       2     148 .. 0.89

  Alignments for each domain:
  == domain 1  score: 31.6 bits;  conditional E-value: 1.3e-11
            HBB_URSMA   7 ekslvtglwgkvnvdevg..gealgrllvvypwtqrffdsfgdlssadaimnnpkvkahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgkeftpqvqaayqkvvagvanalahky 145
                          e  lv  +w+kv  d  g   + l rl+  +p t + fd f  l +   +  +  +k hg  vl ++   lk   + ++ +  l++ h+ k  +  + +++++  ++ vl  +   +f    q a  k +      +a ky
  sp|P02185|MYG_PHYCD   7 EWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          567999*******998763157899*******************99888889999************************************99999999**********98888889********9999887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.74
//
Query:       HBB_RABIT  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    4.6e-92  292.3   0.3    5.1e-92  292.2   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    5.9e-10   26.2   0.4    6.4e-10   26.1   0.4    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  292.2   0.3   5.1e-92   5.1e-92       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 292.2 bits;  conditional E-value: 5.1e-92
            HBB_RABIT   1 vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkvkahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgkeftpqvqaayqkvvagvanalahkyh 146
                          vhl+ eeksavtalwgkvnv+evggealgrllvvypwtqrffesfgdls+ +avm npkvkahgkkvl afs+gl+hldnlkgtfa lselhcdklhvdpenf+llgnvlv vl+hhfgkeftp vqaayqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.1   0.4   6.4e-10   6.4e-10       3     145 ..       3     147 ..       1     148 [. 0.87

  Alignments for each domain:
  == domain 1  score: 26.1 bits;  conditional E-value: 6.4e-10
            HBB_RABIT   3 lsseeksavtalwgkvnveevg..gealgrllvvypwtqrffesfgdlssanavmnnpkvkahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgkeftpqvqaayqkvvagvanalahky 145
                          ls  e   v  +w+kv  +  g   + l rl+  +p t + f+ f  l +   +  +  +k hg  vl a+   l    + ++ +  l++ h+ k  +  + +++++  ++ vl  +   +f    q a  k +      +a ky
  sp|P02185|MYG_PHYCD   3 LSEGEWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          566677889999****9876653157899*******************9998899999*************************************9999899999**99999997766779********9999887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.56
//
Query:       HBB_TUPGL  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    8.5e-84  265.6   0.2    9.5e-84  265.4   0.2    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    3.8e-11   30.0   0.1    4.5e-11   29.7   0.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  265.4   0.2   9.5e-84   9.5e-84       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 265.4 bits;  conditional E-value: 9.5e-84
            HBB_TUPGL   1 vhlsgeekaavtglwgkvdlekvggqslgsllivypwtqrffdsfgdlsspsavmsnpkvkahgkkvltsfsdglnhldnlkgtfaklselhcdklhvdpenfrllgnvlvrvlacnfgpeftpqvqaafqkvvagvanalahkyh 146
                          vhl+ eek+avt+lwgkv++++vgg++lg ll+vypwtqrff+sfgdls+p avm npkvkahgkkvl +fsdgl hldnlkgtfa lselhcdklhvdpenf+llgnvlv vla +fg eftp vqaa+qkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.7   0.1   4.5e-11   4.5e-11       7     145 ..       7     147 ..       2     148 .. 0.89

  Alignments for each domain:
  == domain 1  score: 29.7 bits;  conditional E-value: 4.5e-11
            HBB_TUPGL   7 ekaavtglwgkvdlekvg.gqs.lgsllivypwtqrffdsfgdlsspsavmsnpkvkahgkkvltsfsdglnhldnlkgtfaklselhcdklhvdpenfrllgnvlvrvlacnfgpeftpqvqaafqkvvagvanalahky 145
                          e   v  +w+kv+ +  g gq  l  l+  +p t + fd f  l + + + ++  +k hg  vlt++   l    + ++ +  l++ h+ k  +  + +++++  +++vl      +f    q a+ k +      +a ky
  sp|P02185|MYG_PHYCD   7 EWQLVLHVWAKVEADVAGhGQDiLIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          45567889****9998875666255677789************************************************************99999999****************************99887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.49
//
Query:       HBB_TRIIN  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    8.2e-84  265.9   0.4    9.1e-84  265.8   0.4    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.2e-13   38.3   0.6    1.3e-13   38.2   0.6    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  265.8   0.4   9.1e-84   9.1e-84       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 265.8 bits;  conditional E-value: 9.1e-84
            HBB_TRIIN   1 vhltpeekalviglwakvnvkeyggealgrllvvypwtqrffehfgdlssasaimnnpkvkahgekvftsfgdglkhledlkgafaelselhcdklhvdpenfrllgnvlvcvlarhfgkefspeaqaayqkvvagvanalahkyh 146
                          vhltpeek+ v +lw kvnv e ggealgrllvvypwtqrffe fgdls+  a+m npkvkahg+kv+ +f+dgl hl++lkg fa lselhcdklhvdpenf+llgnvlvcvla+hfgkef+p  qaayqkvvagvanalahkyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          8************************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.2   0.6   1.3e-13   1.3e-13       6     145 ..       6     147 ..       1     148 [. 0.89

  Alignments for each domain:
  == domain 1  score: 38.2 bits;  conditional E-value: 1.3e-13
            HBB_TRIIN   6 eekalviglwakv..nvkeyggealgrllvvypwtqrffehfgdlssasaimnnpkvkahgekvftsfgdglkhledlkgafaelselhcdklhvdpenfrllgnvlvcvlarhfgkefspeaqaayqkvvagvanalahky 145
                           e  lv+ +wakv  +v  +g + l rl+  +p t + f++f  l + + +  +  +k hg  v+t++g  lk     ++ +  l++ h+ k  +  + +++++  ++ vl  +   +f  +aq a  k +      +a ky
  sp|P02185|MYG_PHYCD   6 GEWQLVLHVWAKVeaDVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          57789*******93347789999*************************9999**********************99999*************999999999*******9996555559**********99887777777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.55
//
Query:       HBB_COLLI  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      6e-72  227.2   0.1    6.7e-72  227.1   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.2e-16   47.0   0.1    2.5e-16   46.8   0.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.1   0.1   6.7e-72   6.7e-72       1     146 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 227.1 bits;  conditional E-value: 6.7e-72
            HBB_COLLI   1 vhwsaeekqlitsiwgkvnvadcgaealarllivypwtqrffssfgnlssataisgnpnvkahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgkdftpecqaawqklvrvvahalarkyh 146
                          vh + eek  +t++wgkvnv + g eal rll+vypwtqrff sfg+ls+  a+ gnp vkahgkkvl +f+d + +ldn+kgtfa lselhcdklhvdpenf+llg++lv +la hfgk+ftp  qaa+qk+v  va+ala+kyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7999*********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   46.8   0.1   2.5e-16   2.5e-16       6     145 ..       6     147 ..       2     148 .. 0.94

  Alignments for each domain:
  == domain 1  score: 46.8 bits;  conditional E-value: 2.5e-16
            HBB_COLLI   6 eekqlitsiwgkv..nvadcgaealarllivypwtqrffssfgnlssataisgnpnvkahgkkvltsfgdavknldnikgtfaqlselhcdklhvdpenfrllgdilviilaahfgkdftpecqaawqklvrvvahalarky 145
                           e ql+  +w+kv  +va  g + l rl+  +p t + f  f +l +   + ++ ++k hg  vlt++g  +k   + ++ +  l++ h+ k  +  + ++++++ ++ +l ++   df  ++q a  k +++    +a ky
  sp|P02185|MYG_PHYCD   6 GEWQLVLHVWAKVeaDVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          5789********844589999***********************************************************************999999999*******999999999***************9999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.43
//
Query:       HBB_LARRI  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
      6e-70  220.8   0.1    6.7e-70  220.6   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    1.3e-15   44.6   0.1    1.5e-15   44.3   0.1    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  220.6   0.1   6.7e-70   6.7e-70       1     146 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 220.6 bits;  conditional E-value: 6.7e-70
            HBB_LARRI   1 vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffasfgnlssptaingnpmvrahgkkvltsfgeavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfakdftpdsqaawqklvrvvahalarkyh 146
                          vh + eek  +t+lwgkvnv + g eal rll+vypwtqrff sfg+ls+p a+ gnp v+ahgkkvl +f++ + +ldn+k tfa lselhcdklhvdpenf+llg++l+ vla hf k+ftp  qaa+qk+v  va+ala+kyh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          7999*********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.3   0.1   1.5e-15   1.5e-15       6     145 ..       6     147 ..       2     148 .. 0.94

  Alignments for each domain:
  == domain 1  score: 44.3 bits;  conditional E-value: 1.5e-15
            HBB_LARRI   6 eekqlitglwgkv..nvadcgaealarllivypwtqrffasfgnlssptaingnpmvrahgkkvltsfgeavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfakdftpdsqaawqklvrvvahalarky 145
                           e ql+  +w+kv  +va  g + l rl+  +p t + f  f +l +   + ++  ++ hg  vlt++g  +k   + +  +  l++ h+ k  +  + ++++++ +i vl ++   df  d+q a  k +++    +a ky
  sp|P02185|MYG_PHYCD   6 GEWQLVLHVWAKVeaDVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          5789********844589999***********************************************************************99999999********************************9999999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.45
//
Query:       HBB1_VAREX  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    4.4e-67  211.9   0.3      5e-67  211.8   0.3    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
      2e-13   37.8   0.4    2.4e-13   37.6   0.4    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  211.8   0.3     5e-67     5e-67       1     146 []       2     147 .]       2     147 .] 1.00

  Alignments for each domain:
  == domain 1  score: 211.8 bits;  conditional E-value: 5e-67
           HBB1_VAREX   1 vhwtaeekqlicslwgkidvgliggetlagllviypwtqrqfshfgnlssptaiagnprvkahgkkvltsfgdaiknldnikdtfaklselhcdklhvdptnfkllgnvlvivladhhgkeftpahhaayqklvnvvshslarryh 146
                          vh t eek  + +lwgk++v  +gge l  llv+ypwtqr f  fg+ls+p a+ gnp+vkahgkkvl +f+d + +ldn+k tfa lselhcdklhvdp nfkllgnvlv vla h gkeftp  +aayqk+v  v+++la++yh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          79***********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.6   0.4   2.4e-13   2.4e-13       7     145 ..       7     147 ..       3     148 .. 0.90

  Alignments for each domain:
  == domain 1  score: 37.6 bits;  conditional E-value: 2.4e-13
           HBB1_VAREX   7 ekqlicslwgkidvglig..getlagllviypwtqrqfshfgnlssptaiagnprvkahgkkvltsfgdaiknldnikdtfaklselhcdklhvdptnfkllgnvlvivladhhgkeftpahhaayqklvnvvshslarry 145
                          e ql+  +w+k++  + g   + l  l+  +p t ++f +f +l +   + ++  +k hg  vlt++g  +k   + +  +  l++ h+ k  +    +++++  ++ vl  +h  +f    + a  k + +    +a +y
  sp|P02185|MYG_PHYCD   7 EWQLVLHVWAKVEADVAGhgQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKY 147
                          779********977766531678999****************************************************************98887777899*****************99999999999999988888887 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.70
//
Query:       HBB2_XENTR  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    9.7e-53  165.2   0.1    1.1e-52  165.0   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    8.5e-14   39.0   0.2    1.1e-13   38.7   0.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.0   0.1   1.1e-52   1.1e-52       1     145 [.       2     146 ..       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 165.0 bits;  conditional E-value: 1.1e-52
           HBB2_XENTR   1 vhwtaeekatiasvwgkvdieqdghdalsrllvvypwtqryfssfgnlsnvsavsgnvkvkahgnkvlsavgsaiqhlddvkshlkglskshaedlhvdpenfkrladvlvivlaaklgsaftpqvqavweklnatlvaalshgy 145
                          vh t eek+ + ++wgkv++++ g +al rllvvypwtqr+f sfg+ls   av gn kvkahg kvl a +  + hld++k  +  ls+ h + lhvdpenfk l +vlv vla  +g  ftp vqa ++k+ a +  al+h y
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          79*********************************************************************************************************************************************98 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.7   0.2   1.1e-13   1.1e-13      10     130 ..      10     132 ..       4     142 .. 0.86

  Alignments for each domain:
  == domain 1  score: 38.7 bits;  conditional E-value: 1.1e-13
           HBB2_XENTR  10 tiasvwgkvdieqdgh..dalsrllvvypwtqryfssfgnlsnvsavsgnvkvkahgnkvlsavgsaiqhlddvkshlkglskshaedlhvdpenfkrladvlvivlaaklgsaftpqvqavw 130
                           +  vw+kv+ +  gh  d l rl+  +p t + f  f +l   + + ++  +k hg  vl+a+g+ ++     +++lk l++sha    +  + ++ +++ ++ vl ++    f    q   
  sp|P02185|MYG_PHYCD  10 LVLHVWAKVEADVAGHgqDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAM 132
                          56789***976665554499******************************************************************9877777777888999999998887777777776655 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.72
//
Query:       HBBL_RANCA  [L=146]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    6.8e-57  178.6   0.1    7.5e-57  178.4   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
    2.1e-11   31.0   0.4    2.5e-11   30.8   0.4    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  178.4   0.1   7.5e-57   7.5e-57       1     146 []       2     147 .]       2     147 .] 0.99

  Alignments for each domain:
  == domain 1  score: 178.4 bits;  conditional E-value: 7.5e-57
           HBBL_RANCA   1 vhwtaeekavinsvwqkvdveqdghealtrlfivypwtqryfstfgdlsspaaiagnpkvhahgkkilgaidnaihnlddvkgtlhdlseehanelhvdpenfrrlgevlivvlgaklgkafspqvqhvwekfiavlvdalshsyh 146
                          vh t eek+ + ++w kv+v++ g eal rl++vypwtqr+f +fgdls+p a+ gnpkv ahgkk+lga+ + + +ld++kgt+  lse h ++lhvdpenf+ lg vl+ vl+  +gk f+p vq  ++k +a + +al+h yh
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
                          79***********************************************************************************************************************************************9 PP

>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.8   0.4   2.5e-11   2.5e-11      10     134 ..      10     136 ..       3     147 .. 0.87

  Alignments for each domain:
  == domain 1  score: 30.8 bits;  conditional E-value: 2.5e-11
           HBBL_RANCA  10 vinsvwqkvdveqdgh..ealtrlfivypwtqryfstfgdlsspaaiagnpkvhahgkkilgaidnaihnlddvkgtlhdlseehanelhvdpenfrrlgevlivvlgaklgkafspqvqhvwekfi 134
                          ++  vw kv+ +  gh  + l rlf  +p t + f  f  l + a + ++  +  hg  +l a+   +      ++ l  l++ ha +  +  + ++ ++e +i vl ++    f    q    k +
  sp|P02185|MYG_PHYCD  10 LVLHVWAKVEADVAGHgqDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKAL 136
                          56679***977766653389*********************************************999*******************988887888899*******999988888888887776665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (146 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 2.69
//
Query:       HBB2_TRICR  [L=145]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
    2.7e-46  144.3   0.0      3e-46  144.1   0.0    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2


Domain annotation for each sequence (and alignments):
>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.1   0.0   1.5e-46     3e-46       1     145 []       2     146 ..       2     146 .. 0.98

  Alignments for each domain:
  == domain 1  score: 144.1 bits;  conditional E-value: 1.5e-46
           HBB2_TRICR   1 vhltaedrkeiaailgkvnvdslggqclarlivvnpwsrryfhdfgdlsscdaicrnpkvlahgakvmrsiveatkhldnlreyyadlsvthslkfyvdpenfklfsgivivclaltlqtdfschkqlafeklmkgvshalghgy 145
                          vhlt e++  + a+ gkvnvd +gg++l rl+vv pw++r+f+ fgdls+ da+  npkv ahg kv+ ++ +   hldnl+  +a ls  h  k++vdpenfkl+ ++++  la  +  +f+   q a++k++ gv++al+h y
  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146
                          8*********************************************************************************************************9998888999***************************87 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (145 nodes)
Target sequences:                          2  (301 residues searched)
Passed MSV filter:                         2  (1); expected 0.0 (0.02)
Passed bias filter:                        2  (1); expected 0.0 (0.02)
Passed Vit filter:                         2  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (0.5); expected 0.0 (1e-05)
Initial search space (Z):                  2  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 2.57
//
[ok]