diff test-data/uniprot_globins_match.out @ 0:48a88b7a4734 draft

planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
author iuc
date Sat, 25 Jun 2016 15:07:48 -0400
parents
children 74fc6d7d40f1
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/uniprot_globins_match.out	Sat Jun 25 15:07:48 2016 -0400
@@ -0,0 +1,67 @@
+# hmmsearch :: search profile(s) against a sequence database
+# HMMER 3.1b2 (February 2015); http://hmmer.org/
+# Copyright (C) 2015 Howard Hughes Medical Institute.
+# Freely distributed under the GNU General Public License (GPLv3).
+# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
+# query HMM file:                  /tmp/tmpJW6ntL/files/000/dataset_1.dat
+# target sequence database:        /tmp/tmpJW6ntL/files/000/dataset_2.dat
+# per-seq hits tabular output:     /tmp/tmpJW6ntL/files/000/dataset_4.dat
+# per-dom hits tabular output:     /tmp/tmpJW6ntL/files/000/dataset_5.dat
+# pfam-style tabular hit output:   /tmp/tmpJW6ntL/files/000/dataset_6.dat
+# max ASCII text line length:      unlimited
+# Vit filter P threshold:       <= 0.001
+# Fwd filter P threshold:       <= 1e-05
+# random number seed set to:       4
+# number of worker threads:        1
+# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
+
+Query:       globins4  [M=149]
+Scores for complete sequences (score includes all domains):
+   --- full sequence ---   --- best 1 domain ---    -#dom-
+    E-value  score  bias    E-value  score  bias    exp  N  Sequence            Description
+    ------- ------ -----    ------- ------ -----   ---- --  --------            -----------
+    1.8e-70  222.7   3.2      2e-70  222.6   3.2    1.0  1  sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
+    9.2e-69  217.2   0.1      1e-68  217.0   0.1    1.0  1  sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
+
+
+Domain annotation for each sequence (and alignments):
+>> sp|P02185|MYG_PHYCD  Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
+   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
+ ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
+   1 !  222.6   3.2     2e-70     2e-70       2     149 .]       2     148 ..       1     148 [. 0.99
+
+  Alignments for each domain:
+  == domain 1  score: 222.6 bits;  conditional E-value: 2e-70
+             globins4   2 vLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
+                          vLse+e++ v++vWakveadv+++G+diL+rlfks+P+t+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++ea+lk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk
+  sp|P02185|MYG_PHYCD   2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
+                          8*****************************************************************************.99******************************************************************7 PP
+
+>> sp|P02024|HBB_GORGO  Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
+   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
+ ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
+   1 !  217.0   0.1     1e-68     1e-68       1     149 []       2     147 .]       2     147 .] 0.99
+
+  Alignments for each domain:
+  == domain 1  score: 217.0 bits;  conditional E-value: 1e-68
+             globins4   1 vvLseaektkvkavWakveadveesGadiLvrlfkstPatqefFekFkdLstedelkksadvkkHgkkvldAlsdalakldekleaklkdLselHakklkvdpkyfkllsevlvdvlaarlpkeftadvqaaleKllalvakllaskYk 149
+                          v+L+++ek++v+a+W+kv  +v+e+G+++L rl++++P+tq+fFe+F+dLst+d+++++++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a va++la+kY+
+  sp|P02024|HBB_GORGO   2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
+                          69****************..*************************************************************.******************************************************************7 PP
+
+
+
+Internal pipeline statistics summary:
+-------------------------------------
+Query model(s):                              1  (149 nodes)
+Target sequences:                            2  (301 residues searched)
+Passed MSV filter:                         2  (1); expected 0.0 (0.02)
+Passed bias filter:                        2  (1); expected 0.0 (0.02)
+Passed Vit filter:                         2  (1); expected 0.0 (0.001)
+Passed Fwd filter:                         2  (1); expected 0.0 (1e-05)
+Initial search space (Z):                  2  [actual number of targets]
+Domain search space  (domZ):               2  [number of targets reported over threshold]
+# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
+# Mc/sec: inf
+//
+[ok]