Mercurial > repos > iuc > rrmscorer

changeset 0:02b0e0f78d8a draft default tip

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/main/tools/rrmscorer commit 1ed15985d486840a247b2803613c584c074e4744
author iuc
date Wed, 17 Sep 2025 14:53:30 +0000
parents
children
files RRMScorer.xml macros.xml test-data/input.fasta
diffstat 3 files changed, 533 insertions(+), 0 deletions(-) [+]
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/RRMScorer.xml	Wed Sep 17 14:53:30 2025 +0000
@@ -0,0 +1,515 @@
+<tool id="rrmscorer" name="RRM-Scorer" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="@PROFILE@">
+    <description>Predicts RNA Recognition Motif (RRM) scores</description>
+    <macros>
+        <import>macros.xml</import>
+    </macros>
+    <xrefs>
+        <xref type="bio.tools">RRMScorer</xref>
+    </xrefs>
+    <expand macro="requirements"/>
+    <command detect_errors="exit_code"><![CDATA[
+        mkdir -p json tabular aligned plots &&
+        rrmscorer
+            --json 'json'
+            --csv 'tabular'
+            --window_size $tool_parameters.window_size
+        #if str($input_sequence.input_type_cond.input_type) == 'fasta'
+            --fasta '$input_sequence.input_type_cond.fasta_input'
+        #elif str($input_sequence.input_type_cond.input_type) == 'uniprot'
+            --uniprot '$input_sequence.input_type_cond.uniprot_id'
+        #end if
+
+        #if $output_options.generate_plots
+            --plot 'plots'
+        #end if
+
+        #if $output_options.generate_fasta
+            --aligned 'aligned'
+        #end if
+
+        #if $tool_parameters.target and not $output_options.top_scoring_rna
+            --rna '$tool_parameters.target'
+        #else
+            --top
+        #end if
+        ]]></command>
+    <inputs>
+        <section name="input_sequence" title="Input sequence" expanded="true">
+            <conditional name="input_type_cond">
+                <param name="input_type" type="select" label="Select the type of sequence input" optional="false">
+                    <option value="fasta" selected="true">FASTA file containing the protein sequence(s)</option>
+                    <option value="uniprot">Protein identifier from UniProt</option>
+                </param>
+                <when value="fasta">
+                    <param name="fasta_input" type="data" format="fasta" optional="false" multiple="false" label="Protein sequence(s) in FASTA format" help="Provide a FASTA file containing the protein sequences.">
+                        <validator type="dataset_ok_validator"/>
+                    </param>
+                </when>
+                <when value="uniprot">
+                    <param name="uniprot_id" type="text" value="" optional="false" label="Protein identifier from UniProt" help="Provide a UniProt ID (e.g. P19339).">
+                        <validator type="empty_field" message="Missing UniProt ID"/>
+                    </param>
+                </when>
+            </conditional>
+        </section>
+        <section name="tool_parameters" title="Tool parameters" help="Configure this section to select the predictions to be executed">
+            <param name="target" type="text" optional="true" label="Target RNA sequence (min. 5 nucleotides)" help="Provide a valid target RNA sequence. Leave blank if not specifying a target RNA so that the predictor will use the top-scoring RNA by default.">
+                <validator type="regex" message="The sequence must consist only of RNA nucleotides (A, U, G, C) or be left blank.">^([AUGCaugc]+)?$</validator>
+            </param>
+            <param name="window_size" type="select" label="The window size to test">
+                <option value="5" selected="true">5</option>
+                <option value="3">3</option>
+            </param>
+        </section>
+        <section name="output_options" title="Output parameters" help="Configure this section to define the tool output files">
+            <param name="generate_plots" type="boolean" label="Generate score plots for all the RNA possible windows" help="Enable to generate score plots."/>
+            <param name="top_scoring_rna" type="boolean" label="Find the top-scoring RNA for the specified RRM(s)" help="Enable to find and plot the top-scoring RNA. Attention: This option overrides the target RNA if present."/>
+            <param name="generate_fasta" type="boolean" label="Generate a FASTA file for each input sequence aligned to the HMM" help="Enable to generate a FASTA file with aligned sequences."/>
+        </section>
+    </inputs>
+    <outputs>
+        <collection name="split_csv" type="list" label="Tabular predictions by sequence">
+            <discover_datasets pattern="__designation_and_ext__" directory="tabular" visible="true"/>
+        </collection>
+        <collection name="split_json" type="list" label="Json predictions by sequence">
+            <discover_datasets pattern="__designation_and_ext__" directory="json" visible="true"/>
+        </collection>
+        <collection name="split_aligned" type="list" label="Alignment in FASTA format by sequence">
+            <discover_datasets pattern="__designation_and_ext__" directory="aligned" visible="true"/>
+        </collection>
+        <collection name="split_plots" type="list" label="Plots by sequence">
+            <discover_datasets pattern="__designation_and_ext__" directory="plots" visible="true"/>
+        </collection>
+    </outputs>
+    <tests>
+        <!-- Test 1: UniProt ID P19339, Window Size 5, RNA AUGGCU -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="0"/>
+            <output_collection name="split_plots" count="0"/>
+        </test>
+        <!-- Test 2: UniProt ID P19339, Window Size 3, RNA AUGGCU -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="3"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 3"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="0"/>
+            <output_collection name="split_plots" count="0"/>
+        </test>
+        <!-- Test 3: UniProt ID P19339, Window Size 5, RNA AUGGCU, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="generate_fasta" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--aligned 'aligned'"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="2"/>
+            <output_collection name="split_plots" count="0"/>
+        </test>
+        <!-- Test 4: UniProt ID P19339, Window Size 5, Top RNA, with Plots -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="true"/>
+                <param name="generate_plots" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="0"/>
+            <output_collection name="split_aligned" count="0"/>
+            <output_collection name="split_plots" count="8"/>
+        </test>
+        <!-- Test 5: UniProt ID P19339, Window Size 5, Top RNA, with Plots, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="true"/>
+                <param name="generate_plots" value="true"/>
+                <param name="generate_fasta" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--plot 'plots'"/>
+                <has_text text="--aligned 'aligned'"/>
+                <has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_json" type="list" count="2"/>
+            <output_collection name="split_aligned" type="list" count="2"/>
+            <output_collection name="split_plots" type="list" count="8"/>
+        </test>
+        <!-- Test 6: UniProt ID P19339, Window Size 5, RNA AUGGCU, with Plots -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="generate_plots" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="0"/>
+            <output_collection name="split_plots" count="2"/>
+        </test>
+        <!-- Test 7: UniProt ID P19339, Window Size 5, RNA AUGGCU, with Plots, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P19339"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="false"/>
+                <param name="generate_fasta" value="true"/>
+                <param name="generate_plots" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P19339'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--plot 'plots'"/>
+                <not_has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="2"/>
+            <output_collection name="split_plots" count="2"/>
+        </test>
+        <!-- Test 8: Fasta file, Window Size 5, RNA AUGGCU, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="fasta"/>
+                    <param name="fasta_input" value="input.fasta" ftype="fasta"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="generate_fasta" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--fasta"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+            </assert_command>
+            <output_collection name="split_json" count="2"/>
+            <output_collection name="split_csv" count="2"/>
+            <output_collection name="split_aligned" count="2"/>
+            <output_collection name="split_plots" type="list" count="0"/>
+        </test>
+        <!-- Test 9: Fasta file, Window Size 5, Top RNA, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="fasta"/>
+                    <param name="fasta_input" value="input.fasta" ftype="fasta"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="true"/>
+                <param name="generate_fasta" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--fasta"/>
+                <not_has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--aligned 'aligned'"/>
+                <has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_csv" type="list" count="0"/>
+            <output_collection name="split_json" type="list" count="2"/>
+            <output_collection name="split_plots" type="list" count="0"/>
+            <output_collection name="split_aligned" count="2"/>
+        </test>
+        <!-- Test 10: Fasta file, Window Size 5, Top RNA, with Plots, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="fasta"/>
+                    <param name="fasta_input" value="input.fasta" ftype="fasta"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="true"/>
+                <param name="generate_fasta" value="true"/>
+                <param name="generate_plots" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--fasta"/>
+                <not_has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--plot 'plots'"/>
+                <has_text text="--aligned 'aligned'"/>
+                <has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_csv" type="list" count="0"/>
+            <output_collection name="split_json" type="list" count="2"/>
+            <output_collection name="split_aligned" type="list" count="2"/>
+            <output_collection name="split_plots" type="list" count="8"/>
+        </test>
+        <!-- Test 11: Fasta file, Window Size 5, RNA AUGGCU, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="fasta"/>
+                    <param name="fasta_input" value="input.fasta" ftype="fasta"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+                <param name="target" value="AUGGCU"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="false"/>
+                <param name="generate_fasta" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--fasta"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--aligned 'aligned'"/>
+                <not_has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_csv" type="list" count="2"/>
+            <output_collection name="split_json" type="list" count="2"/>
+            <output_collection name="split_plots" type="list" count="0"/>
+            <output_collection name="split_aligned" count="2"/>
+        </test>
+        <!-- Test 12: Fasta file, Window Size 5, RNA AUGGCU, with Plots, Aligned FASTA files -->
+        <test expect_num_outputs="4">
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="fasta"/>
+                    <param name="fasta_input" value="input.fasta" ftype="fasta"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="window_size" value="5"/>
+                <param name="target" value="AUGGCU"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="false"/>
+                <param name="generate_fasta" value="true"/>
+                <param name="generate_plots" value="true"/>
+            </section>
+            <assert_command>
+                <has_text text="--fasta"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+                <has_text text="--plot 'plots'"/>
+                <has_text text="--aligned 'aligned'"/>
+                <not_has_text text="--top"/>
+            </assert_command>
+            <output_collection name="split_csv" type="list" count="2"/>
+            <output_collection name="split_json" type="list" count="2"/>
+            <output_collection name="split_plots" type="list" count="2"/>
+            <output_collection name="split_aligned" count="2"/>
+        </test>
+        <!-- Test 13: Non-RRM-RNA protein (P05067) -->
+        <test>
+            <section name="input_sequence">
+                <conditional name="input_type_cond">
+                    <param name="input_type" value="uniprot"/>
+                    <param name="uniprot_id" value="P05067"/>
+                </conditional>
+            </section>
+            <section name="tool_parameters">
+                <param name="target" value="AUGGCU"/>
+                <param name="window_size" value="5"/>
+            </section>
+            <section name="output_options">
+                <param name="top_scoring_rna" value="false"/>
+                <param name="generate_plots" value="false"/>
+                <param name="generate_fasta" value="false"/>
+            </section>
+            <assert_command>
+                <has_text text="--uniprot 'P05067'"/>
+                <has_text text="--rna 'AUGGCU'"/>
+                <has_text text="--window_size 5"/>
+                <has_text text="--json 'json'"/>
+                <has_text text="--csv 'tabular'"/>
+            </assert_command>
+            <output_collection name="split_csv" type="list" count="0"/>
+            <output_collection name="split_json" type="list" count="0"/>
+            <output_collection name="split_plots" type="list" count="0"/>
+            <output_collection name="split_aligned" type="list" count="0"/>
+        </test>
+    </tests>
+    <creator>
+        <organization name="Bio2Byte, Vrije Universiteit Brussel (VUB)" address="Interuniversity Institute Bioinformatics Brussels, Université Libre de Bruxelles, 1050 Ixelles, Brussels, Belgium" url="https://bio2byte.be/rrmscorer" email="bio2byte@vub.be" image="https://0.gravatar.com/avatar/2b51fb7600d876086669bcc85a941b763a81d1c2bb3c667b8c83a1aa892cf740"/>
+    </creator>
+    <help><![CDATA[
+    This tool allows you to predict RNA Recognition Motif (RRM) scores for protein
+    sequences provided in *FASTA* format or as *UniProt IDs*.
+
+    **RRMScorer** is designed to predict RNA binding preferences for proteins containing
+    RNA recognition motifs (RRMs), the most prevalent RNA binding domain in eukaryotes.
+
+    **Abstract:**
+
+    By carefully analysing a dataset of 187 RRM-RNA structural complexes, we calculated
+    residue-level binding scores using a probabilistic model derived from
+    amino acid-nucleotide interaction propensities, which are the basis of
+    **RRMScorer**.
+
+    With its ability to provide residue-level insights and accurate predictions,
+    **RRMScorer** serves as a valuable tool for researchers exploring the functional
+    landscape of RRM-RNA interactions.
+
+    **Methodology**:
+
+    The input sequence is scanned against our RRMScorer hidden Markov model (HMM)
+    to (i) identify whether the input sequence contains any RRM domain and (ii)
+    map to the 20 positions in the RRM protein sequence alignment that we use to compute
+    the RNA binding scores.
+
+    If one or more RRM domains are identified in the input sequence, RRMScorer computes
+    the score of the user-defined RNA sequence, or if absent, the scores for all the
+    1024 RNA possible sequences with a length of 5 nt. By utilizing a specific
+    RNA sequence, the user can inspect to which 5-nt windows the RRM is more likely
+    to bind.
+
+    **Input fields:**
+
+    * **Protein sequence(s) FASTA format:** Provide a *FASTA* file containing the protein sequences.
+    * **Protein identifier from Uniprot:** Provide a *UniProt ID* (e.g. P19339).
+    * **Custom RNA target:** Enable or disable the use of a custom RNA target for the predictions.
+    * **Target:** Provide a valid target RNA sequence (minimum 5 nucleotides) if Custom RNA target is enabled.
+    * **The window size to test:** Select the window size (either 3 or 5 nucleotides).
+    * **Plot options:** Configure plot output options.
+
+    **Output:**
+
+    The results are provided in comprehensive bar plots as well as in
+    CSV and JSON formats. When a custom RNA is not provided, the results will
+    include protein sequence logos for a range of top-scoring RNA sequences, as well
+    as the aforementioned CSV and JSON files with the scores.
+
+    **Funding:**
+    This project has received funding from the European Union's Horizon 2020 research
+    and innovation programme under the Marie Skłodowska-Curie grant
+    agreement No. 813239. This work was supported by the European Regional
+    Development Fund and Brussels-Capital Region-Innoviris within the framework of the
+    Operational Programme 2014-2020 (ERDF-2020 project ICITY-RDI.BRU)
+    ]]>
+    </help>
+    <citations>
+        <citation type="doi">10.1371/journal.pcbi.1010859</citation>
+        <citation type="doi">10.1093/nar/gkaf367</citation>
+    </citations>
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/macros.xml	Wed Sep 17 14:53:30 2025 +0000
@@ -0,0 +1,11 @@
+<macros>
+    <token name="@TOOL_VERSION@">1.0.11</token>
+    <token name="@VERSION_SUFFIX@">0</token>
+    <token name="@PROFILE@">22.05</token>
+    <xml name="requirements">
+        <requirements>
+            <requirement type="package" version="@TOOL_VERSION@">rrmscorer</requirement>
+            <requirement type="package" version="0.11.1">seaborn-base</requirement>
+        </requirements>
+    </xml>
+</macros>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/input.fasta	Wed Sep 17 14:53:30 2025 +0000
@@ -0,0 +1,7 @@
+>sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster OX=7227 GN=Sxl PE=1 SV=1
+MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSS
+RRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDP
+RASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQ
+RAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQK
+NILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHF
+MSQMGVVPANVPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI
\ No newline at end of file