Mercurial > repos > iuc > virannot_blast2tsv
comparison test-data/blast2tsv_input.xml @ 0:e889010415a1 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/virAnnot commit 3a3b40c15ae5e82334f016e88b1f3c5bbbb3b2cd
| author | iuc |
|---|---|
| date | Mon, 04 Mar 2024 19:55:52 +0000 |
| parents | |
| children | 77c3ef9b0ed7 |
comparison
equal
deleted
inserted
replaced
| -1:000000000000 | 0:e889010415a1 |
|---|---|
| 1 <?xml version="1.0"?> | |
| 2 <!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd"> | |
| 3 <BlastOutput> | |
| 4 <BlastOutput_program>tblastx</BlastOutput_program> | |
| 5 <BlastOutput_version>TBLASTX 2.10.1+</BlastOutput_version> | |
| 6 <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference> | |
| 7 <BlastOutput_db>/save/tcandresse/refseq/refseq.short.fa</BlastOutput_db> | |
| 8 <BlastOutput_query-ID>ds2020-482-EDGG-1-Q4_42600</BlastOutput_query-ID> | |
| 9 <BlastOutput_query-def>No definition line</BlastOutput_query-def> | |
| 10 <BlastOutput_query-len>96</BlastOutput_query-len> | |
| 11 <BlastOutput_param> | |
| 12 <Parameters> | |
| 13 <Parameters_matrix>BLOSUM62</Parameters_matrix> | |
| 14 <Parameters_expect>0.001</Parameters_expect> | |
| 15 <Parameters_gap-open>11</Parameters_gap-open> | |
| 16 <Parameters_gap-extend>1</Parameters_gap-extend> | |
| 17 <Parameters_filter>L;</Parameters_filter> | |
| 18 </Parameters> | |
| 19 </BlastOutput_param> | |
| 20 <BlastOutput_iterations> | |
| 21 <Iteration> | |
| 22 <Iteration_iter-num>1</Iteration_iter-num> | |
| 23 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_42600</Iteration_query-ID> | |
| 24 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 25 <Iteration_query-len>96</Iteration_query-len> | |
| 26 <Iteration_hits> | |
| 27 <Hit> | |
| 28 <Hit_num>1</Hit_num> | |
| 29 <Hit_id>ref|NC_035070.1|</Hit_id> | |
| 30 <Hit_def>Spinach amalgavirus 1 isolate SRP059420 fusion protein and putative coat protein genes, complete cds</Hit_def> | |
| 31 <Hit_accession>NC_035070</Hit_accession> | |
| 32 <Hit_len>3420</Hit_len> | |
| 33 <Hit_hsps> | |
| 34 <Hsp> | |
| 35 <Hsp_num>1</Hsp_num> | |
| 36 <Hsp_bit-score>51.4703</Hsp_bit-score> | |
| 37 <Hsp_score>106</Hsp_score> | |
| 38 <Hsp_evalue>6.20873e-08</Hsp_evalue> | |
| 39 <Hsp_query-from>3</Hsp_query-from> | |
| 40 <Hsp_query-to>95</Hsp_query-to> | |
| 41 <Hsp_hit-from>1338</Hsp_hit-from> | |
| 42 <Hsp_hit-to>1430</Hsp_hit-to> | |
| 43 <Hsp_query-frame>3</Hsp_query-frame> | |
| 44 <Hsp_hit-frame>3</Hsp_hit-frame> | |
| 45 <Hsp_identity>20</Hsp_identity> | |
| 46 <Hsp_positive>24</Hsp_positive> | |
| 47 <Hsp_gaps>0</Hsp_gaps> | |
| 48 <Hsp_align-len>31</Hsp_align-len> | |
| 49 <Hsp_qseq>GGGTLRTWAADRKMYRGGGSSFDALLLLCQA</Hsp_qseq> | |
| 50 <Hsp_hseq>GGGAMRSWEVDSQMYRGGGNSADALRLLGQA</Hsp_hseq> | |
| 51 <Hsp_midline>GGG +R+W D +MYRGGG+S DAL LL QA</Hsp_midline> | |
| 52 </Hsp> | |
| 53 </Hit_hsps> | |
| 54 </Hit> | |
| 55 </Iteration_hits> | |
| 56 <Iteration_stat> | |
| 57 <Statistics> | |
| 58 <Statistics_db-num>7073</Statistics_db-num> | |
| 59 <Statistics_db-len>36804204</Statistics_db-len> | |
| 60 <Statistics_hsp-len>24</Statistics_hsp-len> | |
| 61 <Statistics_eff-space>96786528</Statistics_eff-space> | |
| 62 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 63 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 64 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 65 </Statistics> | |
| 66 </Iteration_stat> | |
| 67 </Iteration> | |
| 68 <Iteration> | |
| 69 <Iteration_iter-num>2</Iteration_iter-num> | |
| 70 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_60894</Iteration_query-ID> | |
| 71 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 72 <Iteration_query-len>82</Iteration_query-len> | |
| 73 <Iteration_hits> | |
| 74 </Iteration_hits> | |
| 75 <Iteration_stat> | |
| 76 <Statistics> | |
| 77 <Statistics_db-num>7073</Statistics_db-num> | |
| 78 <Statistics_db-len>36804204</Statistics_db-len> | |
| 79 <Statistics_hsp-len>19</Statistics_hsp-len> | |
| 80 <Statistics_eff-space>97069448</Statistics_eff-space> | |
| 81 <Statistics_kappa>0.139224951877679</Statistics_kappa> | |
| 82 <Statistics_lambda>0.315124495232289</Statistics_lambda> | |
| 83 <Statistics_entropy>0.441609275168242</Statistics_entropy> | |
| 84 </Statistics> | |
| 85 </Iteration_stat> | |
| 86 <Iteration_message>No hits found</Iteration_message> | |
| 87 </Iteration> | |
| 88 <Iteration> | |
| 89 <Iteration_iter-num>3</Iteration_iter-num> | |
| 90 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_64647</Iteration_query-ID> | |
| 91 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 92 <Iteration_query-len>80</Iteration_query-len> | |
| 93 <Iteration_hits> | |
| 94 </Iteration_hits> | |
| 95 <Iteration_stat> | |
| 96 <Statistics> | |
| 97 <Statistics_db-num>7073</Statistics_db-num> | |
| 98 <Statistics_db-len>36804204</Statistics_db-len> | |
| 99 <Statistics_hsp-len>18</Statistics_hsp-len> | |
| 100 <Statistics_eff-space>97126032</Statistics_eff-space> | |
| 101 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 102 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 103 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 104 </Statistics> | |
| 105 </Iteration_stat> | |
| 106 <Iteration_message>No hits found</Iteration_message> | |
| 107 </Iteration> | |
| 108 <Iteration> | |
| 109 <Iteration_iter-num>4</Iteration_iter-num> | |
| 110 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_97438</Iteration_query-ID> | |
| 111 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 112 <Iteration_query-len>64</Iteration_query-len> | |
| 113 <Iteration_hits> | |
| 114 </Iteration_hits> | |
| 115 <Iteration_stat> | |
| 116 <Statistics> | |
| 117 <Statistics_db-num>7073</Statistics_db-num> | |
| 118 <Statistics_db-len>36804204</Statistics_db-len> | |
| 119 <Statistics_hsp-len>13</Statistics_hsp-len> | |
| 120 <Statistics_eff-space>97408952</Statistics_eff-space> | |
| 121 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 122 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 123 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 124 </Statistics> | |
| 125 </Iteration_stat> | |
| 126 <Iteration_message>No hits found</Iteration_message> | |
| 127 </Iteration> | |
| 128 <Iteration> | |
| 129 <Iteration_iter-num>5</Iteration_iter-num> | |
| 130 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_104226</Iteration_query-ID> | |
| 131 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 132 <Iteration_query-len>61</Iteration_query-len> | |
| 133 <Iteration_hits> | |
| 134 </Iteration_hits> | |
| 135 <Iteration_stat> | |
| 136 <Statistics> | |
| 137 <Statistics_db-num>7073</Statistics_db-num> | |
| 138 <Statistics_db-len>36804204</Statistics_db-len> | |
| 139 <Statistics_hsp-len>12</Statistics_hsp-len> | |
| 140 <Statistics_eff-space>97465536</Statistics_eff-space> | |
| 141 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 142 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 143 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 144 </Statistics> | |
| 145 </Iteration_stat> | |
| 146 <Iteration_message>No hits found</Iteration_message> | |
| 147 </Iteration> | |
| 148 <Iteration> | |
| 149 <Iteration_iter-num>6</Iteration_iter-num> | |
| 150 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_60048</Iteration_query-ID> | |
| 151 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 152 <Iteration_query-len>83</Iteration_query-len> | |
| 153 <Iteration_hits> | |
| 154 </Iteration_hits> | |
| 155 <Iteration_stat> | |
| 156 <Statistics> | |
| 157 <Statistics_db-num>7073</Statistics_db-num> | |
| 158 <Statistics_db-len>36804204</Statistics_db-len> | |
| 159 <Statistics_hsp-len>19</Statistics_hsp-len> | |
| 160 <Statistics_eff-space>97069448</Statistics_eff-space> | |
| 161 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 162 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 163 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 164 </Statistics> | |
| 165 </Iteration_stat> | |
| 166 <Iteration_message>No hits found</Iteration_message> | |
| 167 </Iteration> | |
| 168 <Iteration> | |
| 169 <Iteration_iter-num>7</Iteration_iter-num> | |
| 170 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_57812</Iteration_query-ID> | |
| 171 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 172 <Iteration_query-len>84</Iteration_query-len> | |
| 173 <Iteration_hits> | |
| 174 </Iteration_hits> | |
| 175 <Iteration_stat> | |
| 176 <Statistics> | |
| 177 <Statistics_db-num>7073</Statistics_db-num> | |
| 178 <Statistics_db-len>36804204</Statistics_db-len> | |
| 179 <Statistics_hsp-len>20</Statistics_hsp-len> | |
| 180 <Statistics_eff-space>97012864</Statistics_eff-space> | |
| 181 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 182 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 183 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 184 </Statistics> | |
| 185 </Iteration_stat> | |
| 186 <Iteration_message>No hits found</Iteration_message> | |
| 187 </Iteration> | |
| 188 <Iteration> | |
| 189 <Iteration_iter-num>8</Iteration_iter-num> | |
| 190 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_107243</Iteration_query-ID> | |
| 191 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 192 <Iteration_query-len>60</Iteration_query-len> | |
| 193 <Iteration_hits> | |
| 194 <Hit> | |
| 195 <Hit_num>1</Hit_num> | |
| 196 <Hit_id>ref|NC_006276.1|</Hit_id> | |
| 197 <Hit_def>White clover cryptic virus 1 RNA2, complete genome</Hit_def> | |
| 198 <Hit_accession>NC_006276</Hit_accession> | |
| 199 <Hit_len>1708</Hit_len> | |
| 200 <Hit_hsps> | |
| 201 <Hsp> | |
| 202 <Hsp_num>1</Hsp_num> | |
| 203 <Hsp_bit-score>37.724</Hsp_bit-score> | |
| 204 <Hsp_score>76</Hsp_score> | |
| 205 <Hsp_evalue>0.000859157</Hsp_evalue> | |
| 206 <Hsp_query-from>2</Hsp_query-from> | |
| 207 <Hsp_query-to>52</Hsp_query-to> | |
| 208 <Hsp_hit-from>495</Hsp_hit-from> | |
| 209 <Hsp_hit-to>545</Hsp_hit-to> | |
| 210 <Hsp_query-frame>2</Hsp_query-frame> | |
| 211 <Hsp_hit-frame>3</Hsp_hit-frame> | |
| 212 <Hsp_identity>14</Hsp_identity> | |
| 213 <Hsp_positive>15</Hsp_positive> | |
| 214 <Hsp_gaps>0</Hsp_gaps> | |
| 215 <Hsp_align-len>17</Hsp_align-len> | |
| 216 <Hsp_qseq>ISVLWNTMILKVYVETG</Hsp_qseq> | |
| 217 <Hsp_hseq>VSVLWNVMILKVYVNTG</Hsp_hseq> | |
| 218 <Hsp_midline>+SVLWN MILKVYV TG</Hsp_midline> | |
| 219 </Hsp> | |
| 220 </Hit_hsps> | |
| 221 </Hit> | |
| 222 </Iteration_hits> | |
| 223 <Iteration_stat> | |
| 224 <Statistics> | |
| 225 <Statistics_db-num>7073</Statistics_db-num> | |
| 226 <Statistics_db-len>36804204</Statistics_db-len> | |
| 227 <Statistics_hsp-len>12</Statistics_hsp-len> | |
| 228 <Statistics_eff-space>97465536</Statistics_eff-space> | |
| 229 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 230 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 231 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 232 </Statistics> | |
| 233 </Iteration_stat> | |
| 234 </Iteration> | |
| 235 <Iteration> | |
| 236 <Iteration_iter-num>9</Iteration_iter-num> | |
| 237 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_99332</Iteration_query-ID> | |
| 238 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 239 <Iteration_query-len>63</Iteration_query-len> | |
| 240 <Iteration_hits> | |
| 241 </Iteration_hits> | |
| 242 <Iteration_stat> | |
| 243 <Statistics> | |
| 244 <Statistics_db-num>7073</Statistics_db-num> | |
| 245 <Statistics_db-len>36804204</Statistics_db-len> | |
| 246 <Statistics_hsp-len>13</Statistics_hsp-len> | |
| 247 <Statistics_eff-space>97408952</Statistics_eff-space> | |
| 248 <Statistics_kappa>0.133969292349849</Statistics_kappa> | |
| 249 <Statistics_lambda>0.313843789061929</Statistics_lambda> | |
| 250 <Statistics_entropy>0.427993038537577</Statistics_entropy> | |
| 251 </Statistics> | |
| 252 </Iteration_stat> | |
| 253 <Iteration_message>No hits found</Iteration_message> | |
| 254 </Iteration> | |
| 255 <Iteration> | |
| 256 <Iteration_iter-num>10</Iteration_iter-num> | |
| 257 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_77228</Iteration_query-ID> | |
| 258 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 259 <Iteration_query-len>74</Iteration_query-len> | |
| 260 <Iteration_hits> | |
| 261 </Iteration_hits> | |
| 262 <Iteration_stat> | |
| 263 <Statistics> | |
| 264 <Statistics_db-num>7073</Statistics_db-num> | |
| 265 <Statistics_db-len>36804204</Statistics_db-len> | |
| 266 <Statistics_hsp-len>16</Statistics_hsp-len> | |
| 267 <Statistics_eff-space>97239200</Statistics_eff-space> | |
| 268 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 269 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 270 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 271 </Statistics> | |
| 272 </Iteration_stat> | |
| 273 <Iteration_message>No hits found</Iteration_message> | |
| 274 </Iteration> | |
| 275 <Iteration> | |
| 276 <Iteration_iter-num>11</Iteration_iter-num> | |
| 277 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_66730</Iteration_query-ID> | |
| 278 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 279 <Iteration_query-len>79</Iteration_query-len> | |
| 280 <Iteration_hits> | |
| 281 </Iteration_hits> | |
| 282 <Iteration_stat> | |
| 283 <Statistics> | |
| 284 <Statistics_db-num>7073</Statistics_db-num> | |
| 285 <Statistics_db-len>36804204</Statistics_db-len> | |
| 286 <Statistics_hsp-len>17</Statistics_hsp-len> | |
| 287 <Statistics_eff-space>109330443</Statistics_eff-space> | |
| 288 <Statistics_kappa>0.123285876267438</Statistics_kappa> | |
| 289 <Statistics_lambda>0.308001358455575</Statistics_lambda> | |
| 290 <Statistics_entropy>0.370429799913588</Statistics_entropy> | |
| 291 </Statistics> | |
| 292 </Iteration_stat> | |
| 293 <Iteration_message>No hits found</Iteration_message> | |
| 294 </Iteration> | |
| 295 <Iteration> | |
| 296 <Iteration_iter-num>12</Iteration_iter-num> | |
| 297 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_2681</Iteration_query-ID> | |
| 298 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 299 <Iteration_query-len>348</Iteration_query-len> | |
| 300 <Iteration_hits> | |
| 301 <Hit> | |
| 302 <Hit_num>1</Hit_num> | |
| 303 <Hit_id>ref|NC_011554.1|</Hit_id> | |
| 304 <Hit_def>Blackberry chlorotic ringspot virus RNA2, complete genome</Hit_def> | |
| 305 <Hit_accession>NC_011554</Hit_accession> | |
| 306 <Hit_len>2879</Hit_len> | |
| 307 <Hit_hsps> | |
| 308 <Hsp> | |
| 309 <Hsp_num>1</Hsp_num> | |
| 310 <Hsp_bit-score>72.0897</Hsp_bit-score> | |
| 311 <Hsp_score>151</Hsp_score> | |
| 312 <Hsp_evalue>1.04985e-23</Hsp_evalue> | |
| 313 <Hsp_query-from>137</Hsp_query-from> | |
| 314 <Hsp_query-to>286</Hsp_query-to> | |
| 315 <Hsp_hit-from>117</Hsp_hit-from> | |
| 316 <Hsp_hit-to>266</Hsp_hit-to> | |
| 317 <Hsp_query-frame>-3</Hsp_query-frame> | |
| 318 <Hsp_hit-frame>3</Hsp_hit-frame> | |
| 319 <Hsp_identity>28</Hsp_identity> | |
| 320 <Hsp_positive>36</Hsp_positive> | |
| 321 <Hsp_gaps>0</Hsp_gaps> | |
| 322 <Hsp_align-len>50</Hsp_align-len> | |
| 323 <Hsp_qseq>DNYDEWVKLFLFEFVVKHTAKFDFATIFDTFEMVVRTIDPSIPDFYEEDD</Hsp_qseq> | |
| 324 <Hsp_hseq>DMYKEWVSMFLFKFIVEHTAKFDFATIDCTFGMIVARLIPGYSDLDDEDE</Hsp_hseq> | |
| 325 <Hsp_midline>D Y EWV +FLF+F+V+HTAKFDFATI TF M+V + P D +ED+</Hsp_midline> | |
| 326 </Hsp> | |
| 327 <Hsp> | |
| 328 <Hsp_num>2</Hsp_num> | |
| 329 <Hsp_bit-score>56.0524</Hsp_bit-score> | |
| 330 <Hsp_score>116</Hsp_score> | |
| 331 <Hsp_evalue>1.04985e-23</Hsp_evalue> | |
| 332 <Hsp_query-from>38</Hsp_query-from> | |
| 333 <Hsp_query-to>148</Hsp_query-to> | |
| 334 <Hsp_hit-from>252</Hsp_hit-from> | |
| 335 <Hsp_hit-to>362</Hsp_hit-to> | |
| 336 <Hsp_query-frame>-3</Hsp_query-frame> | |
| 337 <Hsp_hit-frame>3</Hsp_hit-frame> | |
| 338 <Hsp_identity>21</Hsp_identity> | |
| 339 <Hsp_positive>28</Hsp_positive> | |
| 340 <Hsp_gaps>0</Hsp_gaps> | |
| 341 <Hsp_align-len>37</Hsp_align-len> | |
| 342 <Hsp_qseq>EEDDSGLFPREIDSFYLPYDDLDVDYTKVVHDCRDID</Hsp_qseq> | |
| 343 <Hsp_hseq>DDEDEEHSPREIDSFYLPYDDLDVDYTTIDYRRDDVE</Hsp_hseq> | |
| 344 <Hsp_midline>+++D PREIDSFYLPYDDLDVDYT + + D++</Hsp_midline> | |
| 345 </Hsp> | |
| 346 <Hsp> | |
| 347 <Hsp_num>3</Hsp_num> | |
| 348 <Hsp_bit-score>44.5971</Hsp_bit-score> | |
| 349 <Hsp_score>91</Hsp_score> | |
| 350 <Hsp_evalue>2.20433e-07</Hsp_evalue> | |
| 351 <Hsp_query-from>183</Hsp_query-from> | |
| 352 <Hsp_query-to>275</Hsp_query-to> | |
| 353 <Hsp_hit-from>128</Hsp_hit-from> | |
| 354 <Hsp_hit-to>220</Hsp_hit-to> | |
| 355 <Hsp_query-frame>3</Hsp_query-frame> | |
| 356 <Hsp_hit-frame>-2</Hsp_hit-frame> | |
| 357 <Hsp_identity>19</Hsp_identity> | |
| 358 <Hsp_positive>20</Hsp_positive> | |
| 359 <Hsp_gaps>0</Hsp_gaps> | |
| 360 <Hsp_align-len>31</Hsp_align-len> | |
| 361 <Hsp_qseq>TTISNVSKIVAKSNFAVCLTTNSKRKSFTHS</Hsp_qseq> | |
| 362 <Hsp_hseq>TIIPNVQSIVAKSNFAVCSTINLNKNMLTHS</Hsp_hseq> | |
| 363 <Hsp_midline>T I NV IVAKSNFAVC T N + THS</Hsp_midline> | |
| 364 </Hsp> | |
| 365 <Hsp> | |
| 366 <Hsp_num>4</Hsp_num> | |
| 367 <Hsp_bit-score>28.1016</Hsp_bit-score> | |
| 368 <Hsp_score>55</Hsp_score> | |
| 369 <Hsp_evalue>2.20433e-07</Hsp_evalue> | |
| 370 <Hsp_query-from>73</Hsp_query-from> | |
| 371 <Hsp_query-to>126</Hsp_query-to> | |
| 372 <Hsp_hit-from>274</Hsp_hit-from> | |
| 373 <Hsp_hit-to>327</Hsp_hit-to> | |
| 374 <Hsp_query-frame>1</Hsp_query-frame> | |
| 375 <Hsp_hit-frame>-3</Hsp_hit-frame> | |
| 376 <Hsp_identity>12</Hsp_identity> | |
| 377 <Hsp_positive>12</Hsp_positive> | |
| 378 <Hsp_gaps>0</Hsp_gaps> | |
| 379 <Hsp_align-len>18</Hsp_align-len> | |
| 380 <Hsp_qseq>SPHQDHHKVDKRNQFP*E</Hsp_qseq> | |
| 381 <Hsp_hseq>SLHQDRRMEDKRNQSP*E</Hsp_hseq> | |
| 382 <Hsp_midline>S HQD DKRNQ P*E</Hsp_midline> | |
| 383 </Hsp> | |
| 384 </Hit_hsps> | |
| 385 </Hit> | |
| 386 </Iteration_hits> | |
| 387 <Iteration_stat> | |
| 388 <Statistics> | |
| 389 <Statistics_db-num>7073</Statistics_db-num> | |
| 390 <Statistics_db-len>36804204</Statistics_db-len> | |
| 391 <Statistics_hsp-len>43</Statistics_hsp-len> | |
| 392 <Statistics_eff-space>873366817</Statistics_eff-space> | |
| 393 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 394 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 395 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 396 </Statistics> | |
| 397 </Iteration_stat> | |
| 398 </Iteration> | |
| 399 <Iteration> | |
| 400 <Iteration_iter-num>19</Iteration_iter-num> | |
| 401 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_107857</Iteration_query-ID> | |
| 402 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 403 <Iteration_query-len>59</Iteration_query-len> | |
| 404 <Iteration_hits> | |
| 405 <Hit> | |
| 406 <Hit_num>1</Hit_num> | |
| 407 <Hit_id>ref|NC_003501.1|</Hit_id> | |
| 408 <Hit_def>Brome streak mosaic virus, complete genome</Hit_def> | |
| 409 <Hit_accession>NC_003501</Hit_accession> | |
| 410 <Hit_len>9672</Hit_len> | |
| 411 <Hit_hsps> | |
| 412 <Hsp> | |
| 413 <Hsp_num>1</Hsp_num> | |
| 414 <Hsp_bit-score>62.0091</Hsp_bit-score> | |
| 415 <Hsp_score>129</Hsp_score> | |
| 416 <Hsp_evalue>4.20284e-11</Hsp_evalue> | |
| 417 <Hsp_query-from>2</Hsp_query-from> | |
| 418 <Hsp_query-to>58</Hsp_query-to> | |
| 419 <Hsp_hit-from>3274</Hsp_hit-from> | |
| 420 <Hsp_hit-to>3330</Hsp_hit-to> | |
| 421 <Hsp_query-frame>2</Hsp_query-frame> | |
| 422 <Hsp_hit-frame>1</Hsp_hit-frame> | |
| 423 <Hsp_identity>19</Hsp_identity> | |
| 424 <Hsp_positive>19</Hsp_positive> | |
| 425 <Hsp_gaps>0</Hsp_gaps> | |
| 426 <Hsp_align-len>19</Hsp_align-len> | |
| 427 <Hsp_qseq>QDCRKCHTDIGCSCDYCNW</Hsp_qseq> | |
| 428 <Hsp_hseq>QDCRKCHTDIGCSCDYCNW</Hsp_hseq> | |
| 429 <Hsp_midline>QDCRKCHTDIGCSCDYCNW</Hsp_midline> | |
| 430 </Hsp> | |
| 431 <Hsp> | |
| 432 <Hsp_num>2</Hsp_num> | |
| 433 <Hsp_bit-score>55.1359</Hsp_bit-score> | |
| 434 <Hsp_score>114</Hsp_score> | |
| 435 <Hsp_evalue>4.92676e-09</Hsp_evalue> | |
| 436 <Hsp_query-from>3</Hsp_query-from> | |
| 437 <Hsp_query-to>59</Hsp_query-to> | |
| 438 <Hsp_hit-from>3275</Hsp_hit-from> | |
| 439 <Hsp_hit-to>3331</Hsp_hit-to> | |
| 440 <Hsp_query-frame>-1</Hsp_query-frame> | |
| 441 <Hsp_hit-frame>-3</Hsp_hit-frame> | |
| 442 <Hsp_identity>19</Hsp_identity> | |
| 443 <Hsp_positive>19</Hsp_positive> | |
| 444 <Hsp_gaps>0</Hsp_gaps> | |
| 445 <Hsp_align-len>19</Hsp_align-len> | |
| 446 <Hsp_qseq>ANCSNHSCNQYLCGTFDNL</Hsp_qseq> | |
| 447 <Hsp_hseq>ANCSNHSCNQYLCGTFDNL</Hsp_hseq> | |
| 448 <Hsp_midline>ANCSNHSCNQYLCGTFDNL</Hsp_midline> | |
| 449 </Hsp> | |
| 450 </Hit_hsps> | |
| 451 </Hit> | |
| 452 </Iteration_hits> | |
| 453 <Iteration_stat> | |
| 454 <Statistics> | |
| 455 <Statistics_db-num>7073</Statistics_db-num> | |
| 456 <Statistics_db-len>36804204</Statistics_db-len> | |
| 457 <Statistics_hsp-len>11</Statistics_hsp-len> | |
| 458 <Statistics_eff-space>97522120</Statistics_eff-space> | |
| 459 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 460 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 461 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 462 </Statistics> | |
| 463 </Iteration_stat> | |
| 464 </Iteration> | |
| 465 <Iteration> | |
| 466 <Iteration_iter-num>20</Iteration_iter-num> | |
| 467 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_83983</Iteration_query-ID> | |
| 468 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 469 <Iteration_query-len>71</Iteration_query-len> | |
| 470 <Iteration_hits> | |
| 471 </Iteration_hits> | |
| 472 <Iteration_stat> | |
| 473 <Statistics> | |
| 474 <Statistics_db-num>7073</Statistics_db-num> | |
| 475 <Statistics_db-len>36804204</Statistics_db-len> | |
| 476 <Statistics_hsp-len>15</Statistics_hsp-len> | |
| 477 <Statistics_eff-space>97295784</Statistics_eff-space> | |
| 478 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 479 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 480 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 481 </Statistics> | |
| 482 </Iteration_stat> | |
| 483 <Iteration_message>No hits found</Iteration_message> | |
| 484 </Iteration> | |
| 485 <Iteration> | |
| 486 <Iteration_iter-num>21</Iteration_iter-num> | |
| 487 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_92239</Iteration_query-ID> | |
| 488 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 489 <Iteration_query-len>66</Iteration_query-len> | |
| 490 <Iteration_hits> | |
| 491 </Iteration_hits> | |
| 492 <Iteration_stat> | |
| 493 <Statistics> | |
| 494 <Statistics_db-num>7073</Statistics_db-num> | |
| 495 <Statistics_db-len>36804204</Statistics_db-len> | |
| 496 <Statistics_hsp-len>14</Statistics_hsp-len> | |
| 497 <Statistics_eff-space>97352368</Statistics_eff-space> | |
| 498 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 499 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 500 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 501 </Statistics> | |
| 502 </Iteration_stat> | |
| 503 <Iteration_message>No hits found</Iteration_message> | |
| 504 </Iteration> | |
| 505 <Iteration> | |
| 506 <Iteration_iter-num>22</Iteration_iter-num> | |
| 507 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_31663</Iteration_query-ID> | |
| 508 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 509 <Iteration_query-len>111</Iteration_query-len> | |
| 510 <Iteration_hits> | |
| 511 </Iteration_hits> | |
| 512 <Iteration_stat> | |
| 513 <Statistics> | |
| 514 <Statistics_db-num>7073</Statistics_db-num> | |
| 515 <Statistics_db-len>36804204</Statistics_db-len> | |
| 516 <Statistics_hsp-len>29</Statistics_hsp-len> | |
| 517 <Statistics_eff-space>96503608</Statistics_eff-space> | |
| 518 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 519 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 520 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 521 </Statistics> | |
| 522 </Iteration_stat> | |
| 523 <Iteration_message>No hits found</Iteration_message> | |
| 524 </Iteration> | |
| 525 <Iteration> | |
| 526 <Iteration_iter-num>23</Iteration_iter-num> | |
| 527 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_63163</Iteration_query-ID> | |
| 528 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 529 <Iteration_query-len>81</Iteration_query-len> | |
| 530 <Iteration_hits> | |
| 531 <Hit> | |
| 532 <Hit_num>1</Hit_num> | |
| 533 <Hit_id>ref|NC_011591.1|</Hit_id> | |
| 534 <Hit_def>Southern tomato virus, complete genome</Hit_def> | |
| 535 <Hit_accession>NC_011591</Hit_accession> | |
| 536 <Hit_len>3437</Hit_len> | |
| 537 <Hit_hsps> | |
| 538 <Hsp> | |
| 539 <Hsp_num>1</Hsp_num> | |
| 540 <Hsp_bit-score>44.1389</Hsp_bit-score> | |
| 541 <Hsp_score>90</Hsp_score> | |
| 542 <Hsp_evalue>1.00223e-05</Hsp_evalue> | |
| 543 <Hsp_query-from>1</Hsp_query-from> | |
| 544 <Hsp_query-to>81</Hsp_query-to> | |
| 545 <Hsp_hit-from>3034</Hsp_hit-from> | |
| 546 <Hsp_hit-to>3114</Hsp_hit-to> | |
| 547 <Hsp_query-frame>1</Hsp_query-frame> | |
| 548 <Hsp_hit-frame>1</Hsp_hit-frame> | |
| 549 <Hsp_identity>17</Hsp_identity> | |
| 550 <Hsp_positive>19</Hsp_positive> | |
| 551 <Hsp_gaps>0</Hsp_gaps> | |
| 552 <Hsp_align-len>27</Hsp_align-len> | |
| 553 <Hsp_qseq>KFMDFIRGVAVIGEGQWGIEMDRWIRF</Hsp_qseq> | |
| 554 <Hsp_hseq>KVMDLIRGNATIGRGQWGNDVMDWIRF</Hsp_hseq> | |
| 555 <Hsp_midline>K MD IRG A IG GQWG ++ WIRF</Hsp_midline> | |
| 556 </Hsp> | |
| 557 </Hit_hsps> | |
| 558 </Hit> | |
| 559 </Iteration_hits> | |
| 560 <Iteration_stat> | |
| 561 <Statistics> | |
| 562 <Statistics_db-num>7073</Statistics_db-num> | |
| 563 <Statistics_db-len>36804204</Statistics_db-len> | |
| 564 <Statistics_hsp-len>19</Statistics_hsp-len> | |
| 565 <Statistics_eff-space>97069448</Statistics_eff-space> | |
| 566 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 567 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 568 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 569 </Statistics> | |
| 570 </Iteration_stat> | |
| 571 </Iteration> | |
| 572 <Iteration> | |
| 573 <Iteration_iter-num>24</Iteration_iter-num> | |
| 574 <Iteration_query-ID>ds2020-482-EDGG-1-Q4_91422</Iteration_query-ID> | |
| 575 <Iteration_query-def>No definition line</Iteration_query-def> | |
| 576 <Iteration_query-len>67</Iteration_query-len> | |
| 577 <Iteration_hits> | |
| 578 </Iteration_hits> | |
| 579 <Iteration_stat> | |
| 580 <Statistics> | |
| 581 <Statistics_db-num>7073</Statistics_db-num> | |
| 582 <Statistics_db-len>36804204</Statistics_db-len> | |
| 583 <Statistics_hsp-len>14</Statistics_hsp-len> | |
| 584 <Statistics_eff-space>97352368</Statistics_eff-space> | |
| 585 <Statistics_kappa>0.133956144488482</Statistics_kappa> | |
| 586 <Statistics_lambda>0.317605957635731</Statistics_lambda> | |
| 587 <Statistics_entropy>0.401214524497119</Statistics_entropy> | |
| 588 </Statistics> | |
| 589 </Iteration_stat> | |
| 590 <Iteration_message>No hits found</Iteration_message> | |
| 591 </Iteration> | |
| 592 </BlastOutput_iterations> | |
| 593 </BlastOutput> |