# HG changeset patch # User iuc # Date 1724246008 0 # Node ID fd7104249a3cbe960dd831017a3780e5f31f1976 # Parent 84d20d9c292d2aa256d341c529499715baa4bad7 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/virAnnot commit ab5e1189217b6ed5f1c5d7c5ff6b79b6a4c18cff diff -r 84d20d9c292d -r fd7104249a3c blast2tsv.py --- a/blast2tsv.py Sat May 18 18:14:29 2024 +0000 +++ b/blast2tsv.py Wed Aug 21 13:13:28 2024 +0000 @@ -28,11 +28,19 @@ def _guess_database(accession): """Guess the correct database for querying based off the format of the accession""" - database_mappings_refseq = {'AC_': 'nuccore', 'NC_': 'nuccore', 'NG_': 'nuccore', - 'NT_': 'nuccore', 'NW_': 'nuccore', 'NZ_': 'nuccore', - 'AP_': 'protein', 'NP_': 'protein', 'YP_': 'protein', - 'XP_': 'protein', 'WP_': 'protein'} - return database_mappings_refseq[accession[0:3]] + if accession.isdigit(): + db = 'taxonomy' + else: + database_mappings_refseq = {'AC': 'nuccore', 'NC': 'nuccore', 'NG': 'nuccore', + 'NT': 'nuccore', 'NW': 'nuccore', 'NZ': 'nuccore', + 'AP': 'protein', 'NP': 'protein', 'YP': 'protein', + 'XP': 'protein', 'WP': 'protein', 'OX': 'nuccore'} + try: + db = database_mappings_refseq[accession[0:2]] + except KeyError: + db = 'nuccore' + log.warning("DB not found for " + accession + ". Set to nuccore.") + return db def _read_xml(options): @@ -69,7 +77,7 @@ elif hit_count > 1: final_hit_count = hit_count - 1 hsp["evalue"] = cumul_hit_evalue / final_hit_count # The smaller the E-value, the better the match - hsp["query_id"] = blast_record.query_id + hsp["query_id"] = blast_record.query # or query_id hsp["query_length"] = blast_record.query_length # length of the query hsp["accession"] = aln.accession.replace("ref|", "") hsp["description"] = aln.hit_def @@ -101,7 +109,12 @@ hsp["tax_id"] = "" hsp["taxonomy"] = "" hsp["organism"] = "" - log.warning("RuntimeError - Taxid not found for " + hsp["accession"]) + log.warning(f"RuntimeError - Taxid not found for {hsp['accession']}") + except Exception as err: + hsp["tax_id"] = "" + hsp["taxonomy"] = "" + hsp["organism"] = "" + log.warning(f"Taxid not found for {hsp['accession']}. The error is {err}") if hsp["evalue"] <= options.max_evalue and hsp["queryOverlap"] >= options.min_qov and \ hsp["hitOverlap"] >= options.min_hov and hsp["score"] >= options.min_score: xml_results[hsp["query_id"]] = hsp diff -r 84d20d9c292d -r fd7104249a3c rps2tsv.py --- a/rps2tsv.py Sat May 18 18:14:29 2024 +0000 +++ b/rps2tsv.py Wed Aug 21 13:13:28 2024 +0000 @@ -56,7 +56,7 @@ hsp["accession"] = aln.accession hsp["pfam_id"] = hsp["description"].split(",")[0].replace("pfam", "PF") log.info("Requeting Interpro for " + hsp["pfam_id"]) - url = "https://www.ebi.ac.uk/interpro/api/entry/pfam/" + hsp["pfam_id"] + "/taxonomy/uniprot/" + url = "https://www.ebi.ac.uk/interpro/api/taxonomy/uniprot/entry/pfam/" + hsp["pfam_id"] req = request.Request(url) try: response = request.urlopen(req) @@ -69,13 +69,20 @@ decoded_response = encoded_response.decode() payload = json.loads(decoded_response) kingdoms = [] - for item in payload["taxonomy_subset"]: - lineage_string = item["lineage"] - lineage = [int(i) for i in lineage_string] - translation = ncbi.get_taxid_translator(lineage) - names = list(translation.values()) - taxonomy = names[1:] # remove 'root' at the begining - kingdoms.append(taxonomy[0]) + for item in payload["results"][:6]: + if item["metadata"]["parent"] is not None: + lineage_parent = item["metadata"]["parent"] + translation = ncbi.get_taxid_translator([int(lineage_parent)]) + names = list(translation.values()) + if len(names) > 0: + if names[0] == "root": + taxonomy = names[1:] # remove 'root' at the begining + else: + taxonomy = names + else: + taxonomy = names + if len(taxonomy) != 0: + kingdoms.append(taxonomy[0]) frequency = {kingdom: kingdoms.count(kingdom) for kingdom in kingdoms} # {'Pseudomonadota': 9, 'cellular organisms': 4} sorted_freq = dict(sorted(frequency.items(), key=lambda x: x[1], reverse=True)) concat_freq = ";".join("{}({})".format(k, v) for k, v in sorted_freq.items()) diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_contigs.fa --- a/test-data/blast2tsv_contigs.fa Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_contigs.fa Wed Aug 21 13:13:28 2024 +0000 @@ -1,16 +1,373 @@ ->ds2020-482-EDGG-1-Q4_42600 -TCGGTGGGGGGACCTTGCGGACATGGGCGGCGGACCGTAAGATGTATAGAGGTGGGGGTA -GTAGTTTTGATGCCCTTTTGCTTTTGTGCCAAGCCA ->ds2020-482-EDGG-1-Q4_107243 -TATATCTGTGCTTTGGAACACAATGATTCTCAAAGTCTATGTCGAGACTGGAAACTCTCT ->ds2020-482-EDGG-1-Q4_2681 -CCTTCCTAGCGACCACGCACACGTCAAGACCGGCATCATCAATGTCGCGACAATCGTGAA -CCACTTTAGTATAGTCCACATCAAGATCATCATAAGGTAGATAAAAGGAATCAATTTCCC -TAGGAAAAAGTCCAGAATCATCTTCCTCATAAAAATCTGGTATCGAGGGATCAATGGTTC -GCACCACCATCTCGAATGTATCAAAGATCGTCGCGAAATCAAACTTTGCGGTATGCTTAA -CGACAAACTCGAAAAGGAAAAGTTTTACCCATTCGTCGTAGTTGTCATCTTTATGCACAC -CGAACGTCGAGAAAAACCCAAAGAACGTGTGCGTGGTCGCTAGGAAGG ->ds2020-482-EDGG-1-Q4_107857 -TCAAGATTGTCGAAAGTGCCACACAGATATTGGTTGCAGCTGTGATTACTGCAATTGGC ->ds2020-482-EDGG-1-Q4_63163 -AAGTTCATGGACTTCATCCGAGGAGTTGCCGTCATTGGGGAAGGGCAGTGGGGGATTGAG \ No newline at end of file +>NODE_1_length_506_cov_10.687361 +CTAACCTGTGTTGGGTGTGTTTGGTGTCTTGGGTCGGCATTAGCAACTAAATCAAAAGGC +ATAAACCTTGTGAGTTGATGATTGGCAGGAATGTTGACCGGCGTTTCCGGAGCAGATGTC +GCAGCGTAAATTACGTCGCGAGGAGCATGGGTAGCAGTAGCAGCAGCAGCGGGGCGTTGG +AGAAAGCAAATGTCTTGAGCACGGGCTTCGTCAGTAACGAAGTTGAGGTGGGTAAAGGCA +GCATAAAGGTTGGCTTTATTCGTTTCACGACCGGCAATCCATGTAGGAAGGGCGTAGGTT +GAATAACCATGCTTTATGATCGCAGAACCAGAGGGATTTTCAATCAGCTGGAACAGAGTC +ATGGTGGGGTTCGTAACGTCATTAGCAATAGCAGTGACGGCTTGAAGAACAACTTTAATT +TCACGTAGGTTGCCAGGAGTAGCAGCAAACAACATGTCATAGGCGTTCACATGATTTGTA +GCGAAGATAGGAGGCTGTAGTGACAG +>NODE_2_length_429_cov_3.631016 +GTCTAACCTGTGTTGGGTGTGTTTGGTTAGTTGGCTGGAATTCATGCACCGTTGACACGG +GTTGCTTAACATCTTGCCTCATCCTAGTTTTGGCTGCTTGGTAGAACGTCAAAACAACAT +CCACCTTCTGCTTGGCTGCTATACTCTTGATGCTCTCTGGTTCGTACCTGTCCATATCCA +CTAATATTACATCGGTATTGTAGTCACACTTGCTGGTAATGTTAACCCCCAATTGTGATA +ACACCGCACATATTGAATGACCGTACCTGTAGGTCGTGGTCAACACCTCACGATTGTGCA +CCAAATCCAACACATTACTCAGCACCCTCTCACCGTGGGCTGGGCTTGTGTCTATGCTTC +CTACCTGATCCATGTCACCATAACATATTACATTTTTAAATGCCCAAACACACCCAACAC +AGGTTAGAC +>NODE_3_length_365_cov_1.074194 +GTCTAACCTGTGTTGGGTGTGTTTGGTGGTCCGTTGAGCTAGATTGGAAGAAATTTGATA +GGGAGAGGCCAGCTGAGGACATTTCTTTCTGCATTGATGTATTTCTTTCATGTTTTGAGC +CGCGGTCTGAAAGGGAGACAAGACTTTTGAGGGCATATGGCATTTGTATGAGAAGAGCAC +TCGTGGAACGCCTGTTCGTGACGGATACGGGTTGCGTATTCGGTATCGACGGGATGGTTC +CAAGTGGCTCTCTATGGACTGGCTTCCTTGATACCGCGCTCAATATTCTATATATTTCTG +ATGTTCTTTTGGATATGGGTTTCTACCCCCCCCTGGCTTCCAAACACACCCAACACAGGT +TAGAC +>NODE_4_length_351_cov_1.547297 +GTCTAACCTGTGTTGGGTGTGTTTGGTTTCTAGGTGAATGATGTCAACAAGCGCCCTGGA +CCGTCTGCTCATGCTGCCTCATGGAAAGAAGTTTCCTGGAAAACTAGCTTTGTATCCTTC +CTACAAAGTCTGCCTGTTCCTGAATTTCTTGTACCGATACTTAAACAGTTCAGTCACTTT +ACTACTGATCGAACTAAGAACGTATTCTTTATTCCATCTGCCGCTGGCTATGACCATAAC +ATCTTCTTTGGTCGCGTATTTCCTTTGAACATGTTTGCTGCCATTCATGATTGCACCGCT +ACACTGCCAAGCAATTCCTCAGAAGTTCCAAACACACCCAACACAGGTTAG +>NODE_5_length_344_cov_3.273356 +CTAACCTGTGTTGGGTGTGTTTGGGCTGGGGGCGACCAACAAAACGGTTATTTCCTCTCA +CAATGTTGCTTGAGTTTGTTGTGATGTGTGATTGATTTTGCGCTCATTCATGGACATGTT +CTCCTATTTCTAATTAAGATTATCTCATGTAGTTTCCAGTCGTTATGAATCTCTTGTGGT +ATACTAACGGTCTTTGTATCATTTTTAATAGTTCACTTATGTTTTGATTTAACTCAAATT +CATTTATGTCATATTTTAGCTGAGTTGCATGTTTGCAACTCAGTACATCGTACCATGATC +TTAAATCTAGCTCCGTACCCAAACACACCCAACACAGGTTAGAC +>NODE_6_length_338_cov_1.314488 +GTCTAACCTGTGTTGGGTGTGTTTGGGTATCCTTGAGGCTCTCGGATTCCGTGTCACGAA +CAAGTACTTCATCAAAGTTCTTGGCGATGACGTAATCTTCGGAATTTTAAAGCACATACC +CATTTCGAAATGGGCTGACTTTTTGCAAGACTTCTCTACTGAAGCTAAGCGCCGATTCAA +CGCTAAACTGAACCCCAATAAATGTGGCGCATCTGCAGGAATTCACGGTGCCCAAGTACT +AAGCTACTTCAACTGGAACGGATTTCCCAAGCGCGAAACCACCCAATTGTTAGCACAACT +ACTACACCGTACCCAAACACACCCAACACAGGTTAGAC +>NODE_7_length_335_cov_1.714286 +GTCTAACCCGTGTTGGGTGTGTTTGGTGCCATCATGATTGCACCGCTACACTGCCAAGCA +ATTCCTCCAGAATTCCAGTACTTCAAGACCTGTTCGCCCGCGTCCTGTATTCGATTACTG +CTCCCGCTTTTACCTGCCTGATCCCCGATTTACTCGGTGCCTCCATTGATCAGACAACTA +CTACGCATGTTAACTATATCAACTCCAAGTTGTTCCAAATATTTAACGCTGTTTTCAACC +CAGTCCTGTTTCGTGACTATCAACGCCGCTCGTCTCTTGCTGCTCTGTCACTACAGCCTC +CCGCCAATCCCAAACACACCCAACACAGGTTAGAC +>NODE_8_length_331_cov_0.862319 +GTCTAACCTGTGTTGGGTGTGTTTGGGATTGGAGTGAAGAAAAATTAGAGATGAGAAATG +ATAATAACGAAGAATGTGGCCCTTTCGTAGGAGCAGTAACCCCACCACGTGAGGAAGATT +TAACGAACGCGAGTGGTAATATTCCTGTAGTGCCAAGACAAACGATCAGGAAGCTCTCTC +AGAAGGAAATAGACGAAGGTCGTGACTTAGATGTTGACATGCCGCCATTGGAAGATGTCA +CGGAATTGGATGAGCCAACCAATGAATTAACCAACAGATTCCCACAAGAACTGCACACTG +AAGAGTATGCACCAGAAATAGAAGTGGAAAG +>NODE_9_length_324_cov_2.141264 +GTCTAACCTGTGTTGGGTGTGTTTGGGGCCCCCTTTTTAAACCCCAGGGTGACTTTCAGT +CACCCTGAACTATCTTTCTTCCCAATGTAACAATTTGTGTGCGAACACCTCATTGTCTCG +CATCATTTTTACCAAAGATTTGACATGTTGGTCTGCTGAACCCATTGGCATTCCATGCTT +CATTTCACTGGCCCTGAAACAACTACTCACATCATACCACAATGTGGGCTCCACAACCCA +TTGTTTATCACGTATTAAATCCATCACTGGCTGAATCTTTCCTAGCATCATGCAGTAACT +CATGCACCTGGCTTCCAAATTTTG +>NODE_10_length_324_cov_1.371747 +GTCTAACCTGTGTTGGGTGTGTTTGGTTCGCAGTTGGGCTGTTACTCTAGCTGCAGGATC +AGACTTTTGATCCTCCATTTGTTTCATGCTGTCGGTCTGCAACTTTAAGTATTCGTAGTA +TTTTGATTTGGGCCCTTTCGCTGGTGGCTTTTTATTTATCAAACTTTTATTGTTTGTGAT +TACCACCAGCTTTCTGTACTCTTCCACGTAACCTATGTCAGCCCACTCTAAATCATTGAT +TGTAGATAACCACCATTTGTCAAAAACCTCGTTAAAACCGCCCATGTTTTCCTTTCCATA +ACCAAACACACCCAACACAGGTTA +>NODE_11_length_317_cov_1.125954 +CTAACCTGTGTTGGGTGTGTTTGGTGTCCTATTTCAACATTTTGTTGTTTCGCATCAAGG +CCATCAAGACTGGTTTGGCTGGTAATCCGTCTAATCCACATAATTTGCAGTGGGCGGCCA +AGCAATCCCATACGCAGTCATTAACGCCTAAAGCTTCGTGAATTGTATCAAACTCCACAT +CTGAAACTTTGTACGTCATGTGATTCTCTAATTTTATTTCCTTTAACCAGTTTGGTCTGT +CCATGGACCAGGATATTAATGTGGTAGCGCTGCTAGAGTCTACACCCATCGCCAAACACA +CCCAACACAGGTTAGAC +>NODE_12_length_311_cov_1.535156 +GTCTAACCTGTGTTGGGTGTGTTTGGACCTACATCGTTACTATGACAATACCCGTTATAA +CCCTAGTAATGAGCTTAAATCCCTTGCCCTTAACAAGGAATACTCAATGTTAGTCCAAGC +TTATCTTAATACTAATAAAGTGAAACACCAGCCTTATGAGCTTCACTGCCCTATCCCTGC +TGATGCTGCCACTATCCCACCTTCAAGAGTCCCCGCTCCTGGAATAAAATTAGTTCCTCT +CATGTACCATTATGGCCATGTAATTCGCGCTCACCCACTCAACTTCCAAACACACCCAAC +ACAGGTTAGAC +>NODE_13_length_295_cov_0.945833 +TGTGTTGGGTGTGTTTGGTTTCCGGTTACCATAATCGCTATTCTTTCAAACAGAAAGCGC +ATGCTAAGTATTCTCACCCAGAGGAATATGCTGACAAGCCCTCCTCAAAAGGCTATTTTT +ACAATGCCACCTATGAGAATGCACGAACTCTTATTCACTTCATTAAGCAATATGGATTGC +CCTTCAATCCTGTTATTGCACCAGAAGATGCTGAACTAACTGATGAACAGATTCAATCTT +ACATCAACACAGCAAACTCCTTCTTTAATGATTATCCGACGTTACTGTTCACCCG +>NODE_14_length_294_cov_1.891213 +GTCTAACCTGTGTTGGGTGTGTTTGGTCGTCTCCCGTACTGAAGATTAGCGGTGCAAGTT +ACACCCTTCAGATATAGTGGCCACATGACGTAGCCTTACCCCTGTTTCACTTTGTGGGAT +CACAATTACAACTACCGTCTTTCTTATAGTAGCTGCTACACCCATTACAATACTCGTCTT +GTTCAAGATGAAATCCGAGATCGTTTTTAGCAATCTGTTCAGTCTTTCCTAGTCCATTTT +CAACCCCTTCAATGTGCACTCCAAGAACCCAAACACACCCAACACAGGTTAGAC +>NODE_15_length_280_cov_1.413333 +GTCTAACCTGTGTTGGGTGTGTTTGGGGTCTGCGGATCACTCGGGAATGATTTGAAGTGG +TTTTGCTTCCTGGGAGACGATGGTATATTAATTAGTGACCGAGATTTGGGAATGGCAGAA +CTCAAAAAATACGGAAAAGCTTATTGCAACATGATACTGAAACCCAAGAGTAGTACCAGC +AGTGCAACATTTTGCTGTTTTACAGTGTACAGAAACCAACTAGGACAAGCCAGGTTGGGA +GCTGATCCCATCAGCCAAACACACCCAACACAGGTTAGAC +>NODE_16_length_278_cov_0.901345 +GTCTAACCTGTGTTGGGTGTGTTTGGGCTGTAATCGAGGTATAGTGTCGAACAAGTCGGT +GTCACTGTTGAATTCTATGGCGGCGAACTCAATGGAGTCAGTTATAGTGATCCTGCTACT +GTGAAAAAATATGCTAGACGTGCTCAATTGGGTGAAATTTTTGAATTAGATCGTGCTACT +TTAAAATCGGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGGACATGCG +TCGTTTGCTCTGCTCTTCTTCCAAACACACCCAACACA +>NODE_17_length_277_cov_1.540541 +GTCTAACCTGTGTTGGGTGTGTTTGGTGATTGATAGTTATTGTAGGCGAAACTACTTATG +TAACTGATCCAGTTTTGGCAATCAACAACAATTTCCAACTACTAACAGTGGAAAAGTTGC +AGGATTTGACATTTGAGGTTAGGATGAACACTCTACCATTCTGGATGATGCGTCCAGATC +GTGGAGAGTTGATGAAGCAGCCAATGGGAGCCAGAGAAGCACTCAATTTCACAATGGATT +GCCACAAAGCCCCCCAAACACACCCAACACAGGTTAG +>NODE_18_length_274_cov_3.872146 +CTAACCTGTGTTGGGTGTGTTTGGCATTAGGTTGTAGCGTTTTGATGTTGATTTTATCGG +GTCCCGGGCTCGCTCTGGAATGAACTTTGATTCTAGTCGTTGGCCCATAGTATGACACCC +ACTCTCTTAGGTCTGTTTCCTCCCAAAGATCCATTATTCTAGCGTTGAGTTCACCAAATC +TCAGGTTATTTGAACTTTCTTCTAATTCCCTCATGTTTACACCCAAATCACCACCTACTG +ATACTCTACCAAACACACCCAACACAGGTTAGAC +>NODE_19_length_271_cov_0.879630 +GTCTAACCTGTGTTGGGTGTGTTTGGTATGGAGGGAGGTGTATATGATACCTGGGCACCC +GGAGGGGGAGATGTAAGAAAAATTACCAACTTGACCCTTAACCCAAGCGTGATATTTGGT +TATTTACTAAAATCTCCTTTTGGGGGAGAAGGATGGATTGTTAGTGTGGACGATTTAGAA +GATATAATTGGAGGACATGTCTGGTTAGGCTCCATTTGTATACTTGGTGGAATTTGGCAT +ATCTTAACCAAACACACCCAACACAGGTTAG +>NODE_20_length_267_cov_1.429245 +CTGTGTTGGGTGTGTTTGGACTTGGTATGTGAAGATACGTTGTTAGGTGCTCCGTTTTAT +TTTCCCATTGAGGCCGAACCTAAACCTGTGCTCGAGAGATAGCTGTCCATATACTGATAA +GGGATGTATGGATTCTCGAGAAGAGAGGAGCCATGGTGGTCCCTCCCGGACCGCCCGGAT +CCCACGAGTGAATAGAAAGTTGGATCTACATTGGATCTCACCTGAATCGCCCCATAAACA +ACCAAACACACCCAACACAGGTTAGAC +>NODE_21_length_263_cov_1.177885 +GTCTAACCTGTGTTGGGTGTGTTTGGAGTGGGGGTATATTTAGACAATGAGATAGTAATG +GTAATACAGCCATGCTATAACGCTGCCAACGACAGGGAGATACATTATGATCCAGATTAC +CAAGAAGAACTAAGCTTACTTCTAAGACACTTAAATCTGATGAACGTGCTACAGCATTTT +GATACGATTTTTTAACAGAAATCTATTTCAGAAAGTCAGAATTAGCCACACCCAACACCA +AACACACCCAACACAGGTTAGAC +>NODE_22_length_262_cov_1.053140 +GTCTAACCTGTGTTGGGTGTGTTTGGCTAGTCAGTAGCTTGTTATATGGGTCGTGAGTGG +GAAGTTAGCTTCCGTCTGGGTATGCGCCCGTGGATTGCTGTTGCATATTCAGCTCCTGTT +GCAGCTGCTACTGCTGTTTTCTTGATTTACCCAATTGGTCAAGGAAGTTTTTCTGATGGT +ATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGAGAGCACCCAA +ACACACCCAACACAGGTTAGAC +>NODE_23_length_260_cov_1.590244 +GTCTAACCTGTGTTGGGTGTGTTTGGGTTACCGTTGCTGTTCGGTGCTGGTTTGCTGGTG +GATTGCTCTGACTCTTCTTGATCCGCGTGACCATAGAATAAGTTCTGAGCTTCCTCGGCT +TGGGTTTTACCTGTTTCCACACCATTCTGGTTTAATTTGTCCTCTGAAGTTTCAATTAGT +GGTATGTCGGTGTATAATTTAGCCAATTTCTTTAGCTCATGGGCCATCCTGCTTCCAAAC +ACACCCAACACAGGTTAGAC +>NODE_24_length_258_cov_0.935961 +GTGTTGGGTGTGTTTGGTTGGTGAACGCGCACCATTTAGTGGCAATCACGCGCGGGGAGG +CTGAAAACTGCAAGCATAGATCTTTCGGCCCTTTCGAAGCTACCGCTTCCGAGAGCCTGG +CTAAACTCTGCCCAGATTATCCGATCTGCTTGCCTGTACCTTACGACGTGATCAATAAAG +TGTATAGGTATCTCAGAACGCTTAAGAAGCCTGATGTGCAGTCGCCCCACTACCAAACAC +ACCCAACACAGGTTAGAC +>NODE_25_length_256_cov_0.945274 +GTGTTGGGTGTGTTTGGCTGAAAAGCTTGGCGGACCTACTCCACCTAGATCCGTGACCAC +CCTGATCAGATTGAACGATGGCGATGTCCAAACTTACACCAATCTCAACGTAATAACAAG +GGATTTTGTAATGACTAGAACAAATTTGGTGGGTTGCAATACCGTGGCTAACGAGTCCGC +TACAAAGTTGTTGATTTATGATTATGATGGTAGGGCACATCACAATTCCTCCAAACACAC +CCAACACAGGTTAGAC +>NODE_26_length_256_cov_0.895522 +GGTGCGCTCAATGTGGCACGTGCAACTTTATTTGGTTGCCCCACCATGAGGACAAGCTGA +GCAACCAGCATTGTGGCATGTGCTTCTTTTCACTGGATTTGAAGCACATGGAAAATGATT +GGTTCATTCCGGACATCATGGTCGAGGACATTAACCAATTGCACGTAGGGGCACTGCAAA +AAGATATGTCGGAACTAATGAACCAACTGGATGGCGCAGAGGCTCACATACCAAACACAC +CCAACACAGGTTAGAC +>NODE_27_length_254_cov_0.793970 +CCTGTGTGGGGCCAACTGTCTGGAAATGATTCTAGGAAAGGTGGATTTGCCTTTCTTACG +GCGTATAGCCAGCAGAGATAACATGTTCTCCAGCCAACATCTGGTGGATTATTTACATAT +GCATGATCGAAATGCCGTGATTTTGATGAATGACGTTGCTGTGGCTCGAAGAATAAGAGA +TGATTCCAATGCTTATTGCCGCATAGCGCATAGCAGCTACTTAGGCACCCAAACACACCC +AACACAGGATAGAC +>NODE_28_length_253_cov_1.313131 +GATCAACAGATCTTTTGAAATTAGAGGTAACTTTATTTGAAGGCAACTTAACAATTAAAG +GTGATAACATCCAAGATCTGTTCAAATTAACCAAAATAGGTGGATCAAAATGGTTAACCA +ACGATTCAACATTACTAGAGCATGATCCAAGGTGTGGCAGATTTTGCGTCAAAGTACAGG +AATCTACAGAGTCACTCGTAGAAGAATTCTTAACGTCTTCATCCAAACCAAACACACCCA +ACACAGGTTAGAC +>NODE_29_length_250_cov_0.851282 +GTCTAACCTGTGTTGGGTGTGTTTGGGTTTCTTTGGAGCAACTCGATGAATTTAGTAAAT +CCTTTTAGGAGGTTCCCAATGACCATAGATCGAACCTATCCAATTTTTACAGTGCGATGG +TTGGCTGTTCACGGACTGGCTGTACCTACTGTTTCTTTTTTAGGGTCAATATCAGCAATG +CAGTTCATCCAACGATAAACCTAATTCAAATTATAGAGCTAGCACACCAAACACACCCAA +CACAGGTTAG +>NODE_30_length_249_cov_1.298969 +GTGTTGGGTGTGTTTGGTTGATTTCTGACAAAATCACTTGCAAAAAGAAGCTTGCTTGGT +TCTGTCTGCCCTAGAGATAACCGACTGCCAAACATTTGACTATGTTGATGCAGTGATGCC +TGCGGGACTGGCCGAGCAGTGGTTACATGACACCATCCGGTTGCCAGGGTACGAGCTAGG +GATGTTATTGGAACGAATTAGCATAGTTCCAGCTGCAATAGCCCCAAACACACCCAACAC +AGGTTAGAC +>NODE_31_length_249_cov_0.979381 +GTCTAACCTGTGTTGGGTGTGTTTGGCGAGTTGTGAGAGTGGAAAGCATGCAGTTTATGT +CTTCTACAGCTTTGAATGAGAAATTCAAGCAGCTGATTGCAGAAGAAGGTATTGAAGGGA +TGGAAGCGATGAATTCTGAATCAGTGGAACAGTTATTGGTGAATATAAGGGCCCATCCAG +CCAGTTACCCTGAGGCAGCAGAGTTAACAAACATGCACAATTCACACAATAGTTTATGTT +TGTGCGGGG +>NODE_32_length_248_cov_0.979275 +GTCTAACCTGTGTTGGGTGTGTTTGGATATCGCTGTGCTTGTGATTGCTGACACTAGGGC +GTCTGCTCTCCTATCTACGGGTAAGCTGTTATCTTCATAACCGCGCAACCTATATATTAT +CTCGTGTGTATTCTTTGCATTAAATATAGACAGGTACTCTCCCCAATACCAACTAGTGTT +AAACATGAAAGACTCAAGAGCTATTTGGTCACTCACTGTTTGTAGCTCAGCAACCACCAA +ACACACCC +>NODE_33_length_245_cov_1.000000 +TGTGTTGGGTGTGTTTGGGGCCTTGAGGAGTCATGGTTAGACGATTGGTAAATCATCCAT +TCTCTTTTAACGCGAATCATACGTTCAGCAAGATAATTGCGGACGGCGTTGAACGGCATG +GTGAGACGTTTTGGGTGAAAATTAAAACGAAGATTAATTTTCAAAATAATTTAGACGAAT +GTGAATTCTAAATTTTAAAGCAAAAGGGGGGCCTTCCACCCAAACACACCCAACACAGGT +TAGAC +>NODE_34_length_245_cov_1.000000 +GTCTAACCTGTGTTGGGTGTGTTTGGATGGTGATCGGCAATTTAAAGGAATGTGTGCGAT +ATTTTCACCAATATTCAAGGAGCTTAAAAATCGACTAAAAAGCGTGTTAGATATTAAATA +CATGTATGCAGACGGATTGAGACCTGATCAGTTGTCGGAGCGCATGTCACAGATAGGTGC +AGGTAAATATTTTATAGAGAATGATATGGAACAGCATCTCGCCAAACACACCCAACACAG +GTTAG +>NODE_35_length_242_cov_0.818182 +GTCTAACCTGTGTTGGGTGTGTTTGGGTGGGTAATGAAGTGTACATAATACCAGGTTGGT +CCGACAGACCAAGCGTAACAGAAGTTTTAGACTACAAAGCTTGGACCAGAGCATATTATA +TGATAAGCGATGGTTACATCTGTTGTATAGAACCACTGAGAATGGTTGACGACTTAGTGC +TGAAGAAAATGACCTTAATAGGTAGGCAACCACAAGCCAAACACACCCAACACACCGTTG +AC +>NODE_36_length_240_cov_1.259459 +TCCGAATCAGTGTATTGGACACGGGCTATATCGGGATCGCGGTCGGACGATTGGTAAATC +GACCATTCTCGTTTGACACGAATTAAGCGTTCAGCTAAATAATTTCGTACAGCGTTGAAG +GGCATCGTAGGACGTTGGGTGAAAATTACAAATTGGGAGTTTGGATTTTCGAGAGAATTA +GACGAATGTAAATTCTTGAATTAAAAAGGGGGGGGCGTCATCCCAAACACACCCAACACA +>NODE_37_length_239_cov_1.032609 +TGTGTTGGGTGTGTTTGGCTTGGAGGGAAGGTACAACATTGGTGTCCCTCCTGCGGACAC +TAACGTTCCTGCGGTGGTTTCTAACCCCAGGTGTAACTTTCTCCAATCAGTCAACTCTTG +AATAAAAGGGGCATAAGTGAGTGCTCCAGATATGAAGTCCAGGAGGCCTTGTTTCTCACC +CTTGACGTTGTAACCATTACTATACTCCCGCACCCAAACACACCCAACACAGGTTAGAC +>NODE_38_length_239_cov_1.032609 +TTCATAATGTGGCAATATGCACATCTACGATGCCCTATACATTCTGCGTCAACACACACT +ATTGTTAATTTCTTATCCACCATAGTAATATGGGGCACTCTGGTCCAATTTGTTTTCAAC +ATCGCATATTGCATATCTTTTATGGTGCGTCCGAATTTTTTGATGATTTGCTGGATGGCC +ATGTCTAGCAATTCAGGCAAACCTCCTTCCTCTACAGTCACCCAAACACACCCAACACA +>NODE_39_length_238_cov_1.038251 +GTTGGGTGTGTTTGGGGGGCTTACGAGAAGAGAATGTGGCCAGATTGGCAGAAATAGAGA +GAAAGAAGCTAGAAGATTTAAGGTTGGCTGAGATGGAAAGAATTGTGATAAAGGTGAGTG +CTACAGTTCAGGGAAAGGAAATGGCATTTGCTAACAAAGGTGGGAATCCGATTTTTTTGA +TAAGTGGAGTTGTAATTGATCCAGTGATCAAGCCAAACACACCCAACACAGGTTAGAC +>NODE_40_length_238_cov_0.879781 +CCGTGTAAGATGCGCTGAAGGTTCAAGCTCCTGCACATTGCATGGTGCCGAATTGTTTGA +AATGCCTTTGGGTTTCCAGGGGAGCCACAAGCATTCAGTGCGCGGTTGTACGGCGGGACG +TTGCAGTGCCACTTTCAGGTGTTTGAAACGAGAATTAGAACCGCTTGATGAGCCCGAAGT +GGTCCATGTGGAGGGCTGTACCGGATCTAGTGAAGAATCAGGCGGTGATGGGCAGGTT +>NODE_41_length_236_cov_1.049724 +GTCTAACCTGTGTTGGGTGTGTTTGGACAAGGTGATTTGAGATACATAAGCAGAAAAACC +ATCGCCAATCTATCTCGAGAAGATATTGAGATTGTGGAAGAACATGAAATAAGTGGTGAG +GATCTCCTGTGTGGGGCCAACTGTCTGGAAATGATTCTAGGAAAGGTGGATTTGCCTTTG +TTACGGCGTATAGCCAGCAGAGATAACATGTTTCTCCAGCCAAACACACCCAACAC +>NODE_42_length_235_cov_1.855556 +TGTGTTGGGTGTGTTTGGGGATTGCTGTGGTGTGCATGTCCTCCAATGTGATTACGATCT +TTTTGACCAATAATATGGTCAACTGCAATTGATTTTCACTAATTTGCTCTATTTGTTTGT +GTTTCACTTTTGTGCTTATCAACCTGTGCAGATCATGTATCGTCATCTCTTGTATACTGA +AACATTTGTTTTGATCTCCCTTCATCCCCCCAAACACACCCAACACAGGTTAGAC +>NODE_43_length_234_cov_1.061453 +TGTGTTGGGTGTGTTTGGTTGAGTATTGGGTTATGGTGGAGTTTTTAACTGGTTTCATGT +CATGATTTTGACTCCAAAAATTTACTAGAATTGGGTAGGTATCCCAAAGAGAAGAAGTAG +TACTAATTCCTTGATTTTGTATGGGAAAATTTTCATATGTAATTCATCTACAAAGATAAG +ACATTAATGATGAACCAAACCAAGCGGCCAAACACACCCAACACAGGTTAGACC +>NODE_44_length_232_cov_1.073446 +TGTGTTGGGTGTGTTTGGAAGTAGTGGAGGGGAAAGCGCCTAATGAGGCAATGATAATAG +ACGACGCAACACGCCCCGGGTCGGTAAACAGGTGGGCAGCTGCCGAATGTCTCAAAGTAG +ATATACCCGATGTGCATTACAATGACTGCTACGTCATGTATAATAACACGGGAATAGAAA +GGGATGACCACAGAGCCGTCAACGTGCCAAACACACCCAACACAGGTTAGAC +>NODE_45_length_232_cov_1.073446 +TGTGTTGGGTGTGTTTGGGAGTCGTCGGGGTTCAATATTACATTTACTACACCTTATACC +TAATGCTAGGCGTCATAGATGATGTCAGAGCGAGTGATAAGGGATCAAGCCTCGACTATT +GTTGTTGTTGTCTATGGACAGACGGGACCACGTGTTCCGTTTTGTGATGTAGACTTCACG +CTTATCTCTAATCGAGCCATCAACCTCCAAACACACCCAACACAGGTTAGAC +>NODE_46_length_229_cov_1.091954 +TGTGTTGGGTGTGTTTGGTTGGATGCCTGGAATACAATCATGAAATTGAAAGTACCAGAT +ATTCCTAAAGGCATGCCATCTGAAAAACTTCCTTGACCAATAGGGTAGATCAAGAAAACA +GCTGTAGCAGCCGCGACAGGAGCTGAATATGCAACAGCAATCCAAGGACGCATACCCAGA +CGGAAACTAAGCTCCCTCTCGCTCCAAACACACCCAACACAGGTTAGAC +>NODE_47_length_229_cov_0.816092 +TTGGTAAATTGGCGGAAAGAGGAGGACTCAATGATTATTCGTTCGCCGGAACCAGAAGTA +AAAATTTTGGTAGATAGGGATCACATAAAAACTTCTTTCGAGGAATGGGCCAGGCCGGGT +CATTTCTCAAGAACACTAGCTAAAGGCCCTGACACTACCACTTGGATCTGGAACCTACAT +GCTGATGCTCACGATCTTAATAGCCAAACACACCCAACACAGGTTAGAC +>NODE_48_length_227_cov_1.273256 +GTCTAACCTGTGTTGGGTGTGTTTGGGAGACAGGAGTGTCAAAATTGATCAATTCAATCA +AAAATTTGCCAAATCTTGAGGTGGTTAGATTAAGGCCAACTCGTAGATTAATCAAAGTGC +AGCGTGATGGACCAACCGCCACCAGCAAAGCATCGAGAGATGACGTGCCGCCAACTCATG +ACACGATGCACAACACAGGATCCGTGGCAACCAAACACACCCAACAC +>NODE_49_length_227_cov_1.017442 +CTATCATGTGTAAGTAAGACATGCCTCCTGCCATTACTGGATTTGGCATTCCCATACTCA +CGCCTATATCTGATAATTTTTCTTGTAAATTGTTACATTGCCTCATGTCGTGAATTTTGA +CAAATTTAAGTTTTTCCATGGTCTTTAGCTCATCACTTACATAACTTGACACAGCTATAT +AACTCCTGTTAGCATGTCCTCTCATCCATTGACTTAATTCATCTTTT +>NODE_50_length_226_cov_2.269006 +GTCAACGGTGTGTTGGGTGTGTTTGGGAAAGGTCCTGGAATATGGGTGTCCGATCCTTAT +GGACTAACCGGAACAGTGCAACCTGTAAATCCGGCGTGGGGCGTGGAAGGTTTTGATCCT +TTTGTCCCGGGAGGAATAGCTTCTCATCATATTGCAGCAGGTACATTGGGCATATTAGCG +GGCCTATTCCATCTTAGCGTACGGTCACCCCAGCCAAACACACCCA +>NODE_51_length_225_cov_1.117647 +GTCTAACCTGTGTTGGGTGTGTTTGGTCGATCTGGCCGTTGTTAAGTATTTGCTCACGAT +GTGCTTCAACCTTTGCTCGCCAAATTCTATAACATAAGTGGGTTGTCCATACTGTATCGT +CAATCTTTTGACTTTGTTCCTTTCCATTATTTCTTGCGCTAATTCATTTGAAAAACTAAA +CCCAACGGCCACCCATTTGCTTCGACCAAACACACCCAACACAGG +>NODE_52_length_225_cov_0.917647 +GTCTAACCTGTGTTGGGTGTGTTTGGTTCCCTAGTGAGGCTGGTTTTCCCATGGTGTGAG +AATAGCCGCTATTAACTTGATTACGCATCTCTGGTTCAACCCATTCCCCGCTAACATTCA +CTTGGTCATGCGCGTAAGGACTATCGCTCGCGCTGAAACTTGGACCAGGTTGACCATCGT +CTTCAATCTCATCACACTACCAAACACACCCAACACAGGTTAGAC +>NODE_53_length_223_cov_3.303571 +TCTAACCTGTGTTGGGTGTGTTTGGTTCTCATGTCAATTTGTAATGTGTGGGCTCATCCC +TTATTGGTATGTCATGGGTTTTCCACTTGGCACTGCTGGTCGGCAAATCTTTCCAAATCT +CGCCACATATTTGTATATCTTGATCTTGCATGAATCTGCGCCCAAAGTAGTTAGGGATAC +TTTGAGTTTTGAGCCGCATGCTATTAGCAATCATGGTTATTTC +>NODE_54_length_223_cov_1.803571 +GTCTAACCTGTGTTGGGTGTGTTTGGTCGATTAATGGGAGTTCAACCAAATTCATAACTG +TCTCGATGTCATCCTTTCCTTCCTTTTTATTTTGATTGTCTAAATATTCAGCTAAGACCA +TTCCAACGCCCCCTTTCGCCATGCATAAACTGAACCCACAATTGGGATAAGCACGAAAAT +GAAAGCCTCACGTTCACCCAAACACACCCAACACAGGTTAGAC +>NODE_55_length_216_cov_1.596273 +GTTTTACCATCACTCTGTTACCTTGTCTTGTTATGAATAAATTTGTTTTAGGTTTACTGT +TAACTAATACACTATACCCGAACGTGGAAATAAACAACTTGATGCAATTGTATAACAAAG +TTCCTCCTAACCTTTCGTCAGATCCCTCTTTGTATCTATTGGAACTCATTTTGAGGCTGT +CTGCTATTATTCTCACCTCCCAAACACACCCAACAC +>NODE_56_length_216_cov_1.180124 +GTGTTGGGTGTGTTTGGGGTCTATGTGGTTTATTTGGTTCTACTGAACCAACATTAAATT +TTGAAATATTAACTAATCAGTCCTATCCTGTGGCCTTGGAAATAATATTTTATATTGGAT +TTTTTCTTGCTTTTGCTGTAAAATTACCAATCATACCCCTACATACATGGTTACCAGATA +CCCACGAGAGCCAAACACACCCAACACAGGTTAGAC +>NODE_57_length_216_cov_0.869565 +GTCTAACCTGTGTTGGGTGTGTTTGGATAGTTAGCGAGGTAGGTACTGAGCTGTTTACAT +AGGGGGGGAGTTCGTGTGTTTAGCTTAGGTTTCTGCTAGTCTTGTTTTGATAAATATGAA +TATAGTATTAGATACTCTTGTGAAGTATAAATTTGTAAGATTGAGTAGTAGTTTGACTAA +GCCCATGATCGTGCCAAACACACCCAACACAGGTTA +>NODE_58_length_215_cov_1.668750 +GTCTAACCTGTGTTGGGTGTGTTTGGGCACTGGGGTTCAATTTAAAGTTCATTGTGCACA +TAGACCGCAAGCTGCCTCCAAATTTTTGTTTGATCAAGTCCATCATAAATTTGAGTGCCA +CTGGATCTCGCGTTCCGTCTTCTTTCACTGCAGGTATCACTTCTGGCCTCATGGTCGTCC +AATACGCCCTTGCTGCCCAAACACACCCAACACAG +>NODE_59_length_215_cov_1.187500 +GTCTAACCTGTGTTGGGTGTGTTTGGGGGTGGTAGGACGGTAGGGGTCGCTAGGTCAGGA +ACATCATCTTCAAAGTCATTGAAAAATTGGCGTTGAAAATAAAGGCTAGCGCGGGGGTCA +GGCTTATAATCATCTCTGAAGATGTTGTAAACACCTTGGCAAAATGAGTGAAAGTATAAA +TCTTGGCCGGCGGATGCATAGGCAATTCCGACAGC +>NODE_60_length_215_cov_0.843750 +AAAGATCGAATTTTTAGTGGAGATGGCCACAACATGTACCAAGGGTCAACTGACACCCAC +TTGCATATAAACCAATTTTCTGGTAACTTTTTATTAATCAATGCCACATATTTCTTATTC +TGGCTGTTGATTTCATTCGGCCCAATCAGCACTTCATATATTCTTCCAATGGACAAGCGT +GACTACTTACCCAAACACACCCAACACAGGTTAGA +>NODE_61_length_214_cov_1.232704 +GTCTAACCTGTGTTGGGTGTGTTTGGTTGTAAGGATGCTTGATGCGCATGAGCAAGTGTT +CTCGTCTGCTCTATATAATGTCCTGTCTGCCATTACTCATCGTGGGAGGCATAATCATGA +AACAGGTTTTCGTAACACAACGGTTCGTGCCTCTTCGGACTGGGCTATGATGTGGGAGGA +GGTCCACGCTGCGTATCCAAACACACCCAACACA +>NODE_62_length_213_cov_0.936709 +GTCTAACCTGTGTTGGGTGTGTTTGGATCGAGTTGGGTTATGTTCATCAGGGACCATCCG +GCAACAAAGTATCTCAAGCCCCTGCGTGGACTCAGAAAGCATACGGCATTGCACTGCATC +AGTGATGAAGTAAGACCGAGGATCAGGTGCCTCCTGGGAGCATTAAACCCCCACCGCCGA +TGACCATCCAAACACACCCAACACAGGTTAGAC +>NODE_63_length_210_cov_1.225806 +TGTGTTGGGTGTGTTTGGCTTTCTGGCTCCATAGGTTTTAACCACTACTCTGTCAGTTGG +ACCAACATTTTTGAGCAACCTTTCGGTTTTCCCGCTACCAGCAGGTCCTACAATGGCTTT +CATTTGGGCAATCAATCTTTTCATAGTGTCCCATGATGCTATTCCCCTGTTCACCGCTCT +TAGGCCAAACACACCCAACACAGGTTAGAC +>NODE_64_length_208_cov_1.019608 +GTCTAACCTGTGTTGGGTGTGTTTGGTATGTTATTGCTCCTGATGTGCAAGGATACCCCC +TTGATCCTCGTCTCTACAACATGATCACTACGAGGTACCCAGATTACCTGCCCATCATTA +ACCTCTACTGCCGACCACTCGGAACCACCGAAGCTACCTTCGCTGATTTCAACAAAGAGC +AGATTCCCTCTGATCCCATCTCAGATGA diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_contigs.txt --- a/test-data/blast2tsv_contigs.txt Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_contigs.txt Wed Aug 21 13:13:28 2024 +0000 @@ -1,1 +1,6 @@ -1 Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Martellivirales Bromoviridae Ilarvirus Blackberry chlorotic ringspot virus +1 Viruses Monodnaviria Shotokuvirae Cossaviricota Papovaviricetes Zurhausenvirales Papillomaviridae Firstpapillomavirinae Upsilonpapillomavirus Upsilonpapillomavirus 2 +1 cellular organisms Bacteria Thermodesulfobacteriota Desulfovibrionia Desulfovibrionales Desulfovibrionaceae Desulfovibrio unclassified Desulfovibrio +2 cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota Neoptera Polyneoptera Dictyoptera Blattodea Blattoidea Termitoidae Rhinotermitidae Heterotermitinae Heterotermes unclassified Heterotermes +1 cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Nemertea Enopla Hoplonemertea Monostilifera Eumonostilifera Tetrastemmatidae Tetrastemma +1 cellular organisms Archaea environmental samples +1 cellular organisms Bacteria Terrabacteria group Actinomycetota Actinomycetes Mycobacteriales Nocardiaceae Nocardia unclassified Nocardia diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_input.xml --- a/test-data/blast2tsv_input.xml Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_input.xml Wed Aug 21 13:13:28 2024 +0000 @@ -1,593 +1,1665 @@ - tblastx - TBLASTX 2.10.1+ + rpstblastn + RPSTBLASTN 2.14.1+ Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. - /save/tcandresse/refseq/refseq.short.fa - ds2020-482-EDGG-1-Q4_42600 - No definition line - 96 + /data/db/databases/blast/2018-01-22/pfam/Pfam + Query_1 + NODE_1_length_506_cov_10.687361 + 506 BLOSUM62 - 0.001 + 0.0001 11 1 - L; + F 1 - ds2020-482-EDGG-1-Q4_42600 - No definition line - 96 - - - 1 - ref|NC_035070.1| - Spinach amalgavirus 1 isolate SRP059420 fusion protein and putative coat protein genes, complete cds - NC_035070 - 3420 - - - 1 - 51.4703 - 106 - 6.20873e-08 - 3 - 95 - 1338 - 1430 - 3 - 3 - 20 - 24 - 0 - 31 - GGGTLRTWAADRKMYRGGGSSFDALLLLCQA - GGGAMRSWEVDSQMYRGGGNSADALRLLGQA - GGG +R+W D +MYRGGG+S DAL LL QA - - - - - - - 7073 - 36804204 - 24 - 96786528 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 - - - - - 2 - ds2020-482-EDGG-1-Q4_60894 - No definition line - 82 + Query_1 + NODE_1_length_506_cov_10.687361 + 506 - 7073 - 36804204 - 19 - 97069448 - 0.139224951877679 - 0.315124495232289 - 0.441609275168242 + 16305 + 2821655 + 80 + 133518440 + 0.083353464 + 0.267 + 0.14 + + + No hits found + + + 2 + Query_2 + NODE_2_length_429_cov_3.631016 + 429 + + + + + 16305 + 2821655 + 78 + 100741225 + 0.041 + 0.267 + 0.14 No hits found 3 - ds2020-482-EDGG-1-Q4_64647 - No definition line - 80 + Query_3 + NODE_3_length_365_cov_1.074194 + 365 - 7073 - 36804204 - 18 - 97126032 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 75 + 73543880 + 0.041 + 0.267 + 0.14 No hits found 4 - ds2020-482-EDGG-1-Q4_97438 - No definition line - 64 + Query_4 + NODE_4_length_351_cov_1.547297 + 351 - 7073 - 36804204 - 13 - 97408952 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 74 + 69448655 + 0.041 + 0.267 + 0.14 No hits found 5 - ds2020-482-EDGG-1-Q4_104226 - No definition line - 61 + Query_5 + NODE_5_length_344_cov_3.273356 + 344 - 7073 - 36804204 - 12 - 97465536 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 72 + 69203190 + 0.041 + 0.267 + 0.14 No hits found 6 - ds2020-482-EDGG-1-Q4_60048 - No definition line - 83 + Query_6 + NODE_6_length_338_cov_1.314488 + 338 - 7073 - 36804204 - 19 - 97069448 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 70 + 70572810 + 0.041 + 0.267 + 0.14 No hits found 7 - ds2020-482-EDGG-1-Q4_57812 - No definition line - 84 + Query_7 + NODE_7_length_335_cov_1.714286 + 335 - 7073 - 36804204 - 20 - 97012864 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 70 + 68892505 + 0.041 + 0.267 + 0.14 No hits found 8 - ds2020-482-EDGG-1-Q4_107243 - No definition line - 60 - - - 1 - ref|NC_006276.1| - White clover cryptic virus 1 RNA2, complete genome - NC_006276 - 1708 - - - 1 - 37.724 - 76 - 0.000859157 - 2 - 52 - 495 - 545 - 2 - 3 - 14 - 15 - 0 - 17 - ISVLWNTMILKVYVETG - VSVLWNVMILKVYVNTG - +SVLWN MILKVYV TG - - - - - - - 7073 - 36804204 - 12 - 97465536 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 - - - - - 9 - ds2020-482-EDGG-1-Q4_99332 - No definition line - 63 + Query_8 + NODE_8_length_331_cov_0.862319 + 331 - 7073 - 36804204 - 13 - 97408952 - 0.133969292349849 - 0.313843789061929 - 0.427993038537577 + 16305 + 2821655 + 69 + 69561010 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 9 + Query_9 + NODE_9_length_324_cov_2.141264 + 324 + + + + + 16305 + 2821655 + 67 + 70898020 + 0.041 + 0.267 + 0.14 No hits found 10 - ds2020-482-EDGG-1-Q4_77228 - No definition line - 74 + Query_10 + NODE_10_length_324_cov_1.371747 + 324 - 7073 - 36804204 - 16 - 97239200 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 67 + 70898020 + 0.041 + 0.267 + 0.14 No hits found 11 - ds2020-482-EDGG-1-Q4_66730 - No definition line - 79 + Query_11 + NODE_11_length_317_cov_1.125954 + 317 - 7073 - 36804204 - 17 - 109330443 - 0.123285876267438 - 0.308001358455575 - 0.370429799913588 + 16305 + 2821655 + 65 + 70473200 + 0.041 + 0.267 + 0.14 No hits found 12 - ds2020-482-EDGG-1-Q4_2681 - No definition line - 348 + Query_12 + NODE_12_length_311_cov_1.535156 + 311 + + + + + 16305 + 2821655 + 64 + 69347265 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 13 + Query_13 + NODE_13_length_295_cov_0.945833 + 295 1 - ref|NC_011554.1| - Blackberry chlorotic ringspot virus RNA2, complete genome - NC_011554 - 2879 + gnl|CDD|316155 + pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, Domain 2. This is a family of the conserved region of Leucine-tRNA ligase or Leucyl-tRNA synthetase, EC:6.1.1.4. + 316155 + 184 + + + 1 + 38.6378 + 91 + 2.277e-05 + 159 + 269 + 128 + 168 + 3 + 0 + 17 + 22 + 4 + 41 + FIKQYGLPFNPVIAPEDAELTDEQIQSYINTA---NS-FFN + FAKKYNLPIKPVIKPEDGDLPDIMTEAYTEEGILVNSGEFD + F K+Y LP PVI PED +L D ++Y NS F+ + + + + + + + 16305 + 2821655 + 60 + 70047490 + 0.041 + 0.267 + 0.14 + + + + + 14 + Query_14 + NODE_14_length_294_cov_1.891213 + 294 + + + + + 16305 + 2821655 + 60 + 70047490 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 15 + Query_15 + NODE_15_length_280_cov_1.413333 + 280 + + + + + 16305 + 2821655 + 56 + 70617275 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 16 + Query_16 + NODE_16_length_278_cov_0.901345 + 278 + + + 1 + gnl|CDD|306845 + pfam00421, PSII, Photosystem II protein. + 306845 + 500 1 - 72.0897 - 151 - 1.04985e-23 - 137 - 286 - 117 - 266 - -3 - 3 - 28 - 36 + 132.634 + 334 + 7.65615e-39 + 34 + 270 + 388 + 466 + 1 + 0 + 52 + 61 0 - 50 - DNYDEWVKLFLFEFVVKHTAKFDFATIFDTFEMVVRTIDPSIPDFYEEDD - DMYKEWVSMFLFKFIVEHTAKFDFATIDCTFGMIVARLIPGYSDLDDEDE - D Y EWV +FLF+F+V+HTAKFDFATI TF M+V + P D +ED+ + 79 + SRYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFQTH + SGYSLEQTGVTVQFYGGELNGQTFTDPWQVKRYARHAQLGELNSVDRVTTESDGVFRVSPRGWLAFSHFCFALLFFFGH + S YS+EQ GVTV+FYGGELNG +++DP VK+YAR AQLGE+ +DR T +SDGVFR SPRGW F H FALLFF H + + + + + + + 16305 + 2821655 + 55 + 71220560 + 0.041 + 0.267 + 0.14 + + + + + 17 + Query_17 + NODE_17_length_277_cov_1.540541 + 277 + + + + + 16305 + 2821655 + 55 + 71220560 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 18 + Query_18 + NODE_18_length_274_cov_3.872146 + 274 + + + + + 16305 + 2821655 + 55 + 69295680 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 19 + Query_19 + NODE_19_length_271_cov_0.879630 + 271 + + + 1 + gnl|CDD|306845 + pfam00421, PSII, Photosystem II protein. + 306845 + 500 + + + 1 + 56.3644 + 136 + 1.69015e-11 + 82 + 252 + 165 + 224 + 1 + 0 + 23 + 34 + 23 + 70 + ITNLTLNPSVIFGYL-------------LKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILTK + VSDPTLDPGVIYGYTGHVQPVAPVWGAEGFSPFGPGG----------IVGHHIAAGILGIIGGIFHITTR + +++ TL+P VI+GY SPFG G I+G H+ G + I+GGI+HI T+ + + + + + + + 16305 + 2821655 + 54 + 69882660 + 0.041 + 0.267 + 0.14 + + + + + 20 + Query_20 + NODE_20_length_267_cov_1.429245 + 267 + + + 1 + gnl|CDD|287774 + pfam10839, DUF2647, Protein of unknown function (DUF2647). This eukaryotic family of proteins are annotated as ycf68 but have no known function. + 287774 + 70 + + + 1 + 48.4966 + 115 + 7.70073e-10 + 165 + 233 + 22 + 44 + -2 + 0 + 21 + 22 + 0 + 23 + GAIQVRSNVDPTFYSLVGSGRSG + GAIQVRSHVDLTFYSLVGSGRSG + GAIQVRS+VD TFYSLVGSGRSG 2 - 56.0524 - 116 - 1.04985e-23 - 38 - 148 - 252 - 362 - -3 - 3 - 21 - 28 - 0 - 37 - EEDDSGLFPREIDSFYLPYDDLDVDYTKVVHDCRDID - DDEDEEHSPREIDSFYLPYDDLDVDYTTIDYRRDDVE - +++D PREIDSFYLPYDDLDVDYT + + D++ + 43.1038 + 101 + 7.90575e-08 + 88 + 222 + 22 + 70 + -1 + 0 + 23 + 27 + 4 + 49 + GEIQCRSN----FLFTRGIRAVREGPPWLLSSRESIHPLSVYGQLSLEH + GAIQVRSHVDLTFYSLVGSGRSGGGPPALLFSREHIHLISVWGAISLAH + G IQ RS+ F G GPP LL SRE IH +SV+G +SL H 3 - 44.5971 - 91 - 2.20433e-07 - 183 - 275 - 128 - 220 - 3 - -2 - 19 - 20 + 42.7186 + 100 + 1.07047e-07 + 86 + 175 + 41 + 70 + -3 + 0 + 17 + 18 0 - 31 - TTISNVSKIVAKSNFAVCLTTNSKRKSFTHS - TIIPNVQSIVAKSNFAVCSTINLNKNMLTHS - T I NV IVAKSNFAVC T N + THS + 30 + GGPGGTTMAPLFSRIHTSLISIWTAISRAQ + GRSGGGPPALLFSREHIHLISVWGAISLAH + G GG A LFSR H LIS+W AIS A + + + + + + 16305 + 2821655 + 53 + 70469640 + 0.041 + 0.267 + 0.14 + + + + + 21 + Query_21 + NODE_21_length_263_cov_1.177885 + 263 + + + + + 16305 + 2821655 + 52 + 69082825 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 22 + Query_22 + NODE_22_length_262_cov_1.053140 + 262 + + + 1 + gnl|CDD|306604 + pfam00124, Photo_RC, Photosynthetic reaction centre protein. + 306604 + 258 + + + 1 + 99.6256 + 249 + 4.94039e-28 + 31 + 228 + 77 + 142 + 1 + 0 + 27 + 41 + 0 + 66 + SVACYMGREWEVSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQ + AFISWWLREYEIARKLGMGPHIAWAFSAAIAAYLSLGLIRPILMGSWSEGFPLGIFPHLDWTSNFS + + + RE+E++ +LGM P IA A+SA +AA ++ LI PI GS+S+G PLGI ++ F + + + + + + + 16305 + 2821655 + 52 + 69082825 + 0.041 + 0.267 + 0.14 + + + + + 23 + Query_23 + NODE_23_length_260_cov_1.590244 + 260 + + + + + 16305 + 2821655 + 51 + 69653500 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 24 + Query_24 + NODE_24_length_258_cov_0.935961 + 258 + + + 1 + gnl|CDD|307679 + pfam01660, Vmethyltransf, Viral methyltransferase. This RNA methyltransferase domain is found in a wide range of ssRNA viruses, including Hordei-, Tobra-, Tobamo-, Bromo-, Clostero- and Caliciviruses. This methyltransferase is involved in mRNA capping. Capping of mRNA enhances its stability. This usually occurs in the nucleus. Therefore, many viruses that replicate in the cytoplasm encode their own. This is a specific guanine-7-methyltransferase domain involved in viral mRNA cap0 synthesis. Specificity for guanine 7 position is shown by NMR in and in vivo role in cap synthesis. Based on secondary structure prediction, the basic fold is believed to be similar to the common AdoMet-dependent methyltransferase fold. A curious feature of this methyltransferase domain is that it together with flanking sequences seems to have guanylyltransferase activity coupled to the methyltransferase activity. The domain is found throughout the so-called Alphavirus superfamily, (including alphaviruses and several other groups). It forms the defining, unique feature of this superfamily. + 307679 + 305 + - 4 - 28.1016 - 55 - 2.20433e-07 - 73 - 126 - 274 - 327 + 1 + 65.0021 + 159 + 8.38713e-15 + 27 + 230 + 226 + 296 + 3 + 0 + 28 + 38 + 3 + 71 + AHHLVAITRGEA--ENCKHRSFGPFEATASESLAKL-CPDYPICLPVPYDVINKVYRYLRTLKKPDVQSPH + AHHLFKITRGDGLTLKPDSRTFGPFEAVLLPKIFVPRVLNYIRGKPIPLTVVNKLFSYLRSLKKRVVINGM + AHHL ITRG+ R+FGPFEA + +Y P+P V+NK++ YLR+LKK V + + + + + + + + 16305 + 2821655 + 51 + 69653500 + 0.041 + 0.267 + 0.14 + + + + + 25 + Query_25 + NODE_25_length_256_cov_0.945274 + 256 + + + + + 16305 + 2821655 + 50 + 70224175 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 26 + Query_26 + NODE_26_length_256_cov_0.895522 + 256 + + + + + 16305 + 2821655 + 50 + 70224175 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 27 + Query_27 + NODE_27_length_254_cov_0.793970 + 254 + + + + + 16305 + 2821655 + 49 + 70794850 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 28 + Query_28 + NODE_28_length_253_cov_1.313131 + 253 + + + + + 16305 + 2821655 + 49 + 70794850 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 29 + Query_29 + NODE_29_length_250_cov_0.851282 + 250 + + + 1 + gnl|CDD|278700 + pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. + 278700 + 29 + + + 1 + 42.0012 + 99 + 7.31211e-08 + 79 + 165 + 1 + 29 1 - -3 - 12 - 12 + 0 + 17 + 19 0 - 18 - SPHQDHHKVDKRNQFP*E - SLHQDRRMEDKRNQSP*E - S HQD DKRNQ P*E + 29 + MTIDRTYPIFTVRWLAVHGLAVPTVSFLG + GERPFSYPITTVRWWAIHALTVPTVFFLG + +YPI TVRW A+H L VPTV FLG + + + + + + + 16305 + 2821655 + 48 + 71365525 + 0.041 + 0.267 + 0.14 + + + + + 30 + Query_30 + NODE_30_length_249_cov_1.298969 + 249 + + + + + 16305 + 2821655 + 48 + 71365525 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 31 + Query_31 + NODE_31_length_249_cov_0.979381 + 249 + + + + + 16305 + 2821655 + 48 + 71365525 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 32 + Query_32 + NODE_32_length_248_cov_0.979275 + 248 + + + + + 16305 + 2821655 + 48 + 69326510 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 33 + Query_33 + NODE_33_length_245_cov_1.000000 + 245 + + + + + 16305 + 2821655 + 47 + 69880880 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 34 + Query_34 + NODE_34_length_245_cov_1.000000 + 245 + + + 1 + gnl|CDD|250270 + pfam00978, RdRP_2, RNA dependent RNA polymerase. This family may represent an RNA dependent RNA polymerase. The family also contains the following proteins: 2A protein from bromoviruses putative RNA dependent RNA polymerase from tobamoviruses Non structural polyprotein from togaviruses. + 250270 + 441 + + + 1 + 45.7137 + 109 + 6.42106e-08 + 44 + 211 + 164 + 219 + 2 + 0 + 21 + 31 + 0 + 56 + KGMCAIFSPIFKELKNRLKSVLDIKYMYADGLRPDQLSERMSQIGAGKYFIENDME + KLVTAYFSPIFRELFERLLYVLKPKVVFPTGMTSSLIAERFEFLDASEDFLEIDFS + K + A FSPIF+EL RL VL K ++ G+ ++ER + A + F+E D - 7073 - 36804204 - 43 - 873366817 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 47 + 69880880 + 0.041 + 0.267 + 0.14 - 19 - ds2020-482-EDGG-1-Q4_107857 - No definition line - 59 + 35 + Query_35 + NODE_35_length_242_cov_0.818182 + 242 + + + + + 16305 + 2821655 + 46 + 70435250 + 0.08832702 + 0.267 + 0.14 + + + No hits found + + + 36 + Query_36 + NODE_36_length_240_cov_1.259459 + 240 + + + + + 16305 + 2821655 + 46 + 70435250 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 37 + Query_37 + NODE_37_length_239_cov_1.032609 + 239 + + + + + 16305 + 2821655 + 45 + 70989620 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 38 + Query_38 + NODE_38_length_239_cov_1.032609 + 239 + + + + + 16305 + 2821655 + 45 + 70989620 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 39 + Query_39 + NODE_39_length_238_cov_1.038251 + 238 + + + + + 16305 + 2821655 + 45 + 70989620 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 40 + Query_40 + NODE_40_length_238_cov_0.879781 + 238 + + + + + 16305 + 2821655 + 45 + 70989620 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 41 + Query_41 + NODE_41_length_236_cov_1.049724 + 236 + + + + + 16305 + 2821655 + 45 + 68901690 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 42 + Query_42 + NODE_42_length_235_cov_1.855556 + 235 + + + + + 16305 + 2821655 + 45 + 68901690 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 43 + Query_43 + NODE_43_length_234_cov_1.061453 + 234 + + + + + 16305 + 2821655 + 45 + 68901690 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 44 + Query_44 + NODE_44_length_232_cov_1.073446 + 232 + + + + + 16305 + 2821655 + 44 + 69439755 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 45 + Query_45 + NODE_45_length_232_cov_1.073446 + 232 + + + + + 16305 + 2821655 + 44 + 69439755 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 46 + Query_46 + NODE_46_length_229_cov_1.091954 + 229 1 - ref|NC_003501.1| - Brome streak mosaic virus, complete genome - NC_003501 - 9672 + gnl|CDD|306604 + pfam00124, Photo_RC, Photosynthetic reaction centre protein. + 306604 + 258 1 - 62.0091 - 129 - 4.20284e-11 - 2 - 58 - 3274 - 3330 - 2 - 1 - 19 - 19 + 86.1436 + 214 + 4.26406e-23 + 24 + 194 + 87 + 143 + -3 + 0 + 25 + 36 0 - 19 - QDCRKCHTDIGCSCDYCNW - QDCRKCHTDIGCSCDYCNW - QDCRKCHTDIGCSCDYCNW + 57 + ELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQA + EIARKLGMGPHIAWAFSAAIAAYLSLGLIRPILMGSWSEGFPLGIFPHLDWTSNFSY + E++ +LGM P IA A+SA +AA ++ LI PI GS+S+G PLGI ++ F + + + + + + 16305 + 2821655 + 43 + 69977820 + 0.041 + 0.267 + 0.14 + + + + + 47 + Query_47 + NODE_47_length_229_cov_0.816092 + 229 + + + 1 + gnl|CDD|306687 + pfam00223, PsaA_PsaB, Photosystem I psaA/psaB protein. + 306687 + 717 + - 2 - 55.1359 - 114 - 4.92676e-09 - 3 - 59 - 3275 - 3331 - -1 - -3 - 19 - 19 + 1 + 61.3066 + 149 + 1.79906e-13 + 124 + 222 + 1 + 33 + 1 + 0 + 22 + 24 0 - 19 - ANCSNHSCNQYLCGTFDNL - ANCSNHSCNQYLCGTFDNL - ANCSNHSCNQYLCGTFDNL + 33 + FSRTLAKGPDTTTWIWNLHADAHDLNSQTHPTQ + FSRDLAQGPKTTTWIWNLHATAHDFESHDGDTE + FSR LA+GP TTTWIWNLHA AHD S T+ - 7073 - 36804204 - 11 - 97522120 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 43 + 69977820 + 0.041 + 0.267 + 0.14 - 20 - ds2020-482-EDGG-1-Q4_83983 - No definition line - 71 + 48 + Query_48 + NODE_48_length_227_cov_1.273256 + 227 - 7073 - 36804204 - 15 - 97295784 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 - - - No hits found - - - 21 - ds2020-482-EDGG-1-Q4_92239 - No definition line - 66 - - - - - 7073 - 36804204 - 14 - 97352368 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 42 + 70515885 + 0.041 + 0.267 + 0.14 No hits found - 22 - ds2020-482-EDGG-1-Q4_31663 - No definition line - 111 + 49 + Query_49 + NODE_49_length_227_cov_1.017442 + 227 - 7073 - 36804204 - 29 - 96503608 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 42 + 70515885 + 0.041 + 0.267 + 0.14 No hits found - 23 - ds2020-482-EDGG-1-Q4_63163 - No definition line - 81 + 50 + Query_50 + NODE_50_length_226_cov_2.269006 + 226 1 - ref|NC_011591.1| - Southern tomato virus, complete genome - NC_011591 - 3437 + gnl|CDD|306845 + pfam00421, PSII, Photosystem II protein. + 306845 + 500 1 - 44.1389 - 90 - 1.00223e-05 - 1 - 81 - 3034 - 3114 + 89.1064 + 221 + 2.77182e-23 + 31 + 213 + 160 + 227 1 - 1 - 17 - 19 - 0 - 27 - KFMDFIRGVAVIGEGQWGIEMDRWIRF - KVMDLIRGNATIGRGQWGNDVMDWIRF - K MD IRG A IG GQWG ++ WIRF + 0 + 41 + 45 + 7 + 68 + GPGIWVSDP-------YGLTGTVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRSPQ + GLGTWVSDPTLDPGVIYGYTGHVQPVAPVWGAEGFSPFGPGGIVGHHIAAGILGIIGGIFHITTRPPG + G G WVSDP YG TG VQPV P WG EGF PF PGGI HHIAAG LGI+ G+FH++ R P - 7073 - 36804204 - 19 - 97069448 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 42 + 70515885 + 0.041 + 0.267 + 0.14 - 24 - ds2020-482-EDGG-1-Q4_91422 - No definition line - 67 + 51 + Query_51 + NODE_51_length_225_cov_1.117647 + 225 + + + + + 16305 + 2821655 + 42 + 70515885 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 52 + Query_52 + NODE_52_length_225_cov_0.917647 + 225 + + + + + 16305 + 2821655 + 42 + 70515885 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 53 + Query_53 + NODE_53_length_223_cov_3.303571 + 223 + + + + + 16305 + 2821655 + 41 + 71053950 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 54 + Query_54 + NODE_54_length_223_cov_1.803571 + 223 + + + + + 16305 + 2821655 + 41 + 71053950 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 55 + Query_55 + NODE_55_length_216_cov_1.596273 + 216 - 7073 - 36804204 - 14 - 97352368 - 0.133956144488482 - 0.317605957635731 - 0.401214524497119 + 16305 + 2821655 + 40 + 69422560 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 56 + Query_56 + NODE_56_length_216_cov_1.180124 + 216 + + + 1 + gnl|CDD|306795 + pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. + 306795 + 291 + + + 1 + 42.6815 + 101 + 5.23486e-07 + 18 + 188 + 52 + 110 + 3 + 0 + 16 + 28 + 4 + 60 + GLCGLFGSTEPTLNFEILTNQSYPVALEI---IFYIGFFLAFAVKLPIIPLHTWLPDTHE + GISLMYNYTG-TLSFTELSKALFNGLNSWGLLLLFLLILVGFLFKSAQVPFHTWLPDAYE + G+ ++ T TL+F L+ + + ++ + F K +P HTWLPD +E + + + + + + + 16305 + 2821655 + 40 + 69422560 + 0.041 + 0.267 + 0.14 + + + + + 57 + Query_57 + NODE_57_length_216_cov_0.869565 + 216 + + + + + 16305 + 2821655 + 40 + 69422560 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 58 + Query_58 + NODE_58_length_215_cov_1.668750 + 215 + + + + + 16305 + 2821655 + 39 + 69944320 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 59 + Query_59 + NODE_59_length_215_cov_1.187500 + 215 + + + + + 16305 + 2821655 + 39 + 69944320 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 60 + Query_60 + NODE_60_length_215_cov_0.843750 + 215 + + + + + 16305 + 2821655 + 39 + 69944320 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 61 + Query_61 + NODE_61_length_214_cov_1.232704 + 214 + + + + + 16305 + 2821655 + 39 + 69944320 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 62 + Query_62 + NODE_62_length_213_cov_0.936709 + 213 + + + + + 16305 + 2821655 + 39 + 69944320 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 63 + Query_63 + NODE_63_length_210_cov_1.225806 + 210 + + + + + 16305 + 2821655 + 38 + 70466080 + 0.041 + 0.267 + 0.14 + + + No hits found + + + 64 + Query_64 + NODE_64_length_208_cov_1.019608 + 208 + + + + + 16305 + 2821655 + 37 + 70987840 + 0.041 + 0.267 + 0.14 No hits found + diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_output.tab --- a/test-data/blast2tsv_output.tab Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_output.tab Wed Aug 21 13:13:28 2024 +0000 @@ -1,6 +1,13 @@ #algo query_id nb_reads query_length accession description organism percentIdentity nb_hsps queryOverlap hitOverlap evalue score tax_id taxonomy sequence -TBLASTX ds2020-482-EDGG-1-Q4_42600 96 -TBLASTX ds2020-482-EDGG-1-Q4_107243 60 -TBLASTX ds2020-482-EDGG-1-Q4_2681 348 NC_011554 Blackberry chlorotic ringspot virus RNA2, complete genome Blackberry chlorotic ringspot virus 56.3 2 100 9.0 1.04985e-23 128.1421 339420 Viruses;Riboviria;Orthornavirae;Kitrinoviricota;Alsuviricetes;Martellivirales;Bromoviridae;Ilarvirus;Blackberry chlorotic ringspot virus CCTTCCTAGCGACCACGCACACGTCAAGACCGGCATCATCAATGTCGCGACAATCGTGAACCACTTTAGTATAGTCCACATCAAGATCATCATAAGGTAGATAAAAGGAATCAATTTCCCTAGGAAAAAGTCCAGAATCATCTTCCTCATAAAAATCTGGTATCGAGGGATCAATGGTTCGCACCACCATCTCGAATGTATCAAAGATCGTCGCGAAATCAAACTTTGCGGTATGCTTAACGACAAACTCGAAAAGGAAAAGTTTTACCCATTCGTCGTAGTTGTCATCTTTATGCACACCGAACGTCGAGAAAAACCCAAAGAACGTGTGCGTGGTCGCTAGGAAGG -TBLASTX ds2020-482-EDGG-1-Q4_107857 59 -TBLASTX ds2020-482-EDGG-1-Q4_63163 81 +TBLASTX NODE_13_length_295_cov_0.945833 295 316155 pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, Domain 2. This is a family of the conserved region of Leucine-tRNA ligase or Leucyl-tRNA synthetase, EC:6.1.1.4. Tursiops truncatus papillomavirus 2 41.5 1 100 67.0 2.277e-05 38.6378 316155 Viruses;Monodnaviria;Shotokuvirae;Cossaviricota;Papovaviricetes;Zurhausenvirales;Papillomaviridae;Firstpapillomavirinae;Upsilonpapillomavirus;Upsilonpapillomavirus 2;Tursiops truncatus papillomavirus 2 TGTGTTGGGTGTGTTTGGTTTCCGGTTACCATAATCGCTATTCTTTCAAACAGAAAGCGCATGCTAAGTATTCTCACCCAGAGGAATATGCTGACAAGCCCTCCTCAAAAGGCTATTTTTACAATGCCACCTATGAGAATGCACGAACTCTTATTCACTTCATTAAGCAATATGGATTGCCCTTCAATCCTGTTATTGCACCAGAAGATGCTGAACTAACTGATGAACAGATTCAATCTTACATCAACACAGCAAACTCCTTCTTTAATGATTATCCGACGTTACTGTTCACCCG +TBLASTX NODE_16_length_278_cov_0.901345 278 306845 pfam00421, PSII, Photosystem II protein. 65.8 1 100 47.0 7.65615e-39 132.634 GTCTAACCTGTGTTGGGTGTGTTTGGGCTGTAATCGAGGTATAGTGTCGAACAAGTCGGTGTCACTGTTGAATTCTATGGCGGCGAACTCAATGGAGTCAGTTATAGTGATCCTGCTACTGTGAAAAAATATGCTAGACGTGCTCAATTGGGTGAAATTTTTGAATTAGATCGTGCTACTTTAAAATCGGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGGACATGCGTCGTTTGCTCTGCTCTTCTTCCAAACACACCCAACACA +TBLASTX NODE_19_length_271_cov_0.879630 271 306845 pfam00421, PSII, Photosystem II protein. 32.9 1 100 42.0 1.69015e-11 56.3644 GTCTAACCTGTGTTGGGTGTGTTTGGTATGGAGGGAGGTGTATATGATACCTGGGCACCCGGAGGGGGAGATGTAAGAAAAATTACCAACTTGACCCTTAACCCAAGCGTGATATTTGGTTATTTACTAAAATCTCCTTTTGGGGGAGAAGGATGGATTGTTAGTGTGGACGATTTAGAAGATATAATTGGAGGACATGTCTGGTTAGGCTCCATTTGTATACTTGGTGGAATTTGGCATATCTTAACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_20_length_267_cov_1.429245 267 287774 pfam10839, DUF2647, Protein of unknown function (DUF2647). This eukaryotic family of proteins are annotated as ycf68 but have no known function. Desulfovibrio sp. G100IX 91.3 1 100 99.0 7.70073e-10 48.4966 287774 cellular organisms;Bacteria;Thermodesulfobacteriota;Desulfovibrionia;Desulfovibrionales;Desulfovibrionaceae;Desulfovibrio;unclassified Desulfovibrio;Desulfovibrio sp. G100IX CTGTGTTGGGTGTGTTTGGACTTGGTATGTGAAGATACGTTGTTAGGTGCTCCGTTTTATTTTCCCATTGAGGCCGAACCTAAACCTGTGCTCGAGAGATAGCTGTCCATATACTGATAAGGGATGTATGGATTCTCGAGAAGAGAGGAGCCATGGTGGTCCCTCCCGGACCGCCCGGATCCCACGAGTGAATAGAAAGTTGGATCTACATTGGATCTCACCTGAATCGCCCCATAAACAACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_22_length_262_cov_1.053140 262 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 40.9 1 100 77.0 4.94039e-28 99.6256 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j GTCTAACCTGTGTTGGGTGTGTTTGGCTAGTCAGTAGCTTGTTATATGGGTCGTGAGTGGGAAGTTAGCTTCCGTCTGGGTATGCGCCCGTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCTGCTACTGCTGTTTTCTTGATTTACCCAATTGGTCAAGGAAGTTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGAGAGCACCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_24_length_258_cov_0.935961 258 307679 pfam01660, Vmethyltransf, Viral methyltransferase. This RNA methyltransferase domain is found in a wide range of ssRNA viruses, including Hordei-, Tobra-, Tobamo-, Bromo-, Clostero- and Caliciviruses. This methyltransferase is involved in mRNA capping. Capping of mRNA enhances its stability. This usually occurs in the nucleus. Therefore, many viruses that replicate in the cytoplasm encode their own. This is a specific guanine-7-methyltransferase domain involved in viral mRNA cap0 synthesis. Specificity for guanine 7 position is shown by NMR in and in vivo role in cap synthesis. Based on secondary structure prediction, the basic fold is believed to be similar to the common AdoMet-dependent methyltransferase fold. A curious feature of this methyltransferase domain is that it together with flanking sequences seems to have guanylyltransferase activity coupled to the methyltransferase activity. The domain is found throughout the so-called Alphavirus superfamily, (including alphaviruses and several other groups). It forms the defining, unique feature of this superfamily. Tetrastemma peltatum 39.4 1 100 70.0 8.38713e-15 65.0021 307679 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Spiralia;Lophotrochozoa;Nemertea;Enopla;Hoplonemertea;Monostilifera;Eumonostilifera;Tetrastemmatidae;Tetrastemma;Tetrastemma peltatum GTGTTGGGTGTGTTTGGTTGGTGAACGCGCACCATTTAGTGGCAATCACGCGCGGGGAGGCTGAAAACTGCAAGCATAGATCTTTCGGCCCTTTCGAAGCTACCGCTTCCGAGAGCCTGGCTAAACTCTGCCCAGATTATCCGATCTGCTTGCCTGTACCTTACGACGTGATCAATAAAGTGTATAGGTATCTCAGAACGCTTAAGAAGCCTGATGTGCAGTCGCCCCACTACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_29_length_250_cov_0.851282 250 278700 pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. uncultured archaeon CRE-PA11a 58.6 1 100 100 7.31211e-08 42.0012 278700 cellular organisms;Archaea;environmental samples;uncultured archaeon CRE-PA11a GTCTAACCTGTGTTGGGTGTGTTTGGGTTTCTTTGGAGCAACTCGATGAATTTAGTAAATCCTTTTAGGAGGTTCCCAATGACCATAGATCGAACCTATCCAATTTTTACAGTGCGATGGTTGGCTGTTCACGGACTGGCTGTACCTACTGTTTCTTTTTTAGGGTCAATATCAGCAATGCAGTTCATCCAACGATAAACCTAATTCAAATTATAGAGCTAGCACACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_34_length_245_cov_1.000000 245 250270 pfam00978, RdRP_2, RNA dependent RNA polymerase. This family may represent an RNA dependent RNA polymerase. The family also contains the following proteins: 2A protein from bromoviruses putative RNA dependent RNA polymerase from tobamoviruses Non structural polyprotein from togaviruses. Nocardia sp. 431D04 37.5 1 100 38.0 6.42106e-08 45.7137 250270 cellular organisms;Bacteria;Terrabacteria group;Actinomycetota;Actinomycetes;Mycobacteriales;Nocardiaceae;Nocardia;unclassified Nocardia;Nocardia sp. 431D04 GTCTAACCTGTGTTGGGTGTGTTTGGATGGTGATCGGCAATTTAAAGGAATGTGTGCGATATTTTCACCAATATTCAAGGAGCTTAAAAATCGACTAAAAAGCGTGTTAGATATTAAATACATGTATGCAGACGGATTGAGACCTGATCAGTTGTCGGAGCGCATGTCACAGATAGGTGCAGGTAAATATTTTATAGAGAATGATATGGAACAGCATCTCGCCAAACACACCCAACACAGGTTAG +TBLASTX NODE_46_length_229_cov_1.091954 229 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 43.9 1 100 66.0 4.26406e-23 86.1436 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j TGTGTTGGGTGTGTTTGGTTGGATGCCTGGAATACAATCATGAAATTGAAAGTACCAGATATTCCTAAAGGCATGCCATCTGAAAAACTTCCTTGACCAATAGGGTAGATCAAGAAAACAGCTGTAGCAGCCGCGACAGGAGCTGAATATGCAACAGCAATCCAAGGACGCATACCCAGACGGAAACTAAGCTCCCTCTCGCTCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_47_length_229_cov_0.816092 229 306687 pfam00223, PsaA_PsaB, Photosystem I psaA/psaB protein. 66.7 1 100 14.0 1.79906e-13 61.3066 TTGGTAAATTGGCGGAAAGAGGAGGACTCAATGATTATTCGTTCGCCGGAACCAGAAGTAAAAATTTTGGTAGATAGGGATCACATAAAAACTTCTTTCGAGGAATGGGCCAGGCCGGGTCATTTCTCAAGAACACTAGCTAAAGGCCCTGACACTACCACTTGGATCTGGAACCTACATGCTGATGCTCACGATCTTAATAGCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_50_length_226_cov_2.269006 226 306845 pfam00421, PSII, Photosystem II protein. 60.3 1 100 41.0 2.77182e-23 89.1064 GTCAACGGTGTGTTGGGTGTGTTTGGGAAAGGTCCTGGAATATGGGTGTCCGATCCTTATGGACTAACCGGAACAGTGCAACCTGTAAATCCGGCGTGGGGCGTGGAAGGTTTTGATCCTTTTGTCCCGGGAGGAATAGCTTCTCATCATATTGCAGCAGGTACATTGGGCATATTAGCGGGCCTATTCCATCTTAGCGTACGGTCACCCCAGCCAAACACACCCA +TBLASTX NODE_56_length_216_cov_1.180124 216 306795 pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. 26.7 1 100 62.0 5.23486e-07 42.6815 GTGTTGGGTGTGTTTGGGGTCTATGTGGTTTATTTGGTTCTACTGAACCAACATTAAATTTTGAAATATTAACTAATCAGTCCTATCCTGTGGCCTTGGAAATAATATTTTATATTGGATTTTTTCTTGCTTTTGCTGTAAAATTACCAATCATACCCCTACATACATGGTTACCAGATACCCACGAGAGCCAAACACACCCAACACAGGTTAGAC diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_output_with_rn.tab --- a/test-data/blast2tsv_output_with_rn.tab Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_output_with_rn.tab Wed Aug 21 13:13:28 2024 +0000 @@ -1,6 +1,13 @@ #algo query_id nb_reads query_length accession description organism percentIdentity nb_hsps queryOverlap hitOverlap evalue score tax_id taxonomy sequence -TBLASTX ds2020-482-EDGG-1-Q4_42600 12 96 -TBLASTX ds2020-482-EDGG-1-Q4_107243 63 60 -TBLASTX ds2020-482-EDGG-1-Q4_2681 8 348 NC_011554 Blackberry chlorotic ringspot virus RNA2, complete genome Blackberry chlorotic ringspot virus 56.3 2 100 9.0 1.04985e-23 128.1421 339420 Viruses;Riboviria;Orthornavirae;Kitrinoviricota;Alsuviricetes;Martellivirales;Bromoviridae;Ilarvirus;Blackberry chlorotic ringspot virus CCTTCCTAGCGACCACGCACACGTCAAGACCGGCATCATCAATGTCGCGACAATCGTGAACCACTTTAGTATAGTCCACATCAAGATCATCATAAGGTAGATAAAAGGAATCAATTTCCCTAGGAAAAAGTCCAGAATCATCTTCCTCATAAAAATCTGGTATCGAGGGATCAATGGTTCGCACCACCATCTCGAATGTATCAAAGATCGTCGCGAAATCAAACTTTGCGGTATGCTTAACGACAAACTCGAAAAGGAAAAGTTTTACCCATTCGTCGTAGTTGTCATCTTTATGCACACCGAACGTCGAGAAAAACCCAAAGAACGTGTGCGTGGTCGCTAGGAAGG -TBLASTX ds2020-482-EDGG-1-Q4_107857 402 59 -TBLASTX ds2020-482-EDGG-1-Q4_63163 88 81 +TBLASTX NODE_13_length_295_cov_0.945833 264 295 316155 pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, Domain 2. This is a family of the conserved region of Leucine-tRNA ligase or Leucyl-tRNA synthetase, EC:6.1.1.4. Tursiops truncatus papillomavirus 2 41.5 1 100 67.0 2.277e-05 38.6378 316155 Viruses;Monodnaviria;Shotokuvirae;Cossaviricota;Papovaviricetes;Zurhausenvirales;Papillomaviridae;Firstpapillomavirinae;Upsilonpapillomavirus;Upsilonpapillomavirus 2;Tursiops truncatus papillomavirus 2 TGTGTTGGGTGTGTTTGGTTTCCGGTTACCATAATCGCTATTCTTTCAAACAGAAAGCGCATGCTAAGTATTCTCACCCAGAGGAATATGCTGACAAGCCCTCCTCAAAAGGCTATTTTTACAATGCCACCTATGAGAATGCACGAACTCTTATTCACTTCATTAAGCAATATGGATTGCCCTTCAATCCTGTTATTGCACCAGAAGATGCTGAACTAACTGATGAACAGATTCAATCTTACATCAACACAGCAAACTCCTTCTTTAATGATTATCCGACGTTACTGTTCACCCG +TBLASTX NODE_16_length_278_cov_0.901345 377 278 306845 pfam00421, PSII, Photosystem II protein. 65.8 1 100 47.0 7.65615e-39 132.634 GTCTAACCTGTGTTGGGTGTGTTTGGGCTGTAATCGAGGTATAGTGTCGAACAAGTCGGTGTCACTGTTGAATTCTATGGCGGCGAACTCAATGGAGTCAGTTATAGTGATCCTGCTACTGTGAAAAAATATGCTAGACGTGCTCAATTGGGTGAAATTTTTGAATTAGATCGTGCTACTTTAAAATCGGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGGACATGCGTCGTTTGCTCTGCTCTTCTTCCAAACACACCCAACACA +TBLASTX NODE_19_length_271_cov_0.879630 67 271 306845 pfam00421, PSII, Photosystem II protein. 32.9 1 100 42.0 1.69015e-11 56.3644 GTCTAACCTGTGTTGGGTGTGTTTGGTATGGAGGGAGGTGTATATGATACCTGGGCACCCGGAGGGGGAGATGTAAGAAAAATTACCAACTTGACCCTTAACCCAAGCGTGATATTTGGTTATTTACTAAAATCTCCTTTTGGGGGAGAAGGATGGATTGTTAGTGTGGACGATTTAGAAGATATAATTGGAGGACATGTCTGGTTAGGCTCCATTTGTATACTTGGTGGAATTTGGCATATCTTAACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_20_length_267_cov_1.429245 2 267 287774 pfam10839, DUF2647, Protein of unknown function (DUF2647). This eukaryotic family of proteins are annotated as ycf68 but have no known function. Desulfovibrio sp. G100IX 91.3 1 100 99.0 7.70073e-10 48.4966 287774 cellular organisms;Bacteria;Thermodesulfobacteriota;Desulfovibrionia;Desulfovibrionales;Desulfovibrionaceae;Desulfovibrio;unclassified Desulfovibrio;Desulfovibrio sp. G100IX CTGTGTTGGGTGTGTTTGGACTTGGTATGTGAAGATACGTTGTTAGGTGCTCCGTTTTATTTTCCCATTGAGGCCGAACCTAAACCTGTGCTCGAGAGATAGCTGTCCATATACTGATAAGGGATGTATGGATTCTCGAGAAGAGAGGAGCCATGGTGGTCCCTCCCGGACCGCCCGGATCCCACGAGTGAATAGAAAGTTGGATCTACATTGGATCTCACCTGAATCGCCCCATAAACAACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_22_length_262_cov_1.053140 262 262 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 40.9 1 100 77.0 4.94039e-28 99.6256 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j GTCTAACCTGTGTTGGGTGTGTTTGGCTAGTCAGTAGCTTGTTATATGGGTCGTGAGTGGGAAGTTAGCTTCCGTCTGGGTATGCGCCCGTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCTGCTACTGCTGTTTTCTTGATTTACCCAATTGGTCAAGGAAGTTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGAGAGCACCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_24_length_258_cov_0.935961 101 258 307679 pfam01660, Vmethyltransf, Viral methyltransferase. This RNA methyltransferase domain is found in a wide range of ssRNA viruses, including Hordei-, Tobra-, Tobamo-, Bromo-, Clostero- and Caliciviruses. This methyltransferase is involved in mRNA capping. Capping of mRNA enhances its stability. This usually occurs in the nucleus. Therefore, many viruses that replicate in the cytoplasm encode their own. This is a specific guanine-7-methyltransferase domain involved in viral mRNA cap0 synthesis. Specificity for guanine 7 position is shown by NMR in and in vivo role in cap synthesis. Based on secondary structure prediction, the basic fold is believed to be similar to the common AdoMet-dependent methyltransferase fold. A curious feature of this methyltransferase domain is that it together with flanking sequences seems to have guanylyltransferase activity coupled to the methyltransferase activity. The domain is found throughout the so-called Alphavirus superfamily, (including alphaviruses and several other groups). It forms the defining, unique feature of this superfamily. Tetrastemma peltatum 39.4 1 100 70.0 8.38713e-15 65.0021 307679 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Spiralia;Lophotrochozoa;Nemertea;Enopla;Hoplonemertea;Monostilifera;Eumonostilifera;Tetrastemmatidae;Tetrastemma;Tetrastemma peltatum GTGTTGGGTGTGTTTGGTTGGTGAACGCGCACCATTTAGTGGCAATCACGCGCGGGGAGGCTGAAAACTGCAAGCATAGATCTTTCGGCCCTTTCGAAGCTACCGCTTCCGAGAGCCTGGCTAAACTCTGCCCAGATTATCCGATCTGCTTGCCTGTACCTTACGACGTGATCAATAAAGTGTATAGGTATCTCAGAACGCTTAAGAAGCCTGATGTGCAGTCGCCCCACTACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_29_length_250_cov_0.851282 428 250 278700 pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. uncultured archaeon CRE-PA11a 58.6 1 100 100 7.31211e-08 42.0012 278700 cellular organisms;Archaea;environmental samples;uncultured archaeon CRE-PA11a GTCTAACCTGTGTTGGGTGTGTTTGGGTTTCTTTGGAGCAACTCGATGAATTTAGTAAATCCTTTTAGGAGGTTCCCAATGACCATAGATCGAACCTATCCAATTTTTACAGTGCGATGGTTGGCTGTTCACGGACTGGCTGTACCTACTGTTTCTTTTTTAGGGTCAATATCAGCAATGCAGTTCATCCAACGATAAACCTAATTCAAATTATAGAGCTAGCACACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_34_length_245_cov_1.000000 183 245 250270 pfam00978, RdRP_2, RNA dependent RNA polymerase. This family may represent an RNA dependent RNA polymerase. The family also contains the following proteins: 2A protein from bromoviruses putative RNA dependent RNA polymerase from tobamoviruses Non structural polyprotein from togaviruses. Nocardia sp. 431D04 37.5 1 100 38.0 6.42106e-08 45.7137 250270 cellular organisms;Bacteria;Terrabacteria group;Actinomycetota;Actinomycetes;Mycobacteriales;Nocardiaceae;Nocardia;unclassified Nocardia;Nocardia sp. 431D04 GTCTAACCTGTGTTGGGTGTGTTTGGATGGTGATCGGCAATTTAAAGGAATGTGTGCGATATTTTCACCAATATTCAAGGAGCTTAAAAATCGACTAAAAAGCGTGTTAGATATTAAATACATGTATGCAGACGGATTGAGACCTGATCAGTTGTCGGAGCGCATGTCACAGATAGGTGCAGGTAAATATTTTATAGAGAATGATATGGAACAGCATCTCGCCAAACACACCCAACACAGGTTAG +TBLASTX NODE_46_length_229_cov_1.091954 471 229 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 43.9 1 100 66.0 4.26406e-23 86.1436 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j TGTGTTGGGTGTGTTTGGTTGGATGCCTGGAATACAATCATGAAATTGAAAGTACCAGATATTCCTAAAGGCATGCCATCTGAAAAACTTCCTTGACCAATAGGGTAGATCAAGAAAACAGCTGTAGCAGCCGCGACAGGAGCTGAATATGCAACAGCAATCCAAGGACGCATACCCAGACGGAAACTAAGCTCCCTCTCGCTCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_47_length_229_cov_0.816092 470 229 306687 pfam00223, PsaA_PsaB, Photosystem I psaA/psaB protein. 66.7 1 100 14.0 1.79906e-13 61.3066 TTGGTAAATTGGCGGAAAGAGGAGGACTCAATGATTATTCGTTCGCCGGAACCAGAAGTAAAAATTTTGGTAGATAGGGATCACATAAAAACTTCTTTCGAGGAATGGGCCAGGCCGGGTCATTTCTCAAGAACACTAGCTAAAGGCCCTGACACTACCACTTGGATCTGGAACCTACATGCTGATGCTCACGATCTTAATAGCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_50_length_226_cov_2.269006 315 226 306845 pfam00421, PSII, Photosystem II protein. 60.3 1 100 41.0 2.77182e-23 89.1064 GTCAACGGTGTGTTGGGTGTGTTTGGGAAAGGTCCTGGAATATGGGTGTCCGATCCTTATGGACTAACCGGAACAGTGCAACCTGTAAATCCGGCGTGGGGCGTGGAAGGTTTTGATCCTTTTGTCCCGGGAGGAATAGCTTCTCATCATATTGCAGCAGGTACATTGGGCATATTAGCGGGCCTATTCCATCTTAGCGTACGGTCACCCCAGCCAAACACACCCA +TBLASTX NODE_56_length_216_cov_1.180124 166 216 306795 pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. 26.7 1 100 62.0 5.23486e-07 42.6815 GTGTTGGGTGTGTTTGGGGTCTATGTGGTTTATTTGGTTCTACTGAACCAACATTAAATTTTGAAATATTAACTAATCAGTCCTATCCTGTGGCCTTGGAAATAATATTTTATATTGGATTTTTTCTTGCTTTTGCTGTAAAATTACCAATCATACCCCTACATACATGGTTACCAGATACCCACGAGAGCCAAACACACCCAACACAGGTTAGAC diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_read_nb.tab --- a/test-data/blast2tsv_read_nb.tab Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_read_nb.tab Wed Aug 21 13:13:28 2024 +0000 @@ -1,6 +1,64 @@ -ds2020-482-EDGG-1-Q4_42600 12 -ds2020-482-EDGG-1-Q4_107243 63 -ds2020-482-EDGG-1-Q4_2681 8 -ds2020-482-EDGG-1-Q4_107857 402 -ds2020-482-EDGG-1-Q4_63163 88 -ds2020-482-EDGG-1-Q4_47667 1 +NODE_1_length_506_cov_10.687361 56 +NODE_2_length_429_cov_3.631016 301 +NODE_3_length_365_cov_1.074194 23 +NODE_4_length_351_cov_1.547297 183 +NODE_5_length_344_cov_3.273356 220 +NODE_6_length_338_cov_1.314488 121 +NODE_7_length_335_cov_1.714286 6 +NODE_8_length_331_cov_0.862319 322 +NODE_9_length_324_cov_2.141264 153 +NODE_10_length_324_cov_1.371747 235 +NODE_11_length_317_cov_1.125954 136 +NODE_12_length_311_cov_1.535156 196 +NODE_13_length_295_cov_0.945833 264 +NODE_14_length_294_cov_1.891213 155 +NODE_15_length_280_cov_1.413333 348 +NODE_16_length_278_cov_0.901345 377 +NODE_17_length_277_cov_1.540541 160 +NODE_18_length_274_cov_3.872146 25 +NODE_19_length_271_cov_0.879630 67 +NODE_20_length_267_cov_1.429245 2 +NODE_21_length_263_cov_1.177885 361 +NODE_22_length_262_cov_1.053140 262 +NODE_23_length_260_cov_1.590244 316 +NODE_24_length_258_cov_0.935961 101 +NODE_25_length_256_cov_0.945274 46 +NODE_26_length_256_cov_0.895522 153 +NODE_27_length_254_cov_0.793970 127 +NODE_28_length_253_cov_1.313131 20 +NODE_29_length_250_cov_0.851282 428 +NODE_30_length_249_cov_1.298969 249 +NODE_31_length_249_cov_0.979381 445 +NODE_32_length_248_cov_0.979275 496 +NODE_33_length_245_cov_1.000000 281 +NODE_34_length_245_cov_1.000000 183 +NODE_35_length_242_cov_0.818182 222 +NODE_36_length_240_cov_1.259459 179 +NODE_37_length_239_cov_1.032609 98 +NODE_38_length_239_cov_1.032609 405 +NODE_39_length_238_cov_1.038251 426 +NODE_40_length_238_cov_0.879781 105 +NODE_41_length_236_cov_1.049724 225 +NODE_42_length_235_cov_1.855556 440 +NODE_43_length_234_cov_1.061453 106 +NODE_44_length_232_cov_1.073446 136 +NODE_45_length_232_cov_1.073446 430 +NODE_46_length_229_cov_1.091954 471 +NODE_47_length_229_cov_0.816092 470 +NODE_48_length_227_cov_1.273256 450 +NODE_49_length_227_cov_1.017442 190 +NODE_50_length_226_cov_2.269006 315 +NODE_51_length_225_cov_1.117647 384 +NODE_52_length_225_cov_0.917647 405 +NODE_53_length_223_cov_3.303571 414 +NODE_54_length_223_cov_1.803571 355 +NODE_55_length_216_cov_1.596273 317 +NODE_56_length_216_cov_1.180124 166 +NODE_57_length_216_cov_0.869565 247 +NODE_58_length_215_cov_1.668750 267 +NODE_59_length_215_cov_1.187500 163 +NODE_60_length_215_cov_0.843750 124 +NODE_61_length_214_cov_1.232704 103 +NODE_62_length_213_cov_0.936709 421 +NODE_63_length_210_cov_1.225806 290 +NODE_64_length_208_cov_1.019608 498 \ No newline at end of file diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_reads.txt --- a/test-data/blast2tsv_reads.txt Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_reads.txt Wed Aug 21 13:13:28 2024 +0000 @@ -1,1 +1,6 @@ -0 Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Martellivirales Bromoviridae Ilarvirus Blackberry chlorotic ringspot virus +0 Viruses Monodnaviria Shotokuvirae Cossaviricota Papovaviricetes Zurhausenvirales Papillomaviridae Firstpapillomavirinae Upsilonpapillomavirus Upsilonpapillomavirus 2 +0 cellular organisms Bacteria Thermodesulfobacteriota Desulfovibrionia Desulfovibrionales Desulfovibrionaceae Desulfovibrio unclassified Desulfovibrio +0 cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota Neoptera Polyneoptera Dictyoptera Blattodea Blattoidea Termitoidae Rhinotermitidae Heterotermitinae Heterotermes unclassified Heterotermes +0 cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Nemertea Enopla Hoplonemertea Monostilifera Eumonostilifera Tetrastemmatidae Tetrastemma +0 cellular organisms Archaea environmental samples +0 cellular organisms Bacteria Terrabacteria group Actinomycetota Actinomycetes Mycobacteriales Nocardiaceae Nocardia unclassified Nocardia diff -r 84d20d9c292d -r fd7104249a3c test-data/blast2tsv_reads_with_rn.txt --- a/test-data/blast2tsv_reads_with_rn.txt Sat May 18 18:14:29 2024 +0000 +++ b/test-data/blast2tsv_reads_with_rn.txt Wed Aug 21 13:13:28 2024 +0000 @@ -1,6 +1,13 @@ #algo query_id nb_reads query_length accession description organism percentIdentity nb_hsps queryOverlap hitOverlap evalue score tax_id taxonomy sequence -TBLASTX ds2020-482-EDGG-1-Q4_42600 12 96 -TBLASTX ds2020-482-EDGG-1-Q4_107243 63 60 -TBLASTX ds2020-482-EDGG-1-Q4_2681 8 348 NC_011554 Blackberry chlorotic ringspot virus RNA2, complete genome Blackberry chlorotic ringspot virus 56.3 2 100 9.0 1.04985e-23 128.1421 339420 Viruses;Riboviria;Orthornavirae;Kitrinoviricota;Alsuviricetes;Martellivirales;Bromoviridae;Ilarvirus;Blackberry chlorotic ringspot virus CCTTCCTAGCGACCACGCACACGTCAAGACCGGCATCATCAATGTCGCGACAATCGTGAACCACTTTAGTATAGTCCACATCAAGATCATCATAAGGTAGATAAAAGGAATCAATTTCCCTAGGAAAAAGTCCAGAATCATCTTCCTCATAAAAATCTGGTATCGAGGGATCAATGGTTCGCACCACCATCTCGAATGTATCAAAGATCGTCGCGAAATCAAACTTTGCGGTATGCTTAACGACAAACTCGAAAAGGAAAAGTTTTACCCATTCGTCGTAGTTGTCATCTTTATGCACACCGAACGTCGAGAAAAACCCAAAGAACGTGTGCGTGGTCGCTAGGAAGG -TBLASTX ds2020-482-EDGG-1-Q4_107857 402 59 -TBLASTX ds2020-482-EDGG-1-Q4_63163 88 81 +TBLASTX NODE_13_length_295_cov_0.945833 264 295 316155 pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, Domain 2. This is a family of the conserved region of Leucine-tRNA ligase or Leucyl-tRNA synthetase, EC:6.1.1.4. Tursiops truncatus papillomavirus 2 41.5 1 100 67.0 2.277e-05 38.6378 316155 Viruses;Monodnaviria;Shotokuvirae;Cossaviricota;Papovaviricetes;Zurhausenvirales;Papillomaviridae;Firstpapillomavirinae;Upsilonpapillomavirus;Upsilonpapillomavirus 2;Tursiops truncatus papillomavirus 2 TGTGTTGGGTGTGTTTGGTTTCCGGTTACCATAATCGCTATTCTTTCAAACAGAAAGCGCATGCTAAGTATTCTCACCCAGAGGAATATGCTGACAAGCCCTCCTCAAAAGGCTATTTTTACAATGCCACCTATGAGAATGCACGAACTCTTATTCACTTCATTAAGCAATATGGATTGCCCTTCAATCCTGTTATTGCACCAGAAGATGCTGAACTAACTGATGAACAGATTCAATCTTACATCAACACAGCAAACTCCTTCTTTAATGATTATCCGACGTTACTGTTCACCCG +TBLASTX NODE_16_length_278_cov_0.901345 377 278 306845 pfam00421, PSII, Photosystem II protein. 65.8 1 100 47.0 7.65615e-39 132.634 GTCTAACCTGTGTTGGGTGTGTTTGGGCTGTAATCGAGGTATAGTGTCGAACAAGTCGGTGTCACTGTTGAATTCTATGGCGGCGAACTCAATGGAGTCAGTTATAGTGATCCTGCTACTGTGAAAAAATATGCTAGACGTGCTCAATTGGGTGAAATTTTTGAATTAGATCGTGCTACTTTAAAATCGGATGGTGTTTTTCGTAGCAGTCCAAGGGGTTGGTTTACTTTTGGACATGCGTCGTTTGCTCTGCTCTTCTTCCAAACACACCCAACACA +TBLASTX NODE_19_length_271_cov_0.879630 67 271 306845 pfam00421, PSII, Photosystem II protein. 32.9 1 100 42.0 1.69015e-11 56.3644 GTCTAACCTGTGTTGGGTGTGTTTGGTATGGAGGGAGGTGTATATGATACCTGGGCACCCGGAGGGGGAGATGTAAGAAAAATTACCAACTTGACCCTTAACCCAAGCGTGATATTTGGTTATTTACTAAAATCTCCTTTTGGGGGAGAAGGATGGATTGTTAGTGTGGACGATTTAGAAGATATAATTGGAGGACATGTCTGGTTAGGCTCCATTTGTATACTTGGTGGAATTTGGCATATCTTAACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_20_length_267_cov_1.429245 2 267 287774 pfam10839, DUF2647, Protein of unknown function (DUF2647). This eukaryotic family of proteins are annotated as ycf68 but have no known function. Desulfovibrio sp. G100IX 91.3 1 100 99.0 7.70073e-10 48.4966 287774 cellular organisms;Bacteria;Thermodesulfobacteriota;Desulfovibrionia;Desulfovibrionales;Desulfovibrionaceae;Desulfovibrio;unclassified Desulfovibrio;Desulfovibrio sp. G100IX CTGTGTTGGGTGTGTTTGGACTTGGTATGTGAAGATACGTTGTTAGGTGCTCCGTTTTATTTTCCCATTGAGGCCGAACCTAAACCTGTGCTCGAGAGATAGCTGTCCATATACTGATAAGGGATGTATGGATTCTCGAGAAGAGAGGAGCCATGGTGGTCCCTCCCGGACCGCCCGGATCCCACGAGTGAATAGAAAGTTGGATCTACATTGGATCTCACCTGAATCGCCCCATAAACAACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_22_length_262_cov_1.053140 262 262 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 40.9 1 100 77.0 4.94039e-28 99.6256 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j GTCTAACCTGTGTTGGGTGTGTTTGGCTAGTCAGTAGCTTGTTATATGGGTCGTGAGTGGGAAGTTAGCTTCCGTCTGGGTATGCGCCCGTGGATTGCTGTTGCATATTCAGCTCCTGTTGCAGCTGCTACTGCTGTTTTCTTGATTTACCCAATTGGTCAAGGAAGTTTTTCTGATGGTATGCCTCTAGGAATCTCTGGTACTTTCAACTTCATGATTGTATTCCAGGAGAGCACCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_24_length_258_cov_0.935961 101 258 307679 pfam01660, Vmethyltransf, Viral methyltransferase. This RNA methyltransferase domain is found in a wide range of ssRNA viruses, including Hordei-, Tobra-, Tobamo-, Bromo-, Clostero- and Caliciviruses. This methyltransferase is involved in mRNA capping. Capping of mRNA enhances its stability. This usually occurs in the nucleus. Therefore, many viruses that replicate in the cytoplasm encode their own. This is a specific guanine-7-methyltransferase domain involved in viral mRNA cap0 synthesis. Specificity for guanine 7 position is shown by NMR in and in vivo role in cap synthesis. Based on secondary structure prediction, the basic fold is believed to be similar to the common AdoMet-dependent methyltransferase fold. A curious feature of this methyltransferase domain is that it together with flanking sequences seems to have guanylyltransferase activity coupled to the methyltransferase activity. The domain is found throughout the so-called Alphavirus superfamily, (including alphaviruses and several other groups). It forms the defining, unique feature of this superfamily. Tetrastemma peltatum 39.4 1 100 70.0 8.38713e-15 65.0021 307679 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Spiralia;Lophotrochozoa;Nemertea;Enopla;Hoplonemertea;Monostilifera;Eumonostilifera;Tetrastemmatidae;Tetrastemma;Tetrastemma peltatum GTGTTGGGTGTGTTTGGTTGGTGAACGCGCACCATTTAGTGGCAATCACGCGCGGGGAGGCTGAAAACTGCAAGCATAGATCTTTCGGCCCTTTCGAAGCTACCGCTTCCGAGAGCCTGGCTAAACTCTGCCCAGATTATCCGATCTGCTTGCCTGTACCTTACGACGTGATCAATAAAGTGTATAGGTATCTCAGAACGCTTAAGAAGCCTGATGTGCAGTCGCCCCACTACCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_29_length_250_cov_0.851282 428 250 278700 pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. uncultured archaeon CRE-PA11a 58.6 1 100 100 7.31211e-08 42.0012 278700 cellular organisms;Archaea;environmental samples;uncultured archaeon CRE-PA11a GTCTAACCTGTGTTGGGTGTGTTTGGGTTTCTTTGGAGCAACTCGATGAATTTAGTAAATCCTTTTAGGAGGTTCCCAATGACCATAGATCGAACCTATCCAATTTTTACAGTGCGATGGTTGGCTGTTCACGGACTGGCTGTACCTACTGTTTCTTTTTTAGGGTCAATATCAGCAATGCAGTTCATCCAACGATAAACCTAATTCAAATTATAGAGCTAGCACACCAAACACACCCAACACAGGTTAG +TBLASTX NODE_34_length_245_cov_1.000000 183 245 250270 pfam00978, RdRP_2, RNA dependent RNA polymerase. This family may represent an RNA dependent RNA polymerase. The family also contains the following proteins: 2A protein from bromoviruses putative RNA dependent RNA polymerase from tobamoviruses Non structural polyprotein from togaviruses. Nocardia sp. 431D04 37.5 1 100 38.0 6.42106e-08 45.7137 250270 cellular organisms;Bacteria;Terrabacteria group;Actinomycetota;Actinomycetes;Mycobacteriales;Nocardiaceae;Nocardia;unclassified Nocardia;Nocardia sp. 431D04 GTCTAACCTGTGTTGGGTGTGTTTGGATGGTGATCGGCAATTTAAAGGAATGTGTGCGATATTTTCACCAATATTCAAGGAGCTTAAAAATCGACTAAAAAGCGTGTTAGATATTAAATACATGTATGCAGACGGATTGAGACCTGATCAGTTGTCGGAGCGCATGTCACAGATAGGTGCAGGTAAATATTTTATAGAGAATGATATGGAACAGCATCTCGCCAAACACACCCAACACAGGTTAG +TBLASTX NODE_46_length_229_cov_1.091954 471 229 306604 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Heterotermes sp. TMJ-2004j 43.9 1 100 66.0 4.26406e-23 86.1436 306604 cellular organisms;Eukaryota;Opisthokonta;Metazoa;Eumetazoa;Bilateria;Protostomia;Ecdysozoa;Panarthropoda;Arthropoda;Mandibulata;Pancrustacea;Hexapoda;Insecta;Dicondylia;Pterygota;Neoptera;Polyneoptera;Dictyoptera;Blattodea;Blattoidea;Termitoidae;Rhinotermitidae;Heterotermitinae;Heterotermes;unclassified Heterotermes;Heterotermes sp. TMJ-2004j TGTGTTGGGTGTGTTTGGTTGGATGCCTGGAATACAATCATGAAATTGAAAGTACCAGATATTCCTAAAGGCATGCCATCTGAAAAACTTCCTTGACCAATAGGGTAGATCAAGAAAACAGCTGTAGCAGCCGCGACAGGAGCTGAATATGCAACAGCAATCCAAGGACGCATACCCAGACGGAAACTAAGCTCCCTCTCGCTCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_47_length_229_cov_0.816092 470 229 306687 pfam00223, PsaA_PsaB, Photosystem I psaA/psaB protein. 66.7 1 100 14.0 1.79906e-13 61.3066 TTGGTAAATTGGCGGAAAGAGGAGGACTCAATGATTATTCGTTCGCCGGAACCAGAAGTAAAAATTTTGGTAGATAGGGATCACATAAAAACTTCTTTCGAGGAATGGGCCAGGCCGGGTCATTTCTCAAGAACACTAGCTAAAGGCCCTGACACTACCACTTGGATCTGGAACCTACATGCTGATGCTCACGATCTTAATAGCCAAACACACCCAACACAGGTTAGAC +TBLASTX NODE_50_length_226_cov_2.269006 315 226 306845 pfam00421, PSII, Photosystem II protein. 60.3 1 100 41.0 2.77182e-23 89.1064 GTCAACGGTGTGTTGGGTGTGTTTGGGAAAGGTCCTGGAATATGGGTGTCCGATCCTTATGGACTAACCGGAACAGTGCAACCTGTAAATCCGGCGTGGGGCGTGGAAGGTTTTGATCCTTTTGTCCCGGGAGGAATAGCTTCTCATCATATTGCAGCAGGTACATTGGGCATATTAGCGGGCCTATTCCATCTTAGCGTACGGTCACCCCAGCCAAACACACCCA +TBLASTX NODE_56_length_216_cov_1.180124 166 216 306795 pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. 26.7 1 100 62.0 5.23486e-07 42.6815 GTGTTGGGTGTGTTTGGGGTCTATGTGGTTTATTTGGTTCTACTGAACCAACATTAAATTTTGAAATATTAACTAATCAGTCCTATCCTGTGGCCTTGGAAATAATATTTTATATTGGATTTTTTCTTGCTTTTGCTGTAAAATTACCAATCATACCCCTACATACATGGTTACCAGATACCCACGAGAGCCAAACACACCCAACACAGGTTAGAC diff -r 84d20d9c292d -r fd7104249a3c test-data/rps_test.tab --- a/test-data/rps_test.tab Sat May 18 18:14:29 2024 +0000 +++ b/test-data/rps_test.tab Wed Aug 21 13:13:28 2024 +0000 @@ -1,105 +1,26 @@ #query_id query_length cdd_id hit_id evalue startQ endQ frame description superkingdom -ds2020-267_120 339 pfam01333 gnl|CDD|366578 0.000848733 197 325 -3 pfam01333, Apocytochr_F_C, Apocytochrome F, C-terminal. This is a sub-family of cytochrome C. See pfam00034. Eukaryota(19);Bacteria(1) -ds2020-267_374 242 pfam00124 gnl|CDD|365890 5.09126e-07 21 125 3 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Bacteria(10);Eukaryota(5);Viruses(4);unclassified sequences(1) -ds2020-267_471 230 pfam00201 gnl|CDD|278624 3.12575e-07 46 210 1 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase. Eukaryota(20) -ds2020-267_710 213 pfam01127 gnl|CDD|366480 0.000723904 46 210 1 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate reductase transmembrane subunit. This family includes a transmembrane protein from both the Succinate dehydrogenase and Fumarate reductase complexes. Bacteria(20) -ds2020-267_692 214 pfam00680 gnl|CDD|366242 4.79875e-05 70 180 1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_817 208 pfam05656 gnl|CDD|377540 3.45664e-06 86 190 -1 pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function. Bacteria(17);unclassified sequences(2);Archaea(1) -ds2020-267_98 379 pfam16203 gnl|CDD|374428 1.33948e-30 131 280 -1 pfam16203, ERCC3_RAD25_C, ERCC3/RAD25/XPB C-terminal helicase. This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases. Bacteria(11);Eukaryota(6);Archaea(2);unclassified sequences(1) -ds2020-267_21 858 pfam00680 gnl|CDD|366242 8.36679e-11 295 729 -1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_261 260 pfam01051 gnl|CDD|376444 1.77523e-19 26 217 -2 pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene. Bacteria(19);unclassified sequences(1) -ds2020-267_773 210 pfam01641 gnl|CDD|376583 5.23903e-34 16 174 1 pfam01641, SelR, SelR domain. Methionine sulfoxide reduction is an important process, by which cells regulate biological processes and cope with oxidative stress. MsrA, a protein involved in the reduction of methionine sulfoxides in proteins, has been known for four decades and has been extensively characterized with respect to structure and function. However, recent studies revealed that MsrA is only specific for methionine-S-sulfoxides. Because oxidized methionines occur in a mixture of R and S isomers in vivo, it was unclear how stereo-specific MsrA could be responsible for the reduction of all protein methionine sulfoxides. It appears that a second methionine sulfoxide reductase, SelR, evolved that is specific for methionine-R-sulfoxides, the activity that is different but complementary to that of MsrA. Thus, these proteins, working together, could reduce both stereoisomers of methionine sulfoxide. This domain is found both in SelR proteins and fused with the peptide methionine sulfoxide reductase enzymatic domain pfam01625. The domain has two conserved cysteine and histidines. The domain binds both selenium and zinc. The final cysteine is found to be replaced by the rare amino acid selenocysteine in some members of the family. This family has methionine-R-sulfoxide reductase activity. Bacteria(18);Archaea(1);unclassified sequences(1) -ds2020-267_287 256 pfam00115 gnl|CDD|376293 2.8946e-26 13 237 1 pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. Eukaryota(18);Bacteria(2) -ds2020-267_139 320 pfam05860 gnl|CDD|368641 1.34887e-13 167 298 2 pfam05860, Haemagg_act, haemagglutination activity domain. This domain is suggested to be a carbohydrate- dependent haemagglutination activity site. It is found in a range of haemagglutinins and haemolysins. Bacteria(20) -ds2020-267_763 211 pfam00557 gnl|CDD|376349 0.000231782 167 298 2 pfam00557, Peptidase_M24, Metallopeptidase family M24. This family contains metallopeptidases. It also contains non-peptidase homologs such as the N terminal domain of Spt16 which is a histone H3-H4 binding module. Bacteria(17);Archaea(2);unclassified sequences(1) -ds2020-267_571 221 pfam00501 gnl|CDD|366135 2.61467e-07 34 201 1 pfam00501, AMP-binding, AMP-binding enzyme. Bacteria(17);Eukaryota(2);unclassified sequences(1) -ds2020-267_565 222 pfam03950 gnl|CDD|377172 9.52435e-10 53 184 -3 pfam03950, tRNA-synt_1c_C, tRNA synthetases class I (E and Q), anti-codon binding domain. Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only glutamyl and glutaminyl tRNA synthetases. In some organisms, a single glutamyl-tRNA synthetase aminoacylates both tRNA(Glu) and tRNA(Gln). Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_427 235 pfam03154 gnl|CDD|367360 0.000552392 53 184 -3 pfam03154, Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Eukaryota(20) -ds2020-267_4 2297 pfam00680 gnl|CDD|366242 4.43825e-05 995 1510 -2 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_16 1165 pfam00680 gnl|CDD|366242 8.1737e-06 707 1042 -1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_438 234 pfam00078 gnl|CDD|365856 0.000870142 707 1042 -1 pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase). A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. Eukaryota(16);Viruses(4) -ds2020-267_370 242 pfam00146 gnl|CDD|376297 2.41391e-10 22 111 1 pfam00146, NADHdh, NADH dehydrogenase. Bacteria(14);Eukaryota(3);Archaea(2);unclassified sequences(1) -ds2020-267_278 258 pfam00012 gnl|CDD|365808 4.1355e-19 50 232 2 pfam00012, HSP70, Hsp70 protein. Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region. Bacteria(15);Eukaryota(4);Viruses(1) -ds2020-267_364 243 pfam00216 gnl|CDD|365952 1.5507e-10 134 241 -3 pfam00216, Bac_DNA_binding, Bacterial DNA-binding protein. Bacteria(19);unclassified sequences(1) -ds2020-267_558 222 pfam03737 gnl|CDD|377116 4.93695e-13 57 179 -2 pfam03737, RraA-like, Aldolase/RraA. Members of this family include regulator of ribonuclease E activity A (RraA) and 4-hydroxy-4-methyl-2-oxoglutarate (HMG)/4-carboxy- 4-hydroxy-2-oxoadipate (CHA) aldolase, also known as RraA-like protein. RraA acts as a trans-acting modulator of RNA turnover, binding essential endonuclease RNase E and inhibiting RNA processing. RraA-like proteins seem to contain aldolase and/or decarboxylase activity either in place of or in addition to the RNase E inhibitor functions. Bacteria(19);unclassified sequences(1) -ds2020-267_218 274 pfam01348 gnl|CDD|279664 1.66328e-05 51 257 3 pfam01348, Intron_maturas2, Type II intron maturase. Group II introns use intron-encoded reverse transcriptase, maturase and DNA endonuclease activities for site-specific insertion into DNA. Although this type of intron is self splicing in vitro they require a maturase protein for splicing in vivo. It has been shown that a specific region of the aI2 intron is needed for the maturase function. This region was found to be conserved in group II introns and called domain X. Eukaryota(16);Bacteria(4) -ds2020-267_363 243 pfam00416 gnl|CDD|366086 2.02528e-05 15 134 -2 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18. This family includes ribosomal protein S13 from prokaryotes and S18 from eukaryotes. Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_746 211 pfam01490 gnl|CDD|279788 0.000177299 15 134 -2 pfam01490, Aa_trans, Transmembrane amino acid transporter protein. This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases. Eukaryota(20) -ds2020-267_145 315 pfam02626 gnl|CDD|376868 3.97676e-05 140 256 -3 pfam02626, CT_A_B, Carboxyltransferase domain, subdomain A and B. Urea carboxylase (UC) catalyzes a two-step, ATP- and biotin-dependent carboxylation reaction of urea. It is composed of biotin carboxylase (BC), carboxyltransferase (CT), and biotin carboxyl carrier protein (BCCP) domains. The CT domain of UC consists of four subdomains, named A, B, C and D. This domain covers the A and B subdomains of the CT domain. This domain covers the whole length of KipA (kinase A) from Bacillus subtilis. It can also be found in S. cerevisiae urea amidolyase Dur1,2, which is a multifunctional biotin-dependent enzyme with domains for urea carboxylase and allophanate (urea carboxylate) hydrolase activity. Bacteria(19);unclassified sequences(1) -ds2020-267_637 217 pfam07026 gnl|CDD|284449 1.36077e-13 47 172 2 pfam07026, DUF1317, Protein of unknown function (DUF1317). This family consists of several hypothetical bacterial and phage proteins of around 60 residues in length. The function of this family is unknown. Bacteria(20) -ds2020-267_557 222 pfam00421 gnl|CDD|366090 3.32623e-20 12 200 -2 pfam00421, PSII, Photosystem II protein. Eukaryota(13);Bacteria(7) -ds2020-267_117 344 pfam00252 gnl|CDD|376306 7.27175e-23 107 295 2 pfam00252, Ribosomal_L16, Ribosomal protein L16p/L10e. Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_352 245 pfam00946 gnl|CDD|366381 3.23548e-05 1 141 1 pfam00946, Mononeg_RNA_pol, Mononegavirales RNA dependent RNA polymerase. Members of the Mononegavirales including the Paramyxoviridae, like other non-segmented negative strand RNA viruses, have an RNA-dependent RNA polymerase composed of two subunits, a large protein L and a phosphoprotein P. This is a protein family of the L protein. The L protein confers the RNA polymerase activity on the complex. The P protein acts as a transcription factor. Viruses(20) -ds2020-267_97 380 pfam04879 gnl|CDD|368171 1.9903e-08 125 274 -2 pfam04879, Molybdop_Fe4S4, Molybdopterin oxidoreductase Fe4S4 domain. This domain is found in formate dehydrogenase H for which the structure is known. This first domain (residues 1 to 60) of Structure 1aa6 is an Fe4S4 cluster just below the protein surface. Bacteria(19);unclassified sequences(1) -ds2020-267_2 2436 pfam02123 gnl|CDD|280316 2.17343e-21 184 1476 1 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_595 219 pfam02123 gnl|CDD|280316 5.90575e-11 13 210 1 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_622 217 pfam01370 gnl|CDD|366597 1.5719e-08 50 172 2 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions. Bacteria(17);unclassified sequences(2);Archaea(1) -ds2020-267_214 276 pfam00070 gnl|CDD|365851 1.70856e-05 135 254 3 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain. Eukaryota(11);Bacteria(6);unclassified sequences(2);Archaea(1) -ds2020-267_610 218 pfam17759 gnl|CDD|380005 1.47034e-13 25 195 1 pfam17759, tRNA_synthFbeta, Phenylalanyl tRNA synthetase beta chain CLM domain. This domain corresponds to the catalytic like domain (CLM) in the beta chain of phe tRNA synthetase. Bacteria(17);Archaea(2);unclassified sequences(1) -ds2020-267_94 386 pfam01347 gnl|CDD|366585 0.000224462 25 195 1 pfam01347, Vitellogenin_N, Lipoprotein amino terminal region. This family contains regions from: Vitellogenin, Microsomal triglyceride transfer protein and apolipoprotein B-100. These proteins are all involved in lipid transport. This family contains the LV1n chain from lipovitellin, that contains two structural domains. Eukaryota(20) -ds2020-267_323 250 pfam00227 gnl|CDD|365960 5.8155e-09 10 150 -2 pfam00227, Proteasome, Proteasome subunit. The proteasome is a multisubunit structure that degrades proteins. Protein degradation is an essential component of regulation because proteins can become misfolded, damaged, or unnecessary. Proteasomes and their homologs vary greatly in complexity: from HslV (heat shock locus v), which is encoded by 1 gene in bacteria, to the eukaryotic 20S proteasome, which is encoded by more than 14 genes. Recently evidence of two novel groups of bacterial proteasomes was proposed. The first is Anbu, which is sparsely distributed among cyanobacteria and proteobacteria. The second is call beta-proteobacteria proteasome homolog (BPH). Eukaryota(8);Bacteria(6);Archaea(6) -ds2020-267_168 298 pfam13546 gnl|CDD|379252 0.000766911 10 150 -2 pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Bacteria(18);unclassified sequences(2) -ds2020-267_636 217 pfam13812 gnl|CDD|316342 0.000111468 16 123 -2 pfam13812, PPR_3, Pentatricopeptide repeat domain. This family matches additional variants of the PPR repeat that were not captured by the model for pfam01535. In the case of the Arabidopsis protein UniProtKB:Q66GI4, the repeated helices in this N-terminal region, of protein-only RNase P (PRORP) enzymes, form the pentatricopeptide repeat (PPR) domain which enhances pre-tRNA binding affinity. PROPRP enzymes process precursor tRNAs in human mitochondria and in all tRNA-using compartments of Arabidopsis thaliana. Eukaryota(20) -ds2020-267_486 228 pfam17035 gnl|CDD|374956 5.12677e-09 108 203 3 pfam17035, BET, Bromodomain extra-terminal - transcription regulation. The BET, or bromodomain extra-terminal domain, is found on bromodomain proteins that play key roles in development, cancer progression and virus-host pathogenesis. It interacts with NSD3, JMJD6, CHD4, GLTSCR1, and ATAD5 all of which are shown to impart a pTEFb-independent transcriptional activation function on the bromodomain proteins. Eukaryota(20) -ds2020-267_599 219 pfam05717 gnl|CDD|377551 3.2952e-06 28 147 1 pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition. Bacteria(19);unclassified sequences(1) -ds2020-267_837 207 pfam04061 gnl|CDD|367791 2.43363e-18 1 159 1 pfam04061, ORMDL, ORMDL family. Evidence form suggests that ORMDLs are involved in protein folding in the ER. Orm proteins have been identified as negative regulators of sphingolipid synthesis that form a conserved complex with serine palmitoyltransferase, the first and rate-limiting enzyme in sphingolipid production. This novel and conserved protein complex, has been termed the SPOTS complex (serine palmitoyltransferase, Orm1/2, Tsc3, and Sac1). Eukaryota(20) -ds2020-267_516 225 pfam00115 gnl|CDD|376293 0.000272517 1 159 1 pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. Eukaryota(18);Bacteria(2) -ds2020-267_529 224 pfam00510 gnl|CDD|366140 6.14777e-23 35 211 2 pfam00510, COX3, Cytochrome c oxidase subunit III. Bacteria(15);Eukaryota(3);unclassified sequences(1);Archaea(1) -ds2020-267_230 268 pfam00115 gnl|CDD|376293 1.95663e-15 81 236 -3 pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. Eukaryota(18);Bacteria(2) -ds2020-267_444 233 pfam00680 gnl|CDD|366242 0.00060937 81 236 -3 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_336 248 pfam00113 gnl|CDD|365883 4.23282e-13 15 116 -1 pfam00113, Enolase_C, Enolase, C-terminal TIM barrel domain. Bacteria(17);Archaea(2);unclassified sequences(1) -ds2020-267_365 243 pfam13041 gnl|CDD|372443 0.000129396 15 116 -1 pfam13041, PPR_2, PPR repeat family. This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Eukaryota(20) -ds2020-267_75 425 pfam00005 gnl|CDD|365804 4.26261e-07 129 275 -1 pfam00005, ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains. Bacteria(19);unclassified sequences(1) -ds2020-267_8 1703 pfam00680 gnl|CDD|366242 2.85682e-13 685 1458 -3 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_114 347 pfam00471 gnl|CDD|376336 8.05888e-12 132 302 3 pfam00471, Ribosomal_L33, Ribosomal protein L33. Bacteria(20) -ds2020-267_589 219 pfam12161 gnl|CDD|378823 0.0004347 132 302 3 pfam12161, HsdM_N, HsdM N-terminal domain. This domain is found at the N-terminus of the methylase subunit of Type I DNA methyltransferases. This domain family is found in bacteria and archaea, and is typically between 123 and 138 amino acids in length. The family is found in association with pfam02384. Mutations in this region of EcoKI methyltransferase abolish the normally strong preference of this system for methylating hemimethylated substrate. The structure of this domain has been shown to be all alpha-helical. Bacteria(20) -ds2020-267_206 279 pfam03947 gnl|CDD|377170 2.63457e-16 155 265 2 pfam03947, Ribosomal_L2_C, Ribosomal Proteins L2, C-terminal domain. Bacteria(15);Archaea(4);Eukaryota(1) -ds2020-267_316 251 pfam02123 gnl|CDD|280316 3.50628e-08 28 228 -3 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_697 214 pfam00378 gnl|CDD|334046 5.08319e-08 45 170 -3 pfam00378, ECH_1, Enoyl-CoA hydratase/isomerase. This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. Bacteria(17);unclassified sequences(2);Archaea(1) -ds2020-267_318 251 pfam00252 gnl|CDD|376306 5.63854e-12 78 206 -1 pfam00252, Ribosomal_L16, Ribosomal protein L16p/L10e. Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_20 893 pfam02874 gnl|CDD|367225 7.30466e-19 126 329 3 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain. This family includes the ATP synthase alpha and beta subunits the ATP synthase associated with flagella. Bacteria(17);Eukaryota(2);Archaea(1) -ds2020-267_329 249 pfam13173 gnl|CDD|379049 4.80752e-08 106 249 1 pfam13173, AAA_14, AAA domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Bacteria(19);Archaea(1) -ds2020-267_130 330 pfam00680 gnl|CDD|366242 7.64962e-05 124 282 1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_280 257 pfam01788 gnl|CDD|366811 2.47901e-09 132 224 -1 pfam01788, PsbJ, PsbJ. This family consists of the photosystem II reaction centre protein PsbJ from plants and Cyanobacteria. In Synechocystis sp. PCC 6803 PsbJ regulates the number of photosystem II centers in thylakoid membranes, it is a predicted 4kDa protein with one membrane spanning domain. Eukaryota(17);Bacteria(3) -ds2020-267_100 376 pfam00401 gnl|CDD|366077 8.90041e-05 87 218 -3 pfam00401, ATP-synt_DE, ATP synthase, Delta/Epsilon chain, long alpha-helix domain. Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. This subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213). Bacteria(18);unclassified sequences(2) -ds2020-267_436 234 pfam00155 gnl|CDD|365910 0.000283584 87 218 -3 pfam00155, Aminotran_1_2, Aminotransferase class I and II. Bacteria(19);Archaea(1) -ds2020-267_210 276 pfam17919 gnl|CDD|375430 6.42624e-11 52 237 1 pfam17919, RT_RNaseH_2, RNase H-like domain found in reverse transcriptase. Eukaryota(20) -ds2020-267_58 476 pfam03641 gnl|CDD|367590 7.19579e-14 142 315 -3 pfam03641, Lysine_decarbox, Possible lysine decarboxylase. The members of this family share a highly conserved motif PGGXGTXXE that is probably functionally important. This family includes proteins annotated as lysine decarboxylases, although the evidence for this is not clear. Bacteria(17);Eukaryota(2);unclassified sequences(1) -ds2020-267_466 230 pfam00072 gnl|CDD|333815 5.42419e-08 50 208 2 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Bacteria(20) -ds2020-267_118 343 pfam00421 gnl|CDD|366090 7.68219e-41 92 337 -1 pfam00421, PSII, Photosystem II protein. Eukaryota(13);Bacteria(7) -ds2020-267_643 216 pfam00078 gnl|CDD|365856 0.000675747 92 337 -1 pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase). A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. Eukaryota(16);Viruses(4) -ds2020-267_5 2029 pfam00680 gnl|CDD|366242 0.000288253 92 337 -1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(20) -ds2020-267_506 226 pfam05173 gnl|CDD|377479 2.45773e-17 93 215 -3 pfam05173, DapB_C, Dihydrodipicolinate reductase, C-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The C-terminal domain of DapB has been proposed to be the substrate- binding domain. Bacteria(19);unclassified sequences(1) -ds2020-267_315 251 pfam13426 gnl|CDD|379177 0.000472059 32 241 2 pfam13426, PAS_9, PAS domain. Bacteria(19);unclassified sequences(1) -ds2020-267_227 272 pfam00873 gnl|CDD|334294 2.32215e-15 36 245 -1 pfam00873, ACR_tran, AcrB/AcrD/AcrF family. Members of this family are integral membrane proteins. Some are involved in drug resistance. AcrB cooperates with a membrane fusion protein, AcrA, and an outer membrane channel TolC. The structure shows the AcrB forms a homotrimer. Bacteria(20) -ds2020-267_639 216 pfam00033 gnl|CDD|306530 3.68894e-05 2 118 2 pfam00033, Cytochrome_B, Cytochrome b/b6/petB. Eukaryota(16);Bacteria(4) -ds2020-267_407 239 pfam00177 gnl|CDD|365924 1.14399e-06 28 126 1 pfam00177, Ribosomal_S7, Ribosomal protein S7p/S5e. This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes. Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_457 231 pfam00481 gnl|CDD|366121 0.000499491 28 126 1 pfam00481, PP2C, Protein phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase. Eukaryota(20) -ds2020-267_402 239 pfam06122 gnl|CDD|368759 0.000851192 28 126 1 pfam06122, TraH, Conjugative relaxosome accessory transposon protein. The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon. Bacteria(20) -ds2020-267_369 243 pfam12137 gnl|CDD|378818 6.51052e-05 137 217 -3 pfam12137, RapA_C, RNA polymerase recycling family C-terminal. This domain is found in bacteria. This domain is about 360 amino acids in length. This domain is found associated with pfam00271, pfam00176. The function of this domain is not known, but structurally it forms an alpha-beta fold in nature with a central beta-sheet flanked by helices and loops, the beta-sheet being mainly antiparallel and flanked by four alpha helices, among which the two longer helices exhibit a coiled-coil arrangement. Bacteria(19);unclassified sequences(1) -ds2020-267_750 211 pfam02391 gnl|CDD|376774 1.24642e-05 28 114 -2 pfam02391, MoaE, MoaE protein. This family contains the MoaE protein that is involved in biosynthesis of molybdopterin. Molybdopterin, the universal component of the pterin molybdenum cofactors, contains a dithiolene group serving to bind Mo. Addition of the dithiolene sulfurs to a molybdopterin precursor requires the activity of the converting factor. Converting factor contains the MoaE and MoaD proteins. Bacteria(17);Archaea(2);unclassified sequences(1) -ds2020-267_428 235 pfam00164 gnl|CDD|333891 1.04166e-24 3 182 3 pfam00164, Ribosom_S12_S23, Ribosomal protein S12/S23. This protein is known as S12 in bacteria and archaea and S23 in eukaryotes. Bacteria(16);Archaea(3);Eukaryota(1) -ds2020-267_203 281 pfam03040 gnl|CDD|367312 1.76794e-22 121 231 -3 pfam03040, CemA, CemA family. Members of this family are probable integral membrane proteins. Their molecular function is unknown. CemA proteins are found in the inner envelope membrane of chloroplasts but not in the thylakoid membrane. A cyanobacterial member of this family has been implicated in CO2 transport, but is probably not a CO2 transporter itself. They are predicted to be haem-binding however this has not been proven experimentally. Eukaryota(20) -ds2020-267_33 680 pfam04157 gnl|CDD|367847 4.86455e-13 342 494 -1 pfam04157, EAP30, EAP30/Vps36 family. This family includes EAP30 as well as the Vps36 protein. Vps36 is involved in Golgi to endosome trafficking. EAP30 is a subunit of the ELL complex. The ELL is an 80-kDa RNA polymerase II transcription factor. ELL interacts with three other proteins to form the complex known as ELL complex. The ELL complex is capable of increasing that catalytic rate of transcription elongation, but is unable to repress initiation of transcription by RNA polymerase II as is the case of ELL. EAP30 is thought to lead to the derepression of ELL's transcriptional inhibitory activity. Eukaryota(17);Archaea(3) -ds2020-267_6 1860 pfam02123 gnl|CDD|280316 1.35634e-17 1147 1764 -1 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_555 222 pfam00124 gnl|CDD|365890 7.71427e-08 48 203 3 pfam00124, Photo_RC, Photosynthetic reaction centre protein. Bacteria(10);Eukaryota(5);Viruses(4);unclassified sequences(1) -ds2020-267_550 223 pfam05694 gnl|CDD|377548 0.00097637 48 203 3 pfam05694, SBP56, 56kDa selenium binding protein (SBP56). This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homolog of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport. Bacteria(12);Eukaryota(8) -ds2020-267_65 462 pfam13406 gnl|CDD|372592 4.82338e-27 145 360 -1 pfam13406, SLT_2, Transglycosylase SLT domain. This family is related to the SLT domain pfam01464. Bacteria(19);unclassified sequences(1) -ds2020-267_729 212 pfam01405 gnl|CDD|279713 5.43744e-05 19 99 -3 pfam01405, PsbT, Photosystem II reaction centre T protein. The exact function of this protein is unknown. It probably consists of a single transmembrane spanning helix. The Chlamydomonas reinhardtii psbT protein appears to be (i) a novel photosystem II subunit and (ii) required for maintaining optimal photosystem II activity under adverse growth conditions. Eukaryota(17);Bacteria(3) -ds2020-267_404 239 pfam00361 gnl|CDD|366050 3.50341e-05 70 219 1 pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. Bacteria(16);Eukaryota(2);Archaea(1);unclassified sequences(1) -ds2020-267_312 252 pfam00585 gnl|CDD|278982 1.52007e-05 29 166 2 pfam00585, Thr_dehydrat_C, C-terminal regulatory domain of Threonine dehydratase. Threonine dehydratases pfam00291 all contain a carboxy terminal region. This region may have a regulatory role. Some members contain two copies of this region. This family is homologous to the pfam01842 domain. Bacteria(19);unclassified sequences(1) -ds2020-267_176 291 pfam01235 gnl|CDD|376500 1.13408e-29 115 243 1 pfam01235, Na_Ala_symp, Sodium:alanine symporter family. Bacteria(19);unclassified sequences(1) -ds2020-267_388 241 pfam02123 gnl|CDD|280316 6.16383e-08 35 214 -1 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_669 215 pfam17862 gnl|CDD|380037 4.46873e-06 33 122 -1 pfam17862, AAA_lid_3, AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the C-terminus of AAA domains. Eukaryota(9);Bacteria(8);Archaea(3) -ds2020-267_187 287 pfam02673 gnl|CDD|376891 3.59766e-13 7 156 1 pfam02673, BacA, Bacitracin resistance protein BacA. Bacitracin resistance protein (BacA) is a putative undecaprenol kinase. BacA confers resistance to bacitracin, probably by phosphorylation of undecaprenol. More recent studies show that BacA has undecaprenyl pyrophosphate phosphatase activity. Undecaprenyl phosphate is a key lipid intermediate involved in the synthesis of various bacterial cell wall polymers. Bacitracin, a mixture of related cyclic polypeptide antibiotics, is used to treat surface tissue infections. Its primary mode of action is the inhibition of bacterial cell wall synthesis through sequestration of the essential carrier lipid undecaprenyl pyrophosphate, C55-PP, resulting in the loss of cell integrity and lysis. The characteristic phosphatase sequence-motif in this family is likely to be the PGxSRSGG, compared with the PSGH of the PAP family of phosphatases. Bacteria(19);unclassified sequences(1) -ds2020-267_641 216 pfam00804 gnl|CDD|366315 9.72957e-23 23 187 -3 pfam00804, Syntaxin, Syntaxin. Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins (pfam05739), and an N-terminal domain that is featured in this entry. This domain varies between syntaxin isoforms; in syntaxin 1A it is found as three alpha-helices with a left-handed twist. It may fold back on the SNARE domain to allow the molecule to adopt a 'closed' configuration that prevents formation of the core fusion complex - it thus has an auto-inhibitory role. The function of syntaxins is determined by their localization. They are involved in neuronal exocytosis, ER-Golgi transport and Golgi-endosome transport, for example. They also interact with other proteins as well as those involved in SNARE complexes. These include vesicle coat proteins, Rab GTPases, and tethering factors. Eukaryota(20) -ds2020-267_597 219 pfam00421 gnl|CDD|366090 8.10522e-27 22 207 1 pfam00421, PSII, Photosystem II protein. Eukaryota(13);Bacteria(7) -ds2020-267_268 259 pfam02123 gnl|CDD|280316 3.22949e-21 18 251 3 pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. Viruses(19);unclassified sequences(1) -ds2020-267_719 213 pfam00072 gnl|CDD|333815 9.1657e-13 45 185 -2 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Bacteria(20) -ds2020-267_811 208 pfam07991 gnl|CDD|285265 1.80927e-08 20 190 -1 pfam07991, IlvN, Acetohydroxy acid isomeroreductase, NADPH-binding domain. Acetohydroxy acid isomeroreductase catalyzes the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine. This N-terminal region of the enzyme carries the binding-site for NADPH. The active-site for enzymatic activity lies in the C-terminal part, IlvC, pfam01450. Bacteria(16);Archaea(2);unclassified sequences(2) -ds2020-267_642 216 pfam02874 gnl|CDD|367225 0.000376273 20 190 -1 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain. This family includes the ATP synthase alpha and beta subunits the ATP synthase associated with flagella. Bacteria(17);Eukaryota(2);Archaea(1) -ds2020-267_504 226 pfam01578 gnl|CDD|307628 0.000112784 20 190 -1 pfam01578, Cytochrom_C_asm, Cytochrome C assembly protein. This family consists of various proteins involved in cytochrome c assembly from mitochondria and bacteria; CycK from Rhizobium, CcmC from E. coli and Paracoccus denitrificans and orf240 from wheat mitochondria. The members of this family are probably integral membrane proteins with six predicted transmembrane helices. It has been proposed that members of this family comprise a membrane component of an ABC (ATP binding cassette) transporter complex. It is also proposed that this transporter is necessary for transport of some component needed for cytochrome c assembly. One member CycK contains a putative heme-binding motif, orf240 also contains a putative heme-binding motif and is a proposed ABC transporter with c-type heme as its proposed substrate. However it seems unlikely that all members of this family transport heme nor c-type apocytochromes because CcmC in the putative CcmABC transporter transports neither. CcmF forms a working module with CcmH and CcmI, CcmFHI, and itself is unlikely to bind haem directly. Bacteria(19);Archaea(1) -ds2020-267_274 258 pfam03713 gnl|CDD|367619 9.45376e-09 24 173 -2 pfam03713, DUF305, Domain of unknown function (DUF305). Domain found in small family of bacterial secreted proteins with no known function. Also found in Paramecium bursaria chlorella virus 1. This domain is short and found in one or two copies. The domain has a conserved HH motif that may be functionally important. This domain belongs to the ferritin superfamily. It contains two sequence similar repeats each of which is composed of two alpha helices. Bacteria(18);unclassified sequences(2) -ds2020-267_42 575 pfam00283 gnl|CDD|365999 2.95472e-07 325 411 1 pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. Eukaryota(18);Bacteria(2) -ds2020-267_283 257 pfam13041 gnl|CDD|372443 3.148e-06 13 114 1 pfam13041, PPR_2, PPR repeat family. This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Eukaryota(20) -ds2020-267_685 214 pfam09334 gnl|CDD|370442 1.80219e-14 16 117 -2 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M). This family includes methionyl tRNA synthetases. Bacteria(16);Archaea(3);unclassified sequences(1) +ds2020-267_120 339 pfam01333 gnl|CDD|366578 0.000848733 197 325 -3 pfam01333, Apocytochr_F_C, Apocytochrome F, C-terminal. This is a sub-family of cytochrome C. See pfam00034. cellular organisms(1);Eukaryota(1);Viridiplantae(1);Streptophyta(1) +ds2020-267_374 242 pfam00124 gnl|CDD|365890 5.09126e-07 21 125 3 pfam00124, Photo_RC, Photosynthetic reaction centre protein. cellular organisms(1);Eukaryota(1);Viridiplantae(1);Streptophyta(1) +ds2020-267_471 230 pfam00201 gnl|CDD|278624 3.12575e-07 46 210 1 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase. cellular organisms(1);Eukaryota(1);Viridiplantae(1);Streptophytina(1) +ds2020-267_710 213 pfam01127 gnl|CDD|366480 0.000723904 46 210 1 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate reductase transmembrane subunit. This family includes a transmembrane protein from both the Succinate dehydrogenase and Fumarate reductase complexes. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_692 214 pfam00680 gnl|CDD|366242 4.79875e-05 70 180 1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(1);Riboviria(1);Orthornavirae(1);Pisuviricota(1) +ds2020-267_817 208 pfam05656 gnl|CDD|377540 3.45664e-06 86 190 -1 pfam05656, DUF805, Protein of unknown function (DUF805). This family consists of several bacterial proteins of unknown function. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_98 379 pfam16203 gnl|CDD|374428 1.33948e-30 131 280 -1 pfam16203, ERCC3_RAD25_C, ERCC3/RAD25/XPB C-terminal helicase. This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases. cellular organisms(2);Bacteria(1);Terrabacteria group(1) +ds2020-267_261 260 pfam01051 gnl|CDD|376444 1.77523e-19 26 217 -2 pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene. cellular organisms(1);Bacteria(1);Pseudomonadota(1);Gammaproteobacteria(1) +ds2020-267_773 210 pfam01641 gnl|CDD|376583 5.23903e-34 16 174 1 pfam01641, SelR, SelR domain. Methionine sulfoxide reduction is an important process, by which cells regulate biological processes and cope with oxidative stress. MsrA, a protein involved in the reduction of methionine sulfoxides in proteins, has been known for four decades and has been extensively characterized with respect to structure and function. However, recent studies revealed that MsrA is only specific for methionine-S-sulfoxides. Because oxidized methionines occur in a mixture of R and S isomers in vivo, it was unclear how stereo-specific MsrA could be responsible for the reduction of all protein methionine sulfoxides. It appears that a second methionine sulfoxide reductase, SelR, evolved that is specific for methionine-R-sulfoxides, the activity that is different but complementary to that of MsrA. Thus, these proteins, working together, could reduce both stereoisomers of methionine sulfoxide. This domain is found both in SelR proteins and fused with the peptide methionine sulfoxide reductase enzymatic domain pfam01625. The domain has two conserved cysteine and histidines. The domain binds both selenium and zinc. The final cysteine is found to be replaced by the rare amino acid selenocysteine in some members of the family. This family has methionine-R-sulfoxide reductase activity. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_287 256 pfam00115 gnl|CDD|376293 2.8946e-26 13 237 1 pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. cellular organisms(1);Eukaryota(1);Opisthokonta(1);Metazoa(1) +ds2020-267_139 320 pfam05860 gnl|CDD|368641 1.34887e-13 167 298 2 pfam05860, Haemagg_act, haemagglutination activity domain. This domain is suggested to be a carbohydrate- dependent haemagglutination activity site. It is found in a range of haemagglutinins and haemolysins. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_763 211 pfam00557 gnl|CDD|376349 0.000231782 167 298 2 pfam00557, Peptidase_M24, Metallopeptidase family M24. This family contains metallopeptidases. It also contains non-peptidase homologs such as the N terminal domain of Spt16 which is a histone H3-H4 binding module. cellular organisms(2);Bacteria(2) +ds2020-267_571 221 pfam00501 gnl|CDD|366135 2.61467e-07 34 201 1 pfam00501, AMP-binding, AMP-binding enzyme. Bacteria(2);cellular organisms(1);Terrabacteria group(1) +ds2020-267_565 222 pfam03950 gnl|CDD|377172 9.52435e-10 53 184 -3 pfam03950, tRNA-synt_1c_C, tRNA synthetases class I (E and Q), anti-codon binding domain. Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only glutamyl and glutaminyl tRNA synthetases. In some organisms, a single glutamyl-tRNA synthetase aminoacylates both tRNA(Glu) and tRNA(Gln). cellular organisms(2);Bacteria(1);Eukaryota(1) +ds2020-267_427 235 pfam03154 gnl|CDD|367360 0.000552392 53 184 -3 pfam03154, Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Eukaryota(1);cellular organisms(1);Opisthokonta(1);Metazoa(1) +ds2020-267_4 2297 pfam00680 gnl|CDD|366242 4.43825e-05 995 1510 -2 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(1);Riboviria(1);Orthornavirae(1);Pisuviricota(1) +ds2020-267_16 1165 pfam00680 gnl|CDD|366242 8.1737e-06 707 1042 -1 pfam00680, RdRP_1, RNA dependent RNA polymerase. Viruses(1);Riboviria(1);Orthornavirae(1);Pisuviricota(1) +ds2020-267_438 234 pfam00078 gnl|CDD|365856 0.000870142 707 1042 -1 pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase). A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. Viruses(1);Riboviria(1);Pararnavirae(1);Artverviricota(1) +ds2020-267_370 242 pfam00146 gnl|CDD|376297 2.41391e-10 22 111 1 pfam00146, NADHdh, NADH dehydrogenase. cellular organisms(1);Eukaryota(1);Opisthokonta(1);Metazoa(1) +ds2020-267_278 258 pfam00012 gnl|CDD|365808 4.1355e-19 50 232 2 pfam00012, HSP70, Hsp70 protein. Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region. cellular organisms(2);Eukaryota(1);Bacteria(1) +ds2020-267_364 243 pfam00216 gnl|CDD|365952 1.5507e-10 134 241 -3 pfam00216, Bac_DNA_binding, Bacterial DNA-binding protein. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_558 222 pfam03737 gnl|CDD|377116 4.93695e-13 57 179 -2 pfam03737, RraA-like, Aldolase/RraA. Members of this family include regulator of ribonuclease E activity A (RraA) and 4-hydroxy-4-methyl-2-oxoglutarate (HMG)/4-carboxy- 4-hydroxy-2-oxoadipate (CHA) aldolase, also known as RraA-like protein. RraA acts as a trans-acting modulator of RNA turnover, binding essential endonuclease RNase E and inhibiting RNA processing. RraA-like proteins seem to contain aldolase and/or decarboxylase activity either in place of or in addition to the RNase E inhibitor functions. Bacteria(2);cellular organisms(1);Pseudomonadota(1) +ds2020-267_218 274 pfam01348 gnl|CDD|279664 1.66328e-05 51 257 3 pfam01348, Intron_maturas2, Type II intron maturase. Group II introns use intron-encoded reverse transcriptase, maturase and DNA endonuclease activities for site-specific insertion into DNA. Although this type of intron is self splicing in vitro they require a maturase protein for splicing in vivo. It has been shown that a specific region of the aI2 intron is needed for the maturase function. This region was found to be conserved in group II introns and called domain X. cellular organisms(1);Eukaryota(1);Viridiplantae(1);Streptophyta(1) +ds2020-267_363 243 pfam00416 gnl|CDD|366086 2.02528e-05 15 134 -2 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18. This family includes ribosomal protein S13 from prokaryotes and S18 from eukaryotes. cellular organisms(2);Bacteria(2) +ds2020-267_746 211 pfam01490 gnl|CDD|279788 0.000177299 15 134 -2 pfam01490, Aa_trans, Transmembrane amino acid transporter protein. This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases. cellular organisms(1);Eukaryota(1);Opisthokonta(1);Metazoa(1) diff -r 84d20d9c292d -r fd7104249a3c test-data/rps_test.xml --- a/test-data/rps_test.xml Sat May 18 18:14:29 2024 +0000 +++ b/test-data/rps_test.xml Wed Aug 21 13:13:28 2024 +0000 @@ -1196,613 +1196,6 @@ - 49 - ds2020-267_321 - No definition line - 250 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 50 - ds2020-267_940 - No definition line - 128 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 51 - ds2020-267_61 - No definition line - 465 - - - - - 17919 - 3004588 - 79 - 120763012 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 52 - ds2020-267_21 - No definition line - 858 - - - 1 - gnl|CDD|366242 - pfam00680, RdRP_1, RNA dependent RNA polymerase. - 366242 - 470 - - - 1 - 60.0628 - 146 - 8.36679e-11 - 295 - 729 - 205 - 342 - -1 - 0 - 33 - 59 - 13 - 148 - PIAVGQSWYHGGSQEFIDRMAPFDKFFCFDAKKFDSSINEWMVTIAINICRKQYYDGDNP---DYDTYWAFVAESLLRAPIYRDDGVRMQKYVGTTSGHSHNTLLQSIITLLIGYAALFELDGGLTIDNIDEHAWMESLGDDNIMAVS - GIAVGINPFSRDWERLGALIRKGSDVLDVDYSAFDSTLSPFVFDLVEDI-RSEFCGGLEPTRLALLEL--------LSNPIHILGGTIIKVEGGLPSGQPATSVINSILNNIYVLYALIKHTGESELD-DHETIRFISYGDDNLVAVN - IAVG + + + + D FDS+++ ++ + +I R ++ G P L PI+ G ++ G SG +++ SI+ + AL + G +D E S GDDN++AV+ - - - - - - - 17919 - 3004588 - 85 - 297776073 - 0.066953256 - 0.267 - 0.14 - - - - - 53 - ds2020-267_1079 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 54 - ds2020-267_1216 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 55 - ds2020-267_1183 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 56 - ds2020-267_1156 - No definition line - 65 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 57 - ds2020-267_225 - No definition line - 272 - - - - - 17919 - 3004588 - 54 - 73330632 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 58 - ds2020-267_1022 - No definition line - 81 - - - - - 17919 - 3004588 - 2 - 74218750 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 59 - ds2020-267_707 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 60 - ds2020-267_264 - No definition line - 260 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 61 - ds2020-267_1059 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 62 - ds2020-267_514 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 63 - ds2020-267_718 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 64 - ds2020-267_627 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 65 - ds2020-267_533 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 66 - ds2020-267_1025 - No definition line - 79 - - - - - 17919 - 3004588 - 1 - 74666725 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 67 - ds2020-267_267 - No definition line - 259 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 68 - ds2020-267_143 - No definition line - 315 - - - - - 17919 - 3004588 - 65 - 73594120 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 69 - ds2020-267_88 - No definition line - 400 - - - - - 17919 - 3004588 - 77 - 90990200 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 70 - ds2020-267_954 - No definition line - 126 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 71 - ds2020-267_76 - No definition line - 423 - - - - - 17919 - 3004588 - 78 - 101235078 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 72 - ds2020-267_241 - No definition line - 266 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 73 - ds2020-267_1158 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 74 - ds2020-267_422 - No definition line - 236 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 75 - ds2020-267_361 - No definition line - 243 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 76 - ds2020-267_563 - No definition line - 222 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 77 - ds2020-267_1073 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - 78 ds2020-267_1141 No definition line @@ -5624,16321 +5017,5 @@ No hits found - - 242 - ds2020-267_405 - No definition line - 239 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 243 - ds2020-267_1240 - No definition line - 59 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 244 - ds2020-267_145 - No definition line - 315 - - - 1 - gnl|CDD|376868 - pfam02626, CT_A_B, Carboxyltransferase domain, subdomain A and B. Urea carboxylase (UC) catalyzes a two-step, ATP- and biotin-dependent carboxylation reaction of urea. It is composed of biotin carboxylase (BC), carboxyltransferase (CT), and biotin carboxyl carrier protein (BCCP) domains. The CT domain of UC consists of four subdomains, named A, B, C and D. This domain covers the A and B subdomains of the CT domain. This domain covers the whole length of KipA (kinase A) from Bacillus subtilis. It can also be found in S. cerevisiae urea amidolyase Dur1,2, which is a multifunctional biotin-dependent enzyme with domains for urea carboxylase and allophanate (urea carboxylate) hydrolase activity. - 376868 - 262 - - - 1 - 38.5476 - 91 - 3.97676e-05 - 140 - 256 - 46 - 78 - -3 - 0 - 13 - 17 - 6 - 39 - VCLTGALYEAYVTDTAKQTRERVPNGWRIAIKAGQTLEL - IAVTGADMPATLDG------EPVPMWTPIAVKAGDVLSF - + +TGA A + E VP IA+KAG L - - - - - - - 17919 - 3004588 - 65 - 73594120 - 0.041 - 0.267 - 0.14 - - - - - 245 - ds2020-267_1107 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 246 - ds2020-267_889 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 247 - ds2020-267_154 - No definition line - 309 - - - - - 17919 - 3004588 - 63 - 75027640 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 248 - ds2020-267_391 - No definition line - 241 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 249 - ds2020-267_637 - No definition line - 217 - - - 1 - gnl|CDD|284449 - pfam07026, DUF1317, Protein of unknown function (DUF1317). This family consists of several hypothetical bacterial and phage proteins of around 60 residues in length. The function of this family is unknown. - 284449 - 60 - - - 1 - 57.0614 - 137 - 1.36077e-13 - 47 - 172 - 1 - 44 - 2 - 0 - 21 - 28 - 2 - 44 - MTHAHEDIRVGTLCLPF--FGNGWLMPWGEVVSNTLKAQRLAEE - MKHNHDDIQVGAITCPYSTFHRGWLFPGGKIIKNPFKAQNAAEE - M H H+DI+VG + P+ F GWL P G+++ N KAQ AEE - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 250 - ds2020-267_614 - No definition line - 218 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 251 - ds2020-267_1198 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 252 - ds2020-267_1252 - No definition line - 57 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 253 - ds2020-267_1135 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 254 - ds2020-267_52 - No definition line - 500 - - - - - 17919 - 3004588 - 80 - 135111848 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 255 - ds2020-267_705 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 256 - ds2020-267_236 - No definition line - 266 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 257 - ds2020-267_41 - No definition line - 583 - - - - - 17919 - 3004588 - 82 - 171945760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 258 - ds2020-267_189 - No definition line - 285 - - - - - 17919 - 3004588 - 57 - 75361790 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 1 - ds2020-267_1038 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.072287616 - 0.267 - 0.14 - - - No hits found - - - 2 - ds2020-267_986 - No definition line - 116 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 3 - ds2020-267_1033 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 4 - ds2020-267_921 - No definition line - 131 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 5 - ds2020-267_494 - No definition line - 227 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 6 - ds2020-267_682 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 7 - ds2020-267_964 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 8 - ds2020-267_141 - No definition line - 319 - - - - - 17919 - 3004588 - 65 - 75433973 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 9 - ds2020-267_517 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 10 - ds2020-267_557 - No definition line - 222 - - - 1 - gnl|CDD|366090 - pfam00421, PSII, Photosystem II protein. - 366090 - 499 - - - 1 - 80.2474 - 198 - 3.32623e-20 - 12 - 200 - 148 - 214 - -2 - 0 - 40 - 41 - 10 - 70 - ACFGFGAFHVTGLYGPGIWVSDP-------YGLTGRVQSVNPAWGVEGFDPFVPGGSASHPIAAGTLFIL - GCFGFGAFHFGGLG---TWVSDPTLDPGVIYGYTGHVQPVAPVWGAEGFSPFGPGGIVGHHIAAGILGII - CFGFGAFH GL WVSDP YG TG VQ V P WG EGF PF PGG H IAAG L I+ - - - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - - - 11 - ds2020-267_171 - No definition line - 294 - - - - - 17919 - 3004588 - 60 - 73319024 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 12 - ds2020-267_282 - No definition line - 257 - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 13 - ds2020-267_507 - No definition line - 226 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 14 - ds2020-267_117 - No definition line - 344 - - - 1 - gnl|CDD|376306 - pfam00252, Ribosomal_L16, Ribosomal protein L16p/L10e. - 376306 - 124 - - - 1 - 84.0016 - 209 - 7.27175e-23 - 107 - 295 - 53 - 116 - 2 - 0 - 32 - 44 - 1 - 64 - RAMSRRNSKIWVRVLADLPITRKPTEVRMGRGKGNPTGWIARVSTGQIPFEM-DGVSLSNARQA - RYLKKRGGKLWIRVFPDKPVTKKPGEDRMGKGKGKPEGWVARVKPGRILFEIRGGVHEEVAKEA - R + +R K+W+RV D P+T+KP E RMG+GKG P GW+ARV G+I FE+ GV A++A - - - - - - - 17919 - 3004588 - 71 - 74490577 - 0.041 - 0.267 - 0.14 - - - - - 15 - ds2020-267_352 - No definition line - 245 - - - 1 - gnl|CDD|366381 - pfam00946, Mononeg_RNA_pol, Mononegavirales RNA dependent RNA polymerase. Members of the Mononegavirales including the Paramyxoviridae, like other non-segmented negative strand RNA viruses, have an RNA-dependent RNA polymerase composed of two subunits, a large protein L and a phosphoprotein P. This is a protein family of the L protein. The L protein confers the RNA polymerase activity on the complex. The P protein acts as a transcription factor. - 366381 - 1015 - - - 1 - 38.0729 - 89 - 3.23548e-05 - 1 - 141 - 690 - 736 - 1 - 0 - 13 - 24 - 0 - 47 - KKATEAIAQVSSRVGQIVKPTECIYSTCFLTYGKEMILRGAYLRTCS - RRIFKALRKVTSKLGLNLKLEETIISSDFFIYSKRIYYDGVILPQSL - ++ +A+ +V+S++G +K E I S+ F Y K + G L - - - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - - - 16 - ds2020-267_659 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 17 - ds2020-267_564 - No definition line - 222 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 18 - ds2020-267_1044 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 19 - ds2020-267_298 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 20 - ds2020-267_73 - No definition line - 430 - - - - - 17919 - 3004588 - 78 - 104448890 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 21 - ds2020-267_137 - No definition line - 322 - - - - - 17919 - 3004588 - 66 - 74699294 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 22 - ds2020-267_695 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 23 - ds2020-267_923 - No definition line - 131 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 24 - ds2020-267_1006 - No definition line - 98 - - - - - 17919 - 3004588 - 6 - 75323924 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 25 - ds2020-267_980 - No definition line - 120 - - - - - 17919 - 3004588 - 13 - 74834307 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 26 - ds2020-267_1144 - No definition line - 65 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 27 - ds2020-267_656 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 28 - ds2020-267_80 - No definition line - 417 - - - - - 17919 - 3004588 - 78 - 98021266 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 29 - ds2020-267_3 - No definition line - 2407 - - - - - 17919 - 3004588 - 94 - 934703016 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 30 - ds2020-267_930 - No definition line - 130 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 31 - ds2020-267_830 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 32 - ds2020-267_1002 - No definition line - 106 - - - - - 17919 - 3004588 - 9 - 73926242 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 33 - ds2020-267_987 - No definition line - 116 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 34 - ds2020-267_1238 - No definition line - 59 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 35 - ds2020-267_443 - No definition line - 233 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 36 - ds2020-267_233 - No definition line - 268 - - - - - 17919 - 3004588 - 53 - 73975716 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 37 - ds2020-267_1092 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 38 - ds2020-267_577 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 39 - ds2020-267_55 - No definition line - 484 - - - - - 17919 - 3004588 - 80 - 127256508 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 40 - ds2020-267_152 - No definition line - 310 - - - - - 17919 - 3004588 - 63 - 75027640 - 0.074731812 - 0.267 - 0.14 - - - No hits found - - - 41 - ds2020-267_257 - No definition line - 261 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 42 - ds2020-267_205 - No definition line - 279 - - - - - 17919 - 3004588 - 56 - 74041588 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 43 - ds2020-267_604 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 44 - ds2020-267_616 - No definition line - 218 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 45 - ds2020-267_1237 - No definition line - 59 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 46 - ds2020-267_97 - No definition line - 380 - - - 1 - gnl|CDD|368171 - pfam04879, Molybdop_Fe4S4, Molybdopterin oxidoreductase Fe4S4 domain. This domain is found in formate dehydrogenase H for which the structure is known. This first domain (residues 1 to 60) of Structure 1aa6 is an Fe4S4 cluster just below the protein surface. - 368171 - 55 - - - 1 - 45.3437 - 108 - 1.9903e-08 - 125 - 274 - 1 - 50 - -2 - 0 - 14 - 23 - 0 - 50 - MQYAPSICHGCSTGCNISAGERYGELRRIENRFNGEVKAYFLCDHGHFGY - MKVVKTICPYCGVGCGLLVHVKDGKIVKVEGDPDHPVNRGRLCVKGRFGL - M+ +IC C GC + + G++ ++E + V LC G FG - - - - - - - 17919 - 3004588 - 76 - 82137200 - 0.041 - 0.267 - 0.14 - - - - - 47 - ds2020-267_1167 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 48 - ds2020-267_1028 - No definition line - 77 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 49 - ds2020-267_2 - No definition line - 2436 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 95.9902 - 239 - 2.17343e-21 - 184 - 1476 - 70 - 464 - 1 - 0 - 90 - 155 - 58 - 442 - WAKCGSMAEYIVEAK--NLTTKMKALDNQVT-LGDFELDLSP-LFEWEVLNHRAVLKGIYDKEVTERRDQKQ---SIKLSAADLEEEIDSVFQDVGSVLDARTKEGEKSPLYATWDDWYVDRVQTTPAG-SAFTVNKDMMEARNMLKANGVQNLTKTQVMAQMRDKLPLASILGSEPMILAQMSWKLEWSKLRALFAASMEHWMPSAFALGQIEEYLPSDCPIGKAA--DAHNVCRRVMEMSTQGVVACIDAKNFNILHTHEIMSAILKSASKMLGDRLSSEQHDCLKWLAKAELNQKVLVKTGEVTEQLLQVGRRDGWINKLTKGDGTVVEAADVTVGMFSGTRFTMLYNTVLNRAYYKVAEKRAKIKTLSLHSGDDVYAVFANYIDVYKMKREMALIGYTLQLGK-CFLQGVREFLRISHKNANTSQYLARSAATAIHGR - YAASKPGGYRLRRAAWANSSDFAKDLSDILKSLGLNASSPGPKLVEGNPLLGRGVTNVDWEEEAKNRVDLAVVCRLVLLPMEELRAHIDAVLDE----------LVVRRGLCDPIRLFVKNEPLWCVNGHPDHKL--REGRLRLLSSVSLVDQLVR-RMLFEPQNNNEIAWW----GSVPSKPSMKLEHGKSRAIYACDTRSYLAFEYLLAPVEKAWANKSVILNPGEGDISGFDWSVQDWKRGGVSLMLDYDDFNSQHSTESMRAVFER----LRRRLPDEPAEAADWL----------VCSMDSMYQLS----DGTLLAQRVPG------------TLKSGHRATTFINSVLNCAYAELAGAPWADVPTSIHMGDDVLEGLRTPADATSLLDKYARLGFKVNPSKQSVGHTIAEFLRVAFCSHEVRGYLARAIASLVSGN - +A + A N + K L + + LG P L E L R V +++E R D + L +L ID+V + + L + + G + R + + V L + +++ + ++ +A + ++ S KLE K RA++A ++ + L +E+ + I D V + GV +D +FN H+ E M A+ + L RL E + WL V + + QL + + G + SG R T N+VLN AY ++A S+H GDDV D + + A +G+ + K + EFLR++ + YLAR+ A+ + G - - - - - - - 17919 - 3004588 - 94 - 947905036 - 0.041 - 0.267 - 0.14 - - - - - 50 - ds2020-267_595 - No definition line - 219 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 54.0035 - 130 - 5.90575e-11 - 13 - 210 - 377 - 441 - 1 - 0 - 24 - 32 - 1 - 66 - NNAYLRAAVGKTWYEGALSLHTGDDVFIRANTLADCSVILSDAVAFGCRMNPTKQSIGFYNRLALR - NCAYAEL-AGAPWADVPTSIHMGDDVLEGLRTPADATSLLDKYARLGFKVNPSKQSVGHTIAEFLR - N AY G W + S+H GDDV T AD + +L G ++NP+KQS+G LR - - - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - - - 51 - ds2020-267_243 - No definition line - 265 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 52 - ds2020-267_400 - No definition line - 239 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 53 - ds2020-267_295 - No definition line - 255 - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 54 - ds2020-267_854 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 55 - ds2020-267_613 - No definition line - 218 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 56 - ds2020-267_585 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 57 - ds2020-267_289 - No definition line - 256 - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 58 - ds2020-267_762 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 59 - ds2020-267_679 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 60 - ds2020-267_1118 - No definition line - 68 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 61 - ds2020-267_574 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 62 - ds2020-267_1087 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 63 - ds2020-267_1171 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 64 - ds2020-267_9 - No definition line - 1660 - - - - - 17919 - 3004588 - 91 - 634769058 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 65 - ds2020-267_771 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 66 - ds2020-267_50 - No definition line - 510 - - - - - 17919 - 3004588 - 80 - 141396120 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 67 - ds2020-267_251 - No definition line - 262 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 68 - ds2020-267_851 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 69 - ds2020-267_959 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 70 - ds2020-267_1075 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.081235584 - 0.267 - 0.14 - - - No hits found - - - 71 - ds2020-267_357 - No definition line - 244 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 72 - ds2020-267_781 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 73 - ds2020-267_411 - No definition line - 238 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 74 - ds2020-267_219 - No definition line - 273 - - - - - 17919 - 3004588 - 54 - 75367594 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 75 - ds2020-267_622 - No definition line - 217 - - - 1 - gnl|CDD|379835 - pfam16363, GDP_Man_Dehyd, GDP-mannose 4,6 dehydratase. - 379835 - 330 - - - 1 - 55.2369 - 134 - 2.10592e-11 - 29 - 157 - 47 - 89 - 2 - 0 - 12 - 19 - 0 - 43 - HVRKKLSFHKVDLRDKPALDKLFSSITFDAVIHFAGLKAVGES - HLNPNLVLHYGDLTDSSNLERLIAEVQPDEIYNLAAQSHVDVS - H+ L H DL D L++L + + D + + A V S - - - - - 2 - gnl|CDD|366597 - pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions. - 366597 - 234 - - - 1 - 46.8912 - 112 - 1.5719e-08 - 50 - 172 - 43 - 83 - 2 - 0 - 19 - 25 - 0 - 41 - FHKVDLRDKPALDKLFSSITFDAVIHFAGLKAVGESAETIA - FVEGDLTDRDALEKLFADVQPDAVIHLAAVGGVGASIEDPE - F + DL D+ AL+KLF+ + DAVIH A + VG S E - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 76 - ds2020-267_214 - No definition line - 276 - - - 1 - gnl|CDD|369639 - pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain. - 369639 - 298 - - - 1 - 44.2257 - 105 - 2.55939e-07 - 129 - 254 - 164 - 205 - 3 - 0 - 14 - 21 - 0 - 42 - YCSVWRRLGSEVVVFEAKPEFLAAADKAVSKEAAKLLKAQGV - LAAALAKLGKEVTLVEARDRLLRAFDEEISAILEKALEKNGV - + +LG EV + EA+ L A D+ +S K L+ GV - - - - - 2 - gnl|CDD|365851 - pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain. - 365851 - 79 - - - 1 - 37.5344 - 88 - 1.70856e-05 - 135 - 254 - 16 - 55 - 3 - 0 - 12 - 20 - 0 - 40 - SVWRRLGSEVVVFEAKPEFLAAADKAVSKEAAKLLKAQGV - GALARLGSKVTVVERRDRLLRGLDEEIAKILQERLEKNGI - RLGS+V V E + L D+ ++K + L+ G+ - - - - - - - 17919 - 3004588 - 55 - 74704591 - 0.041 - 0.267 - 0.14 - - - - - 77 - ds2020-267_693 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 78 - ds2020-267_245 - No definition line - 264 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 79 - ds2020-267_728 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 80 - ds2020-267_598 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 81 - ds2020-267_1221 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 82 - ds2020-267_221 - No definition line - 273 - - - - - 17919 - 3004588 - 54 - 75367594 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 83 - ds2020-267_353 - No definition line - 245 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 84 - ds2020-267_610 - No definition line - 218 - - - 1 - gnl|CDD|380005 - pfam17759, tRNA_synthFbeta, Phenylalanyl tRNA synthetase beta chain CLM domain. This domain corresponds to the catalytic like domain (CLM) in the beta chain of phe tRNA synthetase. - 380005 - 212 - - - 1 - 60.2461 - 147 - 1.47034e-13 - 25 - 195 - 77 - 131 - 1 - 0 - 23 - 32 - 2 - 57 - LWTGMLGTIVYNQNRQQNRVRIFESGLRFVPDNQANLGIRQDLLLAGAISGNRYEES - LLPGLLEVLAYNLNRGNPDVRLFEIGRVFLPDEEE--LPREERRLAGLLTGKRLPES - L G+L + YN NR VR+FE G F+PD + R++ LAG ++G R ES - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 85 - ds2020-267_46 - No definition line - 530 - - - - - 17919 - 3004588 - 81 - 147549155 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 86 - ds2020-267_549 - No definition line - 223 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 87 - ds2020-267_1089 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 88 - ds2020-267_935 - No definition line - 129 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 89 - ds2020-267_825 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 90 - ds2020-267_1097 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 91 - ds2020-267_184 - No definition line - 288 - - - - - 17919 - 3004588 - 58 - 74680868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 92 - ds2020-267_94 - No definition line - 386 - - - 1 - gnl|CDD|366585 - pfam01347, Vitellogenin_N, Lipoprotein amino terminal region. This family contains regions from: Vitellogenin, Microsomal triglyceride transfer protein and apolipoprotein B-100. These proteins are all involved in lipid transport. This family contains the LV1n chain from lipovitellin, that contains two structural domains. - 366585 - 582 - - - 1 - 37.639 - 88 - 0.000224462 - 112 - 363 - 208 - 294 - 1 - 0 - 17 - 29 - 5 - 88 - PDHVLLKQAYLEGAVVVTPN--PRGHAMLANKQNLTLLSDSQILRSWGLDEAAVERYWNTV--SASP*ANLRSSTSQTSCPSTSASGI - LKGFLIQSAETTEKVQVSPFLENSQKAEVESRQNLTLEEVEKTPGLIPPPANPRHRG-SLVYEYETEQASLSQELLQSPSSLSSVPNA - L++ A V V+P A + ++QNLTL + R + V + A+L Q+ +S - - - - - - - 17919 - 3004588 - 77 - 82866075 - 0.041 - 0.267 - 0.14 - - - - - 93 - ds2020-267_300 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 94 - ds2020-267_1106 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 95 - ds2020-267_447 - No definition line - 233 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 96 - ds2020-267_970 - No definition line - 124 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 97 - ds2020-267_1068 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 98 - ds2020-267_663 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 99 - ds2020-267_1203 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 100 - ds2020-267_989 - No definition line - 116 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 101 - ds2020-267_1037 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 102 - ds2020-267_828 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 103 - ds2020-267_539 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 104 - ds2020-267_744 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 105 - ds2020-267_1188 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 106 - ds2020-267_890 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 107 - ds2020-267_708 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 108 - ds2020-267_1143 - No definition line - 65 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 109 - ds2020-267_292 - No definition line - 255 - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 110 - ds2020-267_602 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 111 - ds2020-267_323 - No definition line - 250 - - - 1 - gnl|CDD|365960 - pfam00227, Proteasome, Proteasome subunit. The proteasome is a multisubunit structure that degrades proteins. Protein degradation is an essential component of regulation because proteins can become misfolded, damaged, or unnecessary. Proteasomes and their homologs vary greatly in complexity: from HslV (heat shock locus v), which is encoded by 1 gene in bacteria, to the eukaryotic 20S proteasome, which is encoded by more than 14 genes. Recently evidence of two novel groups of bacterial proteasomes was proposed. The first is Anbu, which is sparsely distributed among cyanobacteria and proteobacteria. The second is call beta-proteobacteria proteasome homolog (BPH). - 365960 - 188 - - - 1 - 47.9435 - 115 - 5.8155e-09 - 10 - 150 - 5 - 51 - -2 - 0 - 17 - 29 - 2 - 48 - TTIVSVRRNGHVVIAGDGQATLGNTV-MKGNVKKVRRLYNDKVIAGFA - TTIVGIKGKDGVVLAADKRATRGSKLLSKDTVEKIFKI-DDHIGMAFA - TTIV ++ VV+A D +AT G+ + K V+K+ ++ +D + FA - - - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - - - 112 - ds2020-267_372 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 113 - ds2020-267_238 - No definition line - 266 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 114 - ds2020-267_596 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 115 - ds2020-267_368 - No definition line - 243 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 116 - ds2020-267_945 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 117 - ds2020-267_465 - No definition line - 230 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 118 - ds2020-267_1172 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 119 - ds2020-267_1014 - No definition line - 86 - - - - - 17919 - 3004588 - 3 - 73770775 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 120 - ds2020-267_932 - No definition line - 129 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 121 - ds2020-267_168 - No definition line - 298 - - - 1 - gnl|CDD|379252 - pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. - 379252 - 266 - - - 1 - 34.9929 - 81 - 0.000766911 - 54 - 260 - 40 - 130 - -3 - 0 - 22 - 37 - 22 - 91 - TDSQYRRLQRFIASAVIDYD----QLAILIYRLFGLSKVTITIDRTNW-KWGK----------------SNINIFM-LGVVYKGIAIPLYW - HDGSHQALQRFLSRSPWDDARLRRRLARLVLPAIAPEAPVLAIDDTGFPKDGKHSVGVARQYCGVLGKPDNCQVAVSLGLAYERVSAPLDW - D ++ LQRF++ + D +LA L+ + ID T + K GK N + + LG+ Y+ ++ PL W - - - - - - - 17919 - 3004588 - 60 - 75248472 - 0.041 - 0.267 - 0.14 - - - - - 122 - ds2020-267_95 - No definition line - 382 - - - - - 17919 - 3004588 - 76 - 83779944 - 0.050055168 - 0.267 - 0.14 - - - No hits found - - - 123 - ds2020-267_831 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 124 - ds2020-267_200 - No definition line - 281 - - - - - 17919 - 3004588 - 56 - 74041588 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 125 - ds2020-267_690 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 126 - ds2020-267_105 - No definition line - 370 - - - - - 17919 - 3004588 - 76 - 77208968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 127 - ds2020-267_818 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 128 - ds2020-267_636 - No definition line - 217 - - - 1 - gnl|CDD|372443 - pfam13041, PPR_2, PPR repeat family. This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. - 372443 - 50 - - - 1 - 67.3836 - 166 - 7.94482e-18 - 64 - 195 - 5 - 48 - -2 - 0 - 18 - 32 - 0 - 44 - TFNIMLKGYFRAGQIKEAWEFFLQMKKRKCEIDVVTYTTLVHGF - TYNTLINGYCKNGKVEEAFKLFNEMKKRGIKPNVYTYTILINGL - T+N ++ GY + G+++EA++ F +MKKR + +V TYT L++G - - - 2 - 40.4196 - 96 - 2.82898e-07 - 13 - 99 - 2 - 30 - -2 - 0 - 14 - 23 - 0 - 29 - DVVTYTTLVHGFGVVGEIKKARKVFDEMV - DVVTYNTLINGYCKNGKVEEAFKLFNEMK - DVVTY TL++G+ G++++A K+F+EM - - - - - 2 - gnl|CDD|372345 - pfam12854, PPR_1, PPR repeat. This family matches additional variants of the PPR repeat that were not captured by the model for pfam01535. The exact function is not known. - 372345 - 32 - - - 1 - 46.161 - 111 - 1.10553e-09 - 13 - 108 - 1 - 32 - -2 - 0 - 14 - 20 - 0 - 32 - CEIDVVTYTTLVHGFGVVGEIKKARKVFDEMV - LKPDVVTYNTLIDGLCRAGRVDEAFELFDEME - + DVVTY TL+ G G + +A ++FDEM - - - 2 - 37.3014 - 88 - 4.32035e-06 - 118 - 204 - 4 - 32 - -2 - 0 - 11 - 20 - 0 - 29 - NRTTFNIMLKGYFRAGQIKEAWEFFLQMK - DVVTYNTLIDGLCRAGRVDEAFELFDEME - + T+N ++ G RAG++ EA+E F +M+ - - - - - 3 - gnl|CDD|366695 - pfam01535, PPR, PPR repeat. This repeat has no known function. It is about 35 amino acids long and found in up to 18 copies in some proteins. This family appears to be greatly expanded in plants. This repeat occurs in PET309 that may be involved in RNA stabilisation. This domain occurs in crp1 that is involved in RNA processing. This repeat is associated with a predicted plant protein that has a domain organisation similar to the human BRCA1 protein. The repeat has been called PPR. - 366695 - 31 - - - 1 - 40.141 - 95 - 3.20398e-07 - 106 - 195 - 2 - 31 - -2 - 0 - 11 - 21 - 0 - 30 - TFNIMLKGYFRAGQIKEAWEFFLQMKKRKC - TYNSLISGYCKNGKLEEALELFKEMKEKGI - T+N ++ GY + G+++EA E F +MK++ - - - 2 - 35.9038 - 84 - 1.47382e-05 - 13 - 93 - 1 - 27 - -2 - 0 - 10 - 19 - 0 - 27 - VTYTTLVHGFGVVGEIKKARKVFDEMV - VTYNSLISGYCKNGKLEEALELFKEMK - VTY +L+ G+ G++++A ++F EM - - - - - 4 - gnl|CDD|316342 - pfam13812, PPR_3, Pentatricopeptide repeat domain. This family matches additional variants of the PPR repeat that were not captured by the model for pfam01535. In the case of the Arabidopsis protein UniProtKB:Q66GI4, the repeated helices in this N-terminal region, of protein-only RNase P (PRORP) enzymes, form the pentatricopeptide repeat (PPR) domain which enhances pre-tRNA binding affinity. PROPRP enzymes process precursor tRNAs in human mitochondria and in all tRNA-using compartments of Arabidopsis thaliana. - 316342 - 63 - - - 1 - 36.1819 - 84 - 1.92367e-05 - 16 - 123 - 6 - 41 - -2 - 0 - 13 - 23 - 0 - 36 - MKKRKCEIDVVTYTTLVHGFGVVGEIKKARKVFDEM - MVRDGIQLNVNTYTHLLHAYANVGNLKLALEIFERM - M + +++V TYT L+H + VG +K A ++F+ M - - - 2 - 34.2559 - 79 - 0.000111468 - 61 - 195 - 17 - 61 - -2 - 0 - 14 - 23 - 0 - 45 - TFNIMLKGYFRAGQIKEAWEFFLQMKKRKCEIDVVTYTTLVHGFG - TYTHLLHAYANVGNLKLALEIFERMKKKGIKPTLDTYNAILGVIG - T+ +L Y G +K A E F +MKK+ + + TY ++ G - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 129 - ds2020-267_358 - No definition line - 244 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 130 - ds2020-267_603 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 131 - ds2020-267_1181 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 132 - ds2020-267_486 - No definition line - 228 - - - 1 - gnl|CDD|374956 - pfam17035, BET, Bromodomain extra-terminal - transcription regulation. The BET, or bromodomain extra-terminal domain, is found on bromodomain proteins that play key roles in development, cancer progression and virus-host pathogenesis. It interacts with NSD3, JMJD6, CHD4, GLTSCR1, and ATAD5 all of which are shown to impart a pTEFb-independent transcriptional activation function on the bromodomain proteins. - 374956 - 64 - - - 1 - 45.5577 - 109 - 5.12677e-09 - 108 - 203 - 1 - 32 - 3 - 0 - 13 - 21 - 0 - 32 - EMSMEEKHKLGVGLQSLPKDKMEQVV*MIKKR - PMTYEEKRELSERINKLPGEKLGRVVEIIKER - M+ EEK +L + LP +K+ +VV +IK+R - - - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - - - 133 - ds2020-267_599 - No definition line - 219 - - - 1 - gnl|CDD|377551 - pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition. - 377551 - 100 - - - 1 - 38.9712 - 92 - 3.2952e-06 - 28 - 147 - 9 - 49 - 1 - 0 - 13 - 24 - 3 - 42 - PMDMRSGSNKLLAFILEKHHGIKPHC--AYLFYNKTGTRLKV - PTDMRKGIDGLAA-LVQEVLGLDPFSGHLFVFRNRRRDRIKI - P DMR G + L A ++++ G+ P ++F N+ R+K+ - - - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - - - 134 - ds2020-267_1071 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 135 - ds2020-267_906 - No definition line - 141 - - - - - 17919 - 3004588 - 19 - 74595556 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 136 - ds2020-267_277 - No definition line - 258 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 137 - ds2020-267_359 - No definition line - 244 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 138 - ds2020-267_82 - No definition line - 414 - - - - - 17919 - 3004588 - 78 - 96414360 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 139 - ds2020-267_704 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 140 - ds2020-267_1023 - No definition line - 79 - - - - - 17919 - 3004588 - 1 - 74666725 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 141 - ds2020-267_35 - No definition line - 657 - - - - - 17919 - 3004588 - 83 - 206354296 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 142 - ds2020-267_635 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 143 - ds2020-267_288 - No definition line - 256 - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 144 - ds2020-267_99 - No definition line - 378 - - - - - 17919 - 3004588 - 76 - 82137200 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 145 - ds2020-267_785 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 146 - ds2020-267_837 - No definition line - 207 - - - 1 - gnl|CDD|367791 - pfam04061, ORMDL, ORMDL family. Evidence form suggests that ORMDLs are involved in protein folding in the ER. Orm proteins have been identified as negative regulators of sphingolipid synthesis that form a conserved complex with serine palmitoyltransferase, the first and rate-limiting enzyme in sphingolipid production. This novel and conserved protein complex, has been termed the SPOTS complex (serine palmitoyltransferase, Orm1/2, Tsc3, and Sac1). - 367791 - 135 - - - 1 - 70.6546 - 174 - 2.43363e-18 - 1 - 159 - 83 - 135 - 1 - 0 - 25 - 37 - 0 - 53 - QHVRNRKFLTVVPVVLYLIASHTTDYQHPMLFFNSLAVIVLVIAKFSNMHKVR - QYTPTRKFLTVVPIVLFLLSTHYTKYDLTLFIINFIALLVVVIPKLPFMHRVR - Q+ RKFLTVVP+VL+L+++H T Y + N +A++V+VI K MH+VR - - - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - - - 147 - ds2020-267_382 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 148 - ds2020-267_263 - No definition line - 260 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 149 - ds2020-267_67 - No definition line - 460 - - - - - 17919 - 3004588 - 79 - 117585038 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 150 - ds2020-267_979 - No definition line - 121 - - - - - 17919 - 3004588 - 13 - 74834307 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 151 - ds2020-267_992 - No definition line - 114 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 152 - ds2020-267_883 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 153 - ds2020-267_699 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 154 - ds2020-267_516 - No definition line - 225 - - - 1 - gnl|CDD|376293 - pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. - 376293 - 433 - - - 1 - 35.2292 - 82 - 0.000272517 - 21 - 101 - 1 - 27 - -2 - 0 - 11 - 18 - 0 - 27 - RVVRQFSVMAVVWGIVGMLVGVVIATQ - RIGLLYLVTALVWFLVGGLLGLLIRLQ - R+ + V A+VW +VG L+G++I Q - - - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - - - 155 - ds2020-267_192 - No definition line - 284 - - - - - 17919 - 3004588 - 57 - 73378585 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 156 - ds2020-267_957 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 157 - ds2020-267_572 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 158 - ds2020-267_721 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 159 - ds2020-267_469 - No definition line - 230 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 160 - ds2020-267_385 - No definition line - 241 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 161 - ds2020-267_48 - No definition line - 525 - - - - - 17919 - 3004588 - 81 - 145996006 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 162 - ds2020-267_472 - No definition line - 229 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 163 - ds2020-267_40 - No definition line - 586 - - - - - 17919 - 3004588 - 82 - 173480990 - 0.050180004 - 0.267 - 0.14 - - - No hits found - - - 164 - ds2020-267_1101 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 165 - ds2020-267_898 - No definition line - 147 - - - - - 17919 - 3004588 - 21 - 73592092 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 166 - ds2020-267_136 - No definition line - 322 - - - - - 17919 - 3004588 - 66 - 74699294 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 167 - ds2020-267_344 - No definition line - 246 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 168 - ds2020-267_1053 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 169 - ds2020-267_806 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 170 - ds2020-267_1179 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 171 - ds2020-267_793 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 172 - ds2020-267_1224 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 173 - ds2020-267_1200 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 174 - ds2020-267_124 - No definition line - 337 - - - - - 17919 - 3004588 - 70 - 73510836 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 175 - ds2020-267_732 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 176 - ds2020-267_529 - No definition line - 224 - - - 1 - gnl|CDD|366140 - pfam00510, COX3, Cytochrome c oxidase subunit III. - 366140 - 258 - - - 1 - 85.9226 - 213 - 6.14777e-23 - 35 - 211 - 127 - 185 - 2 - 0 - 30 - 39 - 0 - 59 - PFLNTPILLSSGAAVTWAHHAILAGKEKRAVYALVATVSLALVFTGFQGMEYYQAPVNI - PLLNTIILLSSGVTVTYAHHSLIEGNRKQALQGLFITILLGVYFTGLQAMEYTEASFTI - P LNT ILLSSG VT+AHH+++ G K+A+ L T+ L + FTG Q MEY +A I - - - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - - - 177 - ds2020-267_779 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 178 - ds2020-267_160 - No definition line - 304 - - - - - 17919 - 3004588 - 62 - 73850790 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 179 - ds2020-267_230 - No definition line - 268 - - - 1 - gnl|CDD|376293 - pfam00115, COX1, Cytochrome C and Quinol oxidase polypeptide I. - 376293 - 433 - - - 1 - 67.586 - 166 - 1.95663e-15 - 81 - 236 - 34 - 84 - -3 - 0 - 29 - 35 - 1 - 52 - QLYNVLITAHAFLMIFFMVMPAMIGGSGNWSVPILIGAPDMAFPRLNNISFW - LTYNQLRTLHGNLMIFWFATPFIFGF-GNYLVPLMIGARDMAFPRLNALSFW - YN L T H LMIF+ P + G GN+ VP++IGA DMAFPRLN +SFW - - - - - - - 17919 - 3004588 - 53 - 73975716 - 0.041 - 0.267 - 0.14 - - - - - 180 - ds2020-267_93 - No definition line - 387 - - - - - 17919 - 3004588 - 77 - 84490900 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 181 - ds2020-267_49 - No definition line - 517 - - - - - 17919 - 3004588 - 80 - 144538256 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 182 - ds2020-267_1082 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 183 - ds2020-267_1063 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 184 - ds2020-267_896 - No definition line - 152 - - - - - 17919 - 3004588 - 21 - 76220381 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 185 - ds2020-267_159 - No definition line - 305 - - - - - 17919 - 3004588 - 62 - 73850790 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 186 - ds2020-267_1047 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 187 - ds2020-267_347 - No definition line - 245 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 188 - ds2020-267_444 - No definition line - 233 - - - 1 - gnl|CDD|366242 - pfam00680, RdRP_1, RNA dependent RNA polymerase. - 366242 - 470 - - - 1 - 34.2545 - 79 - 0.00060937 - 51 - 155 - 281 - 315 - -1 - 0 - 14 - 22 - 0 - 35 - GYLVNLFGTMPSGSYYTSLINTNANNMLILGHLID - GTIIKVEGGLPSGQPATSVINSILNNIYVLYALIK - G ++ + G +PSG TS+IN+ NN+ +L LI - - - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - - - 189 - ds2020-267_814 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 190 - ds2020-267_302 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 191 - ds2020-267_169 - No definition line - 298 - - - - - 17919 - 3004588 - 60 - 75248472 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 192 - ds2020-267_396 - No definition line - 240 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 193 - ds2020-267_942 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 194 - ds2020-267_378 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 195 - ds2020-267_308 - No definition line - 253 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 196 - ds2020-267_722 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 197 - ds2020-267_156 - No definition line - 307 - - - - - 17919 - 3004588 - 62 - 75744400 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 198 - ds2020-267_336 - No definition line - 248 - - - 1 - gnl|CDD|365883 - pfam00113, Enolase_C, Enolase, C-terminal TIM barrel domain. - 365883 - 296 - - - 1 - 60.1682 - 146 - 4.23282e-13 - 15 - 116 - 187 - 220 - -1 - 0 - 21 - 27 - 0 - 34 - SNTKILKEGIDKKIANSILIKFNQIGTLTETLEA - TNPKRLKTAIEKKAANSLLLKVNQIGSLTESLAA - +N K LK I+KK ANS+L+K NQIG+LTE+L A - - - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - - - 199 - ds2020-267_658 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 200 - ds2020-267_1003 - No definition line - 106 - - - - - 17919 - 3004588 - 9 - 73926242 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 201 - ds2020-267_561 - No definition line - 222 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 202 - ds2020-267_712 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 203 - ds2020-267_365 - No definition line - 243 - - - 1 - gnl|CDD|372443 - pfam13041, PPR_2, PPR repeat family. This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. - 372443 - 50 - - - 1 - 34.2564 - 80 - 0.000129396 - 49 - 186 - 5 - 50 - -1 - 0 - 8 - 21 - 0 - 46 - ICNNMIRAYTNSVFPIKAIHIYNYMQETNVRSDHFTYNFALKACAR - TYNTLINGYCKNGKVEEAFKLFNEMKKRGIKPNVYTYTILINGLCK - N +I Y + +A ++N M++ ++ + +TY + + - - - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - - - 204 - ds2020-267_75 - No definition line - 425 - - - 1 - gnl|CDD|365804 - pfam00005, ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide as in CFTR, or belong in different polypeptide chains. - 365804 - 150 - - - 1 - 44.5558 - 106 - 4.26261e-07 - 129 - 275 - 19 - 64 - -1 - 0 - 13 - 22 - 3 - 49 - SNGEGKSTLFKVISGQVKADSGEFQISGNLKIAMLEQDIPETSGKVSDI - PNGAGKSTLLKLISGLLSPTEGTILLDGQ---DLTDDERKSLRKEIGYV - NG GKSTL K+ISG + G + G + + + ++ + - - - - - - - 17919 - 3004588 - 78 - 101235078 - 0.041 - 0.267 - 0.14 - - - - - 205 - ds2020-267_787 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 206 - ds2020-267_140 - No definition line - 319 - - - - - 17919 - 3004588 - 65 - 75433973 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 207 - ds2020-267_174 - No definition line - 291 - - - - - 17919 - 3004588 - 59 - 73999946 - 0.06226824 - 0.267 - 0.14 - - - No hits found - - - 208 - ds2020-267_237 - No definition line - 266 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 209 - ds2020-267_8 - No definition line - 1703 - - - 1 - gnl|CDD|366242 - pfam00680, RdRP_1, RNA dependent RNA polymerase. - 366242 - 470 - - - 1 - 70.078 - 172 - 2.85682e-13 - 685 - 1458 - 100 - 348 - -3 - 0 - 54 - 102 - 41 - 274 - SAMPTTTSPGFPWVNQGYKTKAEVFADPVATGKIHR----AWDSIGRGIPW------SLPDCLAFNRVVASEQPNVKVRPVWGYPTDVILEEARFFIPLFSELKELCNREDACYGIGMETMKSGHSHLARSMIDNIVSLTTDFSRFDANVTHWIIRDTFSFISDWFDFSKVRDSEGIVWNVRSDQTARRWKAMVSYFINTKIRTPRGLRVQKSTGIPSGSMWTNLLDTIVNAVQMRTAIYRVTGALPVKDYY------YGDDSSIFLDRPIDLV - DALNKDTSPGLPYILEG-GKKRDLVKDEEADKVLLKAAYEALKLAENGEGLPGVYTTCLKDELRPLEKVQAG----KTRLFWGCPVEVNLVARAVFGPFCNKIYS--NALKLGIAVGINPFSRDWERLGALIRKGSDVLDVDYSAFDSTLSPFVFDLVEDIRSEFCGGLE---------------PTRLALLEL---LSNPIHILGGTIIKVEGGLPSGQPATSVINSILNNIYVLYALIKHTGESELDDHETIRFISYGDDNLVAVNPDVDSV - A+ TSPG P++ +G K ++ D A + + A G L D L V + K R WG P +V L F P +++ N +G+ L + L D+S FD+ ++ ++ S++ + R + ++ I G ++ G+PSG T+++++I+N + + A+ + TG + D+ YGDD+ + ++ +D V - - - - - - - 17919 - 3004588 - 91 - 654004484 - 0.041 - 0.267 - 0.14 - - - - - 210 - ds2020-267_1074 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 211 - ds2020-267_119 - No definition line - 342 - - - - - 17919 - 3004588 - 71 - 74490577 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 212 - ds2020-267_1098 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 213 - ds2020-267_528 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 214 - ds2020-267_326 - No definition line - 250 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 215 - ds2020-267_913 - No definition line - 135 - - - - - 17919 - 3004588 - 17 - 75599020 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 216 - ds2020-267_981 - No definition line - 120 - - - - - 17919 - 3004588 - 13 - 74834307 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 217 - ds2020-267_1247 - No definition line - 58 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 218 - ds2020-267_894 - No definition line - 160 - - - - - 17919 - 3004588 - 24 - 74661428 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 219 - ds2020-267_335 - No definition line - 248 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 220 - ds2020-267_743 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 221 - ds2020-267_547 - No definition line - 223 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 222 - ds2020-267_804 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 223 - ds2020-267_414 - No definition line - 238 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 224 - ds2020-267_1039 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 225 - ds2020-267_1142 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 226 - ds2020-267_476 - No definition line - 229 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 227 - ds2020-267_1032 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 228 - ds2020-267_114 - No definition line - 347 - - - 1 - gnl|CDD|376336 - pfam00471, Ribosomal_L33, Ribosomal protein L33. - 376336 - 47 - - - 1 - 53.6312 - 130 - 8.05888e-12 - 132 - 302 - 1 - 47 - 3 - 0 - 25 - 31 - 10 - 57 - VTVILECTSCLRNRVNKESTGISRYITQKNRHNTPGRLKLRKFCPCCYKHTIHGEIK - VKITLACTECKE----------RNYTTTKNKKNTPERLELKKYCPKCRKHTLHKETK - V + L CT C Y T KN+ NTP RL+L+K+CP C KHT+H E K - - - - - - - 17919 - 3004588 - 72 - 73720060 - 0.041 - 0.267 - 0.14 - - - - - 229 - ds2020-267_864 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 230 - ds2020-267_1086 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 231 - ds2020-267_1138 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 232 - ds2020-267_897 - No definition line - 150 - - - - - 17919 - 3004588 - 21 - 76220381 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 233 - ds2020-267_1128 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 234 - ds2020-267_737 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 235 - ds2020-267_589 - No definition line - 219 - - - 1 - gnl|CDD|378823 - pfam12161, HsdM_N, HsdM N-terminal domain. This domain is found at the N-terminus of the methylase subunit of Type I DNA methyltransferases. This domain family is found in bacteria and archaea, and is typically between 123 and 138 amino acids in length. The family is found in association with pfam02384. Mutations in this region of EcoKI methyltransferase abolish the normally strong preference of this system for methylating hemimethylated substrate. The structure of this domain has been shown to be all alpha-helical. - 378823 - 134 - - - 1 - 33.892 - 78 - 0.0004347 - 11 - 148 - 58 - 101 - 2 - 0 - 10 - 19 - 2 - 46 - RKESGFVFYNTNKWTLKKLKESASNNQQLLLSNFEEYLNGFSAKSK - PLDAGFGFYIPSELRWSKLLNNDDGDE--LGENLNDAFPGLSELNP - ++GF FY ++ KL + ++ L N + G S + - - - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - - - 236 - ds2020-267_259 - No definition line - 261 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 237 - ds2020-267_971 - No definition line - 123 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 238 - ds2020-267_477 - No definition line - 229 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 239 - ds2020-267_1000 - No definition line - 107 - - - - - 17919 - 3004588 - 9 - 73926242 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 240 - ds2020-267_96 - No definition line - 382 - - - - - 17919 - 3004588 - 76 - 83779944 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 241 - ds2020-267_668 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 242 - ds2020-267_30 - No definition line - 721 - - - - - 17919 - 3004588 - 84 - 233905152 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 243 - ds2020-267_646 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 244 - ds2020-267_166 - No definition line - 298 - - - - - 17919 - 3004588 - 60 - 75248472 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 245 - ds2020-267_206 - No definition line - 279 - - - 1 - gnl|CDD|377170 - pfam03947, Ribosomal_L2_C, Ribosomal Proteins L2, C-terminal domain. - 377170 - 126 - - - 1 - 66.2303 - 163 - 2.63457e-16 - 155 - 265 - 10 - 46 - 2 - 0 - 22 - 29 - 0 - 37 - DMPLGTAIHNIEITLGKSGQLARAAGAVAKLIAKEGK - NIPEGTIIHNIELKPGDGGQLARSAGTYAQIVAKEGK - ++P GT IHNIE+ G GQLAR+AG A+++AKEGK - - - - - - - 17919 - 3004588 - 56 - 74041588 - 0.041 - 0.267 - 0.14 - - - - - 246 - ds2020-267_757 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 247 - ds2020-267_1052 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 248 - ds2020-267_591 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 249 - ds2020-267_1056 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 250 - ds2020-267_508 - No definition line - 226 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.050180004 - 0.267 - 0.14 - - - No hits found - - - 251 - ds2020-267_1131 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 252 - ds2020-267_320 - No definition line - 250 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 253 - ds2020-267_836 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 254 - ds2020-267_661 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 255 - ds2020-267_951 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 256 - ds2020-267_944 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 257 - ds2020-267_1206 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 258 - ds2020-267_1197 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 259 - ds2020-267_47 - No definition line - 528 - - - - - 17919 - 3004588 - 81 - 147549155 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 260 - ds2020-267_193 - No definition line - 284 - - - - - 17919 - 3004588 - 57 - 73378585 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 261 - ds2020-267_1184 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 262 - ds2020-267_1043 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 263 - ds2020-267_946 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 264 - ds2020-267_673 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 265 - ds2020-267_1164 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 266 - ds2020-267_544 - No definition line - 223 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 267 - ds2020-267_634 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 268 - ds2020-267_1189 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 269 - ds2020-267_1132 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 270 - ds2020-267_316 - No definition line - 251 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 46.6847 - 111 - 3.50628e-08 - 28 - 228 - 377 - 444 - -3 - 0 - 26 - 34 - 1 - 68 - NAVYTDFMLGPMKEVGSSLHNGDDVLLGTTSLEITRFTLQRGQRLCIRTQPSKCAFGA-IAEFLRVDH - NCAYAELAGAPWADVPTSIHMGDDVLEGLRTPADATSLLDKYARLGFKVNPSKQSVGHTIAEFLRVAF - N Y + P +V +S+H GDDVL G + L + RL + PSK + G IAEFLRV - - - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - - - 271 - ds2020-267_338 - No definition line - 247 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 272 - ds2020-267_85 - No definition line - 411 - - - - - 17919 - 3004588 - 77 - 97489500 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 273 - ds2020-267_967 - No definition line - 124 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 274 - ds2020-267_783 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 275 - ds2020-267_1239 - No definition line - 59 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 276 - ds2020-267_968 - No definition line - 124 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 277 - ds2020-267_109 - No definition line - 357 - - - - - 17919 - 3004588 - 74 - 75536190 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 278 - ds2020-267_1162 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 279 - ds2020-267_1001 - No definition line - 107 - - - - - 17919 - 3004588 - 9 - 73926242 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 280 - ds2020-267_445 - No definition line - 233 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 281 - ds2020-267_739 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 282 - ds2020-267_17 - No definition line - 1094 - - - - - 17919 - 3004588 - 88 - 394049616 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 283 - ds2020-267_1042 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 284 - ds2020-267_706 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 285 - ds2020-267_10 - No definition line - 1619 - - - - - 17919 - 3004588 - 91 - 615533632 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 286 - ds2020-267_802 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 287 - ds2020-267_1182 - No definition line - 62 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 288 - ds2020-267_730 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 289 - ds2020-267_807 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 290 - ds2020-267_1232 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 291 - ds2020-267_467 - No definition line - 230 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 292 - ds2020-267_875 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 293 - ds2020-267_880 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 294 - ds2020-267_652 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.050180004 - 0.267 - 0.14 - - - No hits found - - - 295 - ds2020-267_481 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 296 - ds2020-267_697 - No definition line - 214 - - - 1 - gnl|CDD|334046 - pfam00378, ECH_1, Enoyl-CoA hydratase/isomerase. This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. - 334046 - 251 - - - 1 - 45.4314 - 108 - 5.08319e-08 - 45 - 170 - 89 - 130 - -3 - 0 - 17 - 24 - 0 - 42 - KPYVVAVQGLCFTAGIELMLNADIVIASDDSCFAQMEVKRGL - KPVIAAVNGYAIGGGCELALACDIIIAADNASFGLNEILIGI - KP + AV G G EL L DI+IA+D++ F E+ G+ - - - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - - - 297 - ds2020-267_398 - No definition line - 240 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 298 - ds2020-267_207 - No definition line - 278 - - - - - 17919 - 3004588 - 55 - 74704591 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 299 - ds2020-267_655 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 300 - ds2020-267_858 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 301 - ds2020-267_686 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 302 - ds2020-267_53 - No definition line - 492 - - - - - 17919 - 3004588 - 80 - 131969712 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 303 - ds2020-267_666 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 304 - ds2020-267_191 - No definition line - 284 - - - - - 17919 - 3004588 - 57 - 73378585 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 305 - ds2020-267_1005 - No definition line - 99 - - - - - 17919 - 3004588 - 7 - 74858030 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 306 - ds2020-267_296 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 307 - ds2020-267_146 - No definition line - 313 - - - - - 17919 - 3004588 - 64 - 74310880 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 308 - ds2020-267_318 - No definition line - 251 - - - 1 - gnl|CDD|376306 - pfam00252, Ribosomal_L16, Ribosomal protein L16p/L10e. - 376306 - 124 - - - 1 - 54.7265 - 133 - 5.63854e-12 - 78 - 206 - 81 - 124 - -1 - 0 - 23 - 28 - 1 - 44 - MGSGKGSPEYWVAVVKPCRIL-SAMSGVAENIARRAISIEASKM - MGKGKGKPEGWVARVKPGRILFEIRGGVHEEVAKEALRLAAHKL - MG GKG PE WVA VKP RIL GV E +A+ A+ + A K+ - - - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - - - 309 - ds2020-267_1050 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 310 - ds2020-267_819 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 311 - ds2020-267_809 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 312 - ds2020-267_857 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 313 - ds2020-267_725 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 314 - ds2020-267_991 - No definition line - 114 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 315 - ds2020-267_20 - No definition line - 893 - - - 1 - gnl|CDD|376291 - pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain. This entry includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho. - 376291 - 212 - - - 1 - 160.19 - 407 - 4.59259e-49 - 498 - 866 - 1 - 113 - 3 - 0 - 44 - 69 - 10 - 123 - GLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQLNSRATSESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALITYDN - GIRAIDGLLPIGRGQRIGIFGGSGVGKTVLA-GMIARQASAD---------VVVVYALIGERGREVREFIEELLESGALKRTVVVVATSDEPPLARYLAPYTALTIAEYFRDQGKDVLLIMDS - G++A+D L+PIGRGQR I G GKT +A I Q + + VY IG++ V + ++ L E+ AL+ +++V AT+ +P ++LAPY+ + EYFRD G L+ D+ - - - - - 2 - gnl|CDD|367225 - pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain. This family includes the ATP synthase alpha and beta subunits the ATP synthase associated with flagella. - 367225 - 69 - - - 1 - 76.7994 - 190 - 7.30466e-19 - 126 - 329 - 2 - 69 - 3 - 0 - 32 - 39 - 0 - 68 - VDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTG - VQVIGPVVDVEFGIGRLPGLLNALEVELVEFGTGVLGEVLNLGEDKVRVQVFGGTSGLSRGDEVKRTG - V IG VV V GI R+ GL E+VEF +GV G LNL + V + VFG + + GD VKRTG - - - - - - - 17919 - 3004588 - 86 - 308809894 - 0.041 - 0.267 - 0.14 - - - - - 316 - ds2020-267_982 - No definition line - 119 - - - - - 17919 - 3004588 - 12 - 75318120 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 317 - ds2020-267_215 - No definition line - 275 - - - - - 17919 - 3004588 - 54 - 75367594 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 318 - ds2020-267_1139 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 319 - ds2020-267_434 - No definition line - 234 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 320 - ds2020-267_86 - No definition line - 408 - - - - - 17919 - 3004588 - 77 - 95864675 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 321 - ds2020-267_484 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 322 - ds2020-267_1129 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 323 - ds2020-267_551 - No definition line - 223 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 324 - ds2020-267_545 - No definition line - 223 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 325 - ds2020-267_900 - No definition line - 142 - - - - - 17919 - 3004588 - 19 - 74595556 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 326 - ds2020-267_731 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 327 - ds2020-267_394 - No definition line - 240 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 328 - ds2020-267_1069 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 329 - ds2020-267_329 - No definition line - 249 - - - 1 - gnl|CDD|379049 - pfam13173, AAA_14, AAA domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. - 379049 - 128 - - - 1 - 44.8626 - 107 - 4.80752e-08 - 106 - 249 - 8 - 51 - 1 - 0 - 17 - 24 - 4 - 48 - TGVRRSGKSVLLMQYRDYLLSQQISAENIIYINFESFEYQWVKVADVL - TGPRQVGKTTLLKQLAKELLPP----ENILYINLDDPRLLELADFELL - TG R+ GK+ LL Q LL ENI+YIN + + ++L - - - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - - - 366 - ds2020-267_74 - No definition line - 425 - - - - - 17919 - 3004588 - 78 - 101235078 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 367 - ds2020-267_714 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 368 - ds2020-267_130 - No definition line - 330 - - - 1 - gnl|CDD|366242 - pfam00680, RdRP_1, RNA dependent RNA polymerase. - 366242 - 470 - - - 1 - 38.1065 - 89 - 7.64962e-05 - 124 - 282 - 203 - 255 - 1 - 0 - 18 - 30 - 2 - 54 - TTPIKVGM-PLNGFWLSKLFSKHARCQMHIEGDFEAFDSTISGSVVDLIKDVRK - KLGIAVGINPFSRDW-ERLGALIRKGSDVLDVDYSAFDSTLSPFVFDLVEDIRS - I VG+ P + W +L + + ++ D+ AFDST+S V DL++D+R - - - - - - - 17919 - 3004588 - 68 - 75016032 - 0.041 - 0.267 - 0.14 - - - - - 369 - ds2020-267_247 - No definition line - 264 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 370 - ds2020-267_1062 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 371 - ds2020-267_183 - No definition line - 288 - - - - - 17919 - 3004588 - 58 - 74680868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 372 - ds2020-267_995 - No definition line - 111 - - - - - 17919 - 3004588 - 10 - 76285746 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 373 - ds2020-267_717 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 374 - ds2020-267_720 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 375 - ds2020-267_280 - No definition line - 257 - - - 1 - gnl|CDD|366811 - pfam01788, PsbJ, PsbJ. This family consists of the photosystem II reaction centre protein PsbJ from plants and Cyanobacteria. In Synechocystis sp. PCC 6803 PsbJ regulates the number of photosystem II centers in thylakoid membranes, it is a predicted 4kDa protein with one membrane spanning domain. - 366811 - 38 - - - 1 - 46.2086 - 110 - 2.47901e-09 - 132 - 224 - 1 - 31 - -1 - 0 - 22 - 27 - 0 - 31 - DTTGRIPLWIIGTVAGILVIGLIGIFFYGSY - SGTGRIPLWLVATVAGLGVIGVVGIFFYGSY - TGRIPLW++ TVAG+ VIG++GIFFYGSY - - - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - - - 408 - ds2020-267_28 - No definition line - 727 - - - - - 17919 - 3004588 - 84 - 236903936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 409 - ds2020-267_696 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 410 - ds2020-267_100 - No definition line - 376 - - - 1 - gnl|CDD|376940 - pfam02823, ATP-synt_DE_N, ATP synthase, Delta/Epsilon chain, beta-sandwich domain. Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. The subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213). - 376940 - 79 - - - 1 - 48.1873 - 116 - 3.06167e-09 - 228 - 347 - 39 - 79 - -3 - 0 - 15 - 26 - 1 - 41 - TAVDIGILRIRL-NDQWLTMALMGGFARIGNNEITVLVNDA - TALKPGVLRIKTADGEEEYIAVSGGFLEVQPNEVTILADTA - TA+ G+LRI+ + + +A+ GGF + NE+T+L + A - - - - - 2 - gnl|CDD|366077 - pfam00401, ATP-synt_DE, ATP synthase, Delta/Epsilon chain, long alpha-helix domain. Part of the ATP synthase CF(1). These subunits are part of the head unit of the ATP synthase. This subunit is called epsilon in bacteria and delta in mitochondria. In bacteria the delta (D) subunit is equivalent to the mitochondrial Oligomycin sensitive subunit, OSCP (pfam00213). - 366077 - 45 - - - 1 - 35.8096 - 84 - 8.90041e-05 - 87 - 218 - 1 - 45 - -3 - 0 - 16 - 23 - 1 - 45 - SDIDPQEAQQTLEIAEANLRKAEGKRQ-TIEANLALRRARTRVEA - EDIDEERAEEAKERAEERLAQAKQDDIDYARAQAALARALARLQA - DID + A++ E AE L +A+ A AL RA R++A - - - - - - - 17919 - 3004588 - 76 - 80494456 - 0.041 - 0.267 - 0.14 - - - - - 430 - ds2020-267_926 - No definition line - 130 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 431 - ds2020-267_436 - No definition line - 234 - - - 1 - gnl|CDD|365910 - pfam00155, Aminotran_1_2, Aminotransferase class I and II. - 365910 - 356 - - - 1 - 35.3773 - 82 - 0.000283584 - 12 - 191 - 276 - 329 - -2 - 0 - 13 - 24 - 6 - 60 - QQRNIAIERLNAIKGISCTMPQGAFYCFPKIDRDIYPIEDDMQFMMELLLQEKVLMVTGT - KRRDYLRDGLQAA-GLSVLPSQAGFFLLTGLDP-----ETAKELAQVLLEEVGVYVTPGS - ++R+ + L A G+S Q F+ +D E + LL + V + G+ - - - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - - - 432 - ds2020-267_158 - No definition line - 305 - - - - - 17919 - 3004588 - 62 - 73850790 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 433 - ds2020-267_996 - No definition line - 109 - - - - - 17919 - 3004588 - 10 - 73460348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 434 - ds2020-267_1076 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 435 - ds2020-267_871 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 436 - ds2020-267_748 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 437 - ds2020-267_210 - No definition line - 276 - - - 1 - gnl|CDD|375428 - pfam17917, RT_RNaseH, RNase H-like domain found in reverse transcriptase. DNA polymerase and ribonuclease H (RNase H) activities allow reverse transcriptases to convert the single-stranded retroviral RNA genome into double-stranded DNA, which is integrated into the host chromosome during infection. This entry represents the RNase H like domain. - 375428 - 103 - - - 1 - 58.6334 - 143 - 1.59337e-13 - 52 - 240 - 12 - 76 - 1 - 0 - 25 - 34 - 4 - 66 - AS---MSCVLGQHDETGRKERALYYLSKKFTDYETRYTVLEKTCCALTRASQRLRHYMLNYTTMLI - ASDYGIGAVLSQEDEDG-KERPIAYASRKLTPAERNYSTTEKELLAIVWALKKFRHYLLGRKFTVY - AS + VL Q DE G KER + Y S+K T E Y+ EK A+ A ++ RHY+L + - - - - - 2 - gnl|CDD|375430 - pfam17919, RT_RNaseH_2, RNase H-like domain found in reverse transcriptase. - 375430 - 100 - - - 1 - 51.7059 - 125 - 6.42624e-11 - 52 - 237 - 37 - 100 - 1 - 0 - 21 - 33 - 4 - 65 - AS---MSCVLGQHDETGRKERALYYLSKKFTDYETRYTVLEKTCCALTRASQRLRHYMLNYTTML - ASDYGIGAVLSQEDD-GGGERPIAFASRKLSPAERNYSTTEKELLAIVWALKKFRHYLLGRKFTI - AS + VL Q D+ G ER + + S+K + E Y+ EK A+ A ++ RHY+L + - - - - - - - 17919 - 3004588 - 55 - 74704591 - 0.041 - 0.267 - 0.14 - - - - - 438 - ds2020-267_1223 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 439 - ds2020-267_246 - No definition line - 264 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 440 - ds2020-267_856 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 441 - ds2020-267_58 - No definition line - 476 - - - 1 - gnl|CDD|367590 - pfam03641, Lysine_decarbox, Possible lysine decarboxylase. The members of this family share a highly conserved motif PGGXGTXXE that is probably functionally important. This family includes proteins annotated as lysine decarboxylases, although the evidence for this is not clear. - 367590 - 128 - - - 1 - 62.6055 - 153 - 7.19579e-14 - 142 - 315 - 1 - 58 - -3 - 0 - 25 - 35 - 0 - 58 - VADGVIEKNGIAVGVIPEFMMDREVAHGGLTRLHLTDTMHTSKAIMAEYASAFITLPG - VADGALEAGGRVIGIIPNILLPEEIPNPNVTELIIVPDMHERKAKMAELADAFVALPG - VADG +E G +G+IP ++ E+ + +T L + MH KA MAE A AF+ LPG - - - - - - - 17919 - 3004588 - 79 - 125529973 - 0.041 - 0.267 - 0.14 - - - - - 442 - ds2020-267_903 - No definition line - 142 - - - - - 17919 - 3004588 - 19 - 74595556 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 443 - ds2020-267_413 - No definition line - 238 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 444 - ds2020-267_733 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 445 - ds2020-267_754 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 446 - ds2020-267_299 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 447 - ds2020-267_36 - No definition line - 651 - - - - - 17919 - 3004588 - 83 - 203319674 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 448 - ds2020-267_1166 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 449 - ds2020-267_451 - No definition line - 232 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 450 - ds2020-267_466 - No definition line - 230 - - - 1 - gnl|CDD|333815 - pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. - 333815 - 111 - - - 1 - 44.0621 - 105 - 5.42419e-08 - 50 - 208 - 1 - 51 - 2 - 0 - 19 - 32 - 2 - 53 - VLVVDDHDLVRMGIVRMLSDSPDIDMIGEATDGETAIIKTKQLNPDVVLLDVR - VLIVDDDPLIRELLRQLL-EKEGYV-VAEADDGKEALELLKEERPDLILLDIN - VL+VDD L+R + ++L + + EA DG+ A+ K+ PD++LLD+ - - - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - - - 451 - ds2020-267_1208 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 452 - ds2020-267_327 - No definition line - 249 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 453 - ds2020-267_691 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 454 - ds2020-267_775 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 455 - ds2020-267_975 - No definition line - 122 - - - - - 17919 - 3004588 - 13 - 74834307 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 456 - ds2020-267_1222 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 457 - ds2020-267_483 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 458 - ds2020-267_1159 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 459 - ds2020-267_1048 - No definition line - 75 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 460 - ds2020-267_568 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 461 - ds2020-267_12 - No definition line - 1539 - - - - - 17919 - 3004588 - 90 - 588764394 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 462 - ds2020-267_950 - No definition line - 127 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.049250052 - 0.267 - 0.14 - - - No hits found - - - 463 - ds2020-267_861 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 464 - ds2020-267_118 - No definition line - 343 - - - 1 - gnl|CDD|366090 - pfam00421, PSII, Photosystem II protein. - 366090 - 499 - - - 1 - 138.798 - 350 - 7.68219e-41 - 92 - 337 - 323 - 404 - -1 - 0 - 59 - 64 - 0 - 82 - LTVRGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGA - LFRVGPMDNGDGLMRSWLGHIIFGDETGRFLDVRRMPNFFETFPVVLVDKDGIVRADIPFRRGESGYSLEQTGVTVQFYGGE - L G MDNGDG+ WLGH IF D+ GR L VRRMP FFETFPVVLVD DGIVRAD+PFRR ES YS+EQ GVTV+FYGG - - - - - - - 17919 - 3004588 - 71 - 74490577 - 0.041 - 0.267 - 0.14 - - - - - 465 - ds2020-267_703 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 466 - ds2020-267_304 - No definition line - 253 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 1 - ds2020-267_962 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.06567078 - 0.267 - 0.14 - - - No hits found - - - 2 - ds2020-267_848 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 3 - ds2020-267_643 - No definition line - 216 - - - 1 - gnl|CDD|365856 - pfam00078, RVT_1, Reverse transcriptase (RNA-dependent DNA polymerase). A reverse transcriptase gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. Reverse transcriptases occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. - 365856 - 184 - - - 1 - 33.8002 - 78 - 0.000675747 - 76 - 204 - 41 - 72 - 1 - 0 - 12 - 17 - 11 - 43 - SHFRSGRGRHSALRRIKEEWGTSRWFLEFDIRKCFHTINRSSL - PGFRPGRSLKKA-----------KWFLKLDLKKAFDQVPLDEL - FR GR A +WFL+ D++K F + L - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 4 - ds2020-267_1196 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 5 - ds2020-267_18 - No definition line - 1037 - - - - - 17919 - 3004588 - 87 - 372973830 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 6 - ds2020-267_623 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 7 - ds2020-267_853 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 8 - ds2020-267_626 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 9 - ds2020-267_5 - No definition line - 2029 - - - 1 - gnl|CDD|366242 - pfam00680, RdRP_1, RNA dependent RNA polymerase. - 366242 - 470 - - - 1 - 41.5733 - 98 - 0.000288253 - 840 - 1661 - 166 - 417 - 3 - 0 - 50 - 85 - 50 - 288 - KDDPNKMRTIWGCSKPWIIADTMLWWEYVAYAKLQPGATPMLWSYETFTGGWLRLNHALFSSYIRHSYITLDWKRFDKKAYFCIIDKIFDGVETFLDFDNGYLPTKD--YPDTKSTWTQERSTRLKRLFDWTKENFYHAPIVLPNGHMYVRKFAGIPSGLFITQLIDSWYN-YTMLATILSAMGF----DPRSCIIKVQGDDSIIRLSALIPPDAHDSFLTKVQELADYYFQSVVSVNKSE---VRNELNGCEVLSYR-HRHGLPYRDEL---AMLAQLYHTKARNPS - KVQAGKTRLFWGCPVEVNLVARAVFGPFCNKIYSNALKLGIAVGINPFSRDWERL-GALIRKG--SDVLDVDYSAFDSTLSPFVFDLVEDIRSEFCGG----LEPTRLALLELLSN-----------------------PIHILGG-TIIKVEGGLPSGQPATSVINSILNNIYVLYALIKHTGESELDDHETIRFISYGDDNLVAVNPDVDSVGDRLS----EHLKDLG-LTPTRADKTSEFSPIKPLEEVSFLKRTFSRTEGGVRPRLDRKSIERQLAWARAGNTS - K K R WGC + ++ + + F+ W RL AL + +D+ FD + D + D F L + S PI + G ++ G+PSG T +I+S N +L ++ G D + GDD+++ ++ + + L D + +K+ L L R R L ++ QL +A N S - - - - - - - 17919 - 3004588 - 92 - 791927360 - 0.041 - 0.267 - 0.14 - - - - - 10 - ds2020-267_501 - No definition line - 227 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 11 - ds2020-267_938 - No definition line - 128 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 12 - ds2020-267_177 - No definition line - 290 - - - - - 17919 - 3004588 - 58 - 74680868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 13 - ds2020-267_408 - No definition line - 238 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 14 - ds2020-267_416 - No definition line - 237 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 15 - ds2020-267_1225 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 16 - ds2020-267_842 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 17 - ds2020-267_796 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 18 - ds2020-267_761 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 19 - ds2020-267_628 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 20 - ds2020-267_1192 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 21 - ds2020-267_590 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 22 - ds2020-267_506 - No definition line - 226 - - - 1 - gnl|CDD|377479 - pfam05173, DapB_C, Dihydrodipicolinate reductase, C-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The C-terminal domain of DapB has been proposed to be the substrate- binding domain. - 377479 - 132 - - - 1 - 68.2474 - 168 - 2.45773e-17 - 93 - 215 - 15 - 55 - -3 - 0 - 25 - 28 - 0 - 41 - LYTGYDIEIIEAHHKHKADAPSGTALKMGEVIDEARGTFKP - LGDAYDVEIIEKHHNQKKDAPSGTALKLAEAIAEARGEYNA - L YD+EIIE HH K DAPSGTALK+ E I EARG + - - - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - - - 23 - ds2020-267_297 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 24 - ds2020-267_838 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 25 - ds2020-267_965 - No definition line - 124 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 26 - ds2020-267_228 - No definition line - 271 - - - - - 17919 - 3004588 - 54 - 73330632 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 27 - ds2020-267_1021 - No definition line - 81 - - - - - 17919 - 3004588 - 2 - 74218750 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 28 - ds2020-267_1150 - No definition line - 65 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 29 - ds2020-267_1202 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 30 - ds2020-267_1127 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 31 - ds2020-267_57 - No definition line - 477 - - - - - 17919 - 3004588 - 79 - 127118960 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 32 - ds2020-267_665 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 33 - ds2020-267_846 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 34 - ds2020-267_442 - No definition line - 233 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 35 - ds2020-267_142 - No definition line - 318 - - - - - 17919 - 3004588 - 65 - 75433973 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 36 - ds2020-267_901 - No definition line - 142 - - - - - 17919 - 3004588 - 19 - 74595556 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 37 - ds2020-267_1174 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 38 - ds2020-267_584 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 39 - ds2020-267_315 - No definition line - 251 - - - 1 - gnl|CDD|366402 - pfam00989, PAS, PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya. - 366402 - 112 - - - 1 - 37.783 - 88 - 1.61999e-05 - 32 - 241 - 1 - 72 - 2 - 0 - 19 - 34 - 2 - 72 - KHYRQLVNHASEGIIVV-QNQKIVFANPQIYKLTARQPDSLLAFNFTDLIDEADRLIVQD-YEQRCLQGERC - EDLRAILESLPDGIFVVDEDGRILYVNAAAEELLGLSREEVIGKSLLDLIPEDDRAEVVELLRQALRQGEES - + R ++ +GI VV ++ +I++ N +L + ++ + DLI E DR V + Q QGE - - - - - 2 - gnl|CDD|379059 - pfam13188, PAS_8, PAS domain. - 379059 - 65 - - - 1 - 33.6888 - 77 - 0.000292007 - 32 - 199 - 1 - 58 - 2 - 0 - 15 - 26 - 2 - 58 - KHYRQLVNHASEGIIVV-QNQKIVFANPQIYKLT-ARQPDSLLAFNFTDLIDEADRLI - ERLRALFESSPDGILVLDDGGRIIYANPAALELLGYELLGELLGELLPDLDPLLEDLL - + R L + +GI+V+ +I++ANP +L LL DL + L+ - - - - - 3 - gnl|CDD|379177 - pfam13426, PAS_9, PAS domain. - 379177 - 102 - - - 1 - 33.9742 - 78 - 0.000472059 - 62 - 193 - 1 - 45 - 2 - 0 - 12 - 24 - 1 - 45 - SEGIIVV-QNQKIVFANPQIYKLTARQPDSLLAFNFTDLIDEADR - PDGILITDEDGRIIYVNPAALRLLGYTREELLGKSITDLFTEPEA - +GI++ ++ +I++ NP +L + LL + TDL E + - - - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - - - 40 - ds2020-267_227 - No definition line - 272 - - - 1 - gnl|CDD|334294 - pfam00873, ACR_tran, AcrB/AcrD/AcrF family. Members of this family are integral membrane proteins. Some are involved in drug resistance. AcrB cooperates with a membrane fusion protein, AcrA, and an outer membrane channel TolC. The structure shows the AcrB forms a homotrimer. - 334294 - 1010 - - - 1 - 67.321 - 165 - 2.32215e-15 - 36 - 245 - 179 - 248 - -1 - 0 - 18 - 40 - 0 - 70 - GRQRQIRVLLNPTQMNAYKVSVNQISNALRPQNVELPVGTITNQNQEMVIQVNGLVKTPNEFNQISVAQN - GSQYAMRIWLDPQKLASYGLTLTDVVSALKAQNVNIGAGQLEGQGLQALIRAQGRLQSAEDFEKIIVKNQ - G Q +R+ L+P ++ +Y +++ + +AL+ QNV + G + Q + +I+ G +++ +F +I V - - - - - - - 17919 - 3004588 - 54 - 73330632 - 0.05830098 - 0.267 - 0.14 - - - - - 41 - ds2020-267_458 - No definition line - 231 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 42 - ds2020-267_170 - No definition line - 295 - - - - - 17919 - 3004588 - 60 - 73319024 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 72 - ds2020-267_639 - No definition line - 216 - - - 1 - gnl|CDD|379304 - pfam13631, Cytochrom_B_N_2, Cytochrome b(N-terminal)/b6/petB. - 379304 - 169 - - - 1 - 42.2222 - 100 - 4.98182e-07 - 2 - 214 - 81 - 152 - 2 - 0 - 23 - 35 - 1 - 72 - GGYSVDSPTLTRFFTFHF-ILPFIIAALAALHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFL - GGDFPGTATLPRFYALHVLLLPGLILALIVAHLLLVEKHGQFPPPGTEKNVVGVPFWPVFAVKMLLFFLVTV - GG + TL RF+ H +LP +I AL HLL + + G P G + + F P + +K L L+ + - - - - - 2 - gnl|CDD|306530 - pfam00033, Cytochrome_B, Cytochrome b/b6/petB. - 306530 - 189 - - - 1 - 37.3615 - 87 - 3.68894e-05 - 2 - 118 - 151 - 189 - 2 - 0 - 28 - 32 - 0 - 39 - GGYSVDSPTLTRFFTFHFILPFIIAALAALHLLFLHETG - GSFSVDQATLTRFFSLHFLLPFILAILMLLHLLFLHETG - G +SVD TLTRFF+ HF+LPFI+A L LHLLFLHETG - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 73 - ds2020-267_72 - No definition line - 438 - - - - - 17919 - 3004588 - 78 - 109269608 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 74 - ds2020-267_865 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 99 - ds2020-267_927 - No definition line - 130 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 100 - ds2020-267_116 - No definition line - 345 - - - - - 17919 - 3004588 - 72 - 73720060 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 101 - ds2020-267_407 - No definition line - 239 - - - 1 - gnl|CDD|365924 - pfam00177, Ribosomal_S7, Ribosomal protein S7p/S5e. This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes. - 365924 - 143 - - - 1 - 41.2271 - 98 - 1.14399e-06 - 28 - 126 - 111 - 143 - 1 - 0 - 15 - 20 - 0 - 33 - EKCLFAEILDAYRKRGIARKKRENLHRLASTNR - AERLANELIDAANGRGAAVKKKEETHRMAEANR - + L E++DA RG A KK+E HR+A NR - - - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - - - 102 - ds2020-267_687 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 103 - ds2020-267_457 - No definition line - 231 - - - 1 - gnl|CDD|366121 - pfam00481, PP2C, Protein phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase. - 366121 - 253 - - - 1 - 34.6201 - 80 - 0.000499491 - 10 - 111 - 34 - 67 - 1 - 0 - 12 - 18 - 0 - 34 - RKAFGVYDGHGGAEVARACRDRMHELVAEAVELE - WSFFAVFDGHGGSEAAKYCGKHLHTILALRRSFL - F V+DGHGG+E A+ C +H ++A - - - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - - - 104 - ds2020-267_601 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 105 - ds2020-267_402 - No definition line - 239 - - - 1 - gnl|CDD|368759 - pfam06122, TraH, Conjugative relaxosome accessory transposon protein. The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon. - 368759 - 357 - - - 1 - 33.8542 - 78 - 0.000851192 - 65 - 235 - 191 - 244 - 2 - 0 - 16 - 21 - 7 - 59 - GNVTWQALSKVAGLREVDKRR--FMGLLGKVVFGENGKITPYFTSNDKVIEEVDPSCGR - GNLVWKALKKNGFFAGDTELAELLMSLVGTVIIGANAA-----DGGGKVDVRVIPPLAT - GN+ W+AL K + M L+G V+ G N KV V P - - - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - - - 106 - ds2020-267_1083 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 107 - ds2020-267_914 - No definition line - 134 - - - - - 17919 - 3004588 - 16 - 76100752 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 108 - ds2020-267_566 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 109 - ds2020-267_518 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 110 - ds2020-267_694 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 111 - ds2020-267_369 - No definition line - 243 - - - 1 - gnl|CDD|378818 - pfam12137, RapA_C, RNA polymerase recycling family C-terminal. This domain is found in bacteria. This domain is about 360 amino acids in length. This domain is found associated with pfam00271, pfam00176. The function of this domain is not known, but structurally it forms an alpha-beta fold in nature with a central beta-sheet flanked by helices and loops, the beta-sheet being mainly antiparallel and flanked by four alpha helices, among which the two longer helices exhibit a coiled-coil arrangement. - 378818 - 360 - - - 1 - 37.1168 - 87 - 6.51052e-05 - 137 - 217 - 135 - 162 - -3 - 0 - 14 - 19 - 1 - 28 - LHPSDEVQVQGL-AVPEDGMTLTFERDQ - LRPSDHMLVPDFPGLPEDGMTVTFDRET - L PSD + V +PEDGMT+TF+R+ - - - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - - - 112 - ds2020-267_735 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 113 - ds2020-267_32 - No definition line - 701 - - - - - 17919 - 3004588 - 84 - 223409408 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 114 - ds2020-267_239 - No definition line - 266 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 115 - ds2020-267_795 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 116 - ds2020-267_750 - No definition line - 211 - - - 1 - gnl|CDD|376774 - pfam02391, MoaE, MoaE protein. This family contains the MoaE protein that is involved in biosynthesis of molybdopterin. Molybdopterin, the universal component of the pterin molybdenum cofactors, contains a dithiolene group serving to bind Mo. Addition of the dithiolene sulfurs to a molybdopterin precursor requires the activity of the converting factor. Converting factor contains the MoaE and MoaD proteins. - 376774 - 112 - - - 1 - 37.815 - 89 - 1.24642e-05 - 28 - 114 - 61 - 89 - -2 - 0 - 8 - 17 - 0 - 29 - AKGQFDIENAIAIHRIGDLAIGEMAVWIG - ARERWPLLDVAIVHRVGRLPVGEAIVLVA - A+ ++ + + +HR+G L +GE V + - - - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - - - 117 - ds2020-267_919 - No definition line - 131 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 118 - ds2020-267_148 - No definition line - 313 - - - - - 17919 - 3004588 - 64 - 74310880 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 119 - ds2020-267_581 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 120 - ds2020-267_1157 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 121 - ds2020-267_452 - No definition line - 232 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 122 - ds2020-267_1100 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 123 - ds2020-267_816 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 124 - ds2020-267_428 - No definition line - 235 - - - 1 - gnl|CDD|333891 - pfam00164, Ribosom_S12_S23, Ribosomal protein S12/S23. This protein is known as S12 in bacteria and archaea and S23 in eukaryotes. - 333891 - 113 - - - 1 - 86.7373 - 215 - 1.04166e-24 - 3 - 182 - 32 - 100 - 3 - 0 - 37 - 45 - 9 - 69 - KKPNSALRKMAKVRLS-NQHDTFAYIPGEG--HNLQEHSMVLIRGGR----VKDLPGVKFHCIR--GVK - KQPNSALRKCVRVRLIKNGKEVTAFIPGDGAIHFLQEHDEVLIRGGGGPHAVGDLPGVRYKVVRVAGVS - K+PNSALRK +VRL N + A+IPG+G H LQEH VLIRGG V DLPGV++ +R GV - - - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - - - 125 - ds2020-267_1199 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 126 - ds2020-267_684 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 127 - ds2020-267_1231 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 128 - ds2020-267_199 - No definition line - 283 - - - - - 17919 - 3004588 - 57 - 73378585 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 129 - ds2020-267_430 - No definition line - 235 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 130 - ds2020-267_997 - No definition line - 109 - - - - - 17919 - 3004588 - 10 - 73460348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 131 - ds2020-267_203 - No definition line - 281 - - - 1 - gnl|CDD|367312 - pfam03040, CemA, CemA family. Members of this family are probable integral membrane proteins. Their molecular function is unknown. CemA proteins are found in the inner envelope membrane of chloroplasts but not in the thylakoid membrane. A cyanobacterial member of this family has been implicated in CO2 transport, but is probably not a CO2 transporter itself. They are predicted to be haem-binding however this has not been proven experimentally. - 367312 - 228 - - - 1 - 84.8795 - 211 - 1.76794e-22 - 121 - 231 - 192 - 228 - -3 - 0 - 26 - 32 - 0 - 37 - LVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND - FIATFPVILDTVFKYWIFRYLNRISPSAVATYRNMNE - ++TFPVILDT+FKYWIFRYLNR+SPS V Y +MN+ - - - - - - - 17919 - 3004588 - 56 - 74041588 - 0.041 - 0.267 - 0.14 - - - - - 132 - ds2020-267_887 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 173 - ds2020-267_1217 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 174 - ds2020-267_536 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 175 - ds2020-267_1177 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 176 - ds2020-267_33 - No definition line - 680 - - - 1 - gnl|CDD|367847 - pfam04157, EAP30, EAP30/Vps36 family. This family includes EAP30 as well as the Vps36 protein. Vps36 is involved in Golgi to endosome trafficking. EAP30 is a subunit of the ELL complex. The ELL is an 80-kDa RNA polymerase II transcription factor. ELL interacts with three other proteins to form the complex known as ELL complex. The ELL complex is capable of increasing that catalytic rate of transcription elongation, but is unable to repress initiation of transcription by RNA polymerase II as is the case of ELL. EAP30 is thought to lead to the derepression of ELL's transcriptional inhibitory activity. - 367847 - 216 - - - 1 - 63.8066 - 156 - 4.86455e-13 - 342 - 494 - 1 - 51 - -1 - 0 - 21 - 35 - 0 - 51 - VGVSGILRKEQEMWESTDKSLQDAFQDLNALMSKAKEMVMLAEKMRQKLLS - VGIAAIERRQEQQREQYDELLSSAFEDLEALMSKFKELVEFAKKHKKEIKK - VG++ I R++++ E D+ L AF+DL ALMSK KE+V A+K ++++ - - - - - - - 17919 - 3004588 - 83 - 216975473 - 0.041 - 0.267 - 0.14 - - - - - 197 - ds2020-267_885 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 198 - ds2020-267_6 - No definition line - 1860 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 83.6639 - 207 - 1.35634e-17 - 1147 - 1764 - 288 - 464 - -1 - 0 - 49 - 81 - 31 - 207 - RRVMEMSTQGVVACIDARNFNILHTQEVMASILESASVMLGSRLSEEQHKCLKWLSKAELNQKVLVKKGEVTEELLSAGRQEGWINQMMKGDGTMVEAATVTVGMFSGTRFTMLYNTILNRAYYKVAEELAGIKTLSLHSGDDVYSAFASYIDVYKMKKAMAFIGYTLQLAK-CFLQGVREFLRISHKNANTSQYLARSAATAIHGR - WSVQDWKRGGVSLMLDYDDFNSQHSTESMRAVFER----LRRRLPDEPAEAADWLVCS--------------------------MDSMYQLSDGTLLAQRVPGTLKSGHRATTFINSVLNCAYAELAGAPWADVPTSIHMGDDVLEGLRTPADATSLLDKYARLGFKVNPSKQSVGHTIAEFLRVAFCSHEVRGYLARAIASLVSGN - V + GV +D +FN H+ E M ++ E L RL +E + WL + ++ M + + A V + SG R T N++LN AY ++A S+H GDDV + D + A +G+ + +K + EFLR++ + YLAR+ A+ + G - - - - - - - 17919 - 3004588 - 92 - 715989120 - 0.041 - 0.267 - 0.14 - - - - - 199 - ds2020-267_1246 - No definition line - 58 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 200 - ds2020-267_555 - No definition line - 222 - - - 1 - gnl|CDD|365890 - pfam00124, Photo_RC, Photosynthetic reaction centre protein. - 365890 - 260 - - - 1 - 44.9254 - 107 - 7.71427e-08 - 48 - 203 - 20 - 63 - 3 - 0 - 17 - 25 - 8 - 52 - VFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAMLPTSAAIGFHV*PISE - IIGIGFVAAPSVDW--------NPLLFGRNLWTLAIEPPSPSYGLSFAPLWE - + I F+AAP VD LL+G N+ + A+ P S + G P+ E - - - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - - - 201 - ds2020-267_525 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 202 - ds2020-267_587 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 203 - ds2020-267_1220 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 204 - ds2020-267_87 - No definition line - 403 - - - - - 17919 - 3004588 - 77 - 92615025 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 205 - ds2020-267_1176 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 206 - ds2020-267_834 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 207 - ds2020-267_909 - No definition line - 139 - - - - - 17919 - 3004588 - 18 - 75097288 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 208 - ds2020-267_911 - No definition line - 138 - - - - - 17919 - 3004588 - 18 - 75097288 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 209 - ds2020-267_594 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 210 - ds2020-267_195 - No definition line - 283 - - - - - 17919 - 3004588 - 57 - 73378585 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 211 - ds2020-267_640 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 212 - ds2020-267_583 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 213 - ds2020-267_1013 - No definition line - 91 - - - - - 17919 - 3004588 - 4 - 76255712 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 214 - ds2020-267_1250 - No definition line - 58 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 215 - ds2020-267_530 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 216 - ds2020-267_751 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 217 - ds2020-267_550 - No definition line - 223 - - - 1 - gnl|CDD|377548 - pfam05694, SBP56, 56kDa selenium binding protein (SBP56). This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea. The exact function of this protein is unknown although it is thought that SBP56 participates in late stages of intra-Golgi protein transport. The Lotus japonicus homolog of SBP56, LjSBP is thought to have more than one physiological role and can be implicated in controlling the oxidation/reduction status of target proteins, in vesicular Golgi transport. - 377548 - 454 - - - 1 - 33.4244 - 77 - 0.00097637 - 43 - 216 - 128 - 182 - -2 - 0 - 21 - 27 - 3 - 58 - GAARPQTHACGPCGRLRQYHLGRADQPRIADVLLLDSGSKDVRA*LQRWDKARSPTQL - GYSRPHTVHCLPDGEIYISALGDADGNGPGGFLLLDHETFEVKG---RWEKDRGPQLF - G +RP T C P G + LG AD LLLD + +V+ RW+K R P - - - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - - - 218 - ds2020-267_958 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 219 - ds2020-267_554 - No definition line - 222 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 220 - ds2020-267_474 - No definition line - 229 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 221 - ds2020-267_127 - No definition line - 334 - - - - - 17919 - 3004588 - 69 - 74263434 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 222 - ds2020-267_65 - No definition line - 462 - - - 1 - gnl|CDD|372592 - pfam13406, SLT_2, Transglycosylase SLT domain. This family is related to the SLT domain pfam01464. - 372592 - 292 - - - 1 - 100.321 - 251 - 4.82338e-27 - 145 - 360 - 50 - 121 - -1 - 0 - 32 - 50 - 0 - 72 - PWEYIDGAASSSRVSGGQRNFASQSALLDRIENQYGVPASIVTAIWGMESSYGQGTGNSSLDNSLATLAYDG - WWDYLARFVTPARIARGRAFLQEHAALLARIEKRYGVPPEIIVAIWGVETNYGRYTGNFPVLDALATLAFDG - W+Y+ + +R++ G+ +ALL RIE +YGVP I+ AIWG+E++YG+ TGN + ++LATLA+DG - - - - - - - 17919 - 3004588 - 79 - 119174025 - 0.041 - 0.267 - 0.14 - - - - - 223 - ds2020-267_1168 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 224 - ds2020-267_330 - No definition line - 249 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 225 - ds2020-267_678 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 226 - ds2020-267_83 - No definition line - 414 - - - - - 17919 - 3004588 - 78 - 96414360 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 227 - ds2020-267_985 - No definition line - 117 - - - - - 17919 - 3004588 - 12 - 75318120 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 228 - ds2020-267_1067 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.07531314 - 0.267 - 0.14 - - - No hits found - - - 229 - ds2020-267_833 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 230 - ds2020-267_432 - No definition line - 234 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 231 - ds2020-267_726 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 232 - ds2020-267_734 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 233 - ds2020-267_588 - No definition line - 219 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 234 - ds2020-267_924 - No definition line - 131 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 235 - ds2020-267_843 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 236 - ds2020-267_672 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 237 - ds2020-267_132 - No definition line - 328 - - - - - 17919 - 3004588 - 67 - 75768630 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 238 - ds2020-267_1029 - No definition line - 77 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 239 - ds2020-267_39 - No definition line - 603 - - - - - 17919 - 3004588 - 82 - 182692370 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 240 - ds2020-267_729 - No definition line - 212 - - - 1 - gnl|CDD|279713 - pfam01405, PsbT, Photosystem II reaction centre T protein. The exact function of this protein is unknown. It probably consists of a single transmembrane spanning helix. The Chlamydomonas reinhardtii psbT protein appears to be (i) a novel photosystem II subunit and (ii) required for maintaining optimal photosystem II activity under adverse growth conditions. - 279713 - 29 - - - 1 - 34.2227 - 79 - 5.43744e-05 - 19 - 99 - 1 - 27 - -3 - 0 - 22 - 23 - 0 - 27 - MEALVYTFLLVSTLGIIFFAIFFREPP - MEALVYTLLLALTLGTLFFAIFFREPP - MEALVYT LL TLG +FFAIFFREPP - - - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - - - 241 - ds2020-267_977 - No definition line - 121 - - - - - 17919 - 3004588 - 13 - 74834307 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 242 - ds2020-267_19 - No definition line - 1000 - - - - - 17919 - 3004588 - 87 - 355626210 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 243 - ds2020-267_519 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 244 - ds2020-267_532 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 245 - ds2020-267_644 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 246 - ds2020-267_496 - No definition line - 227 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 247 - ds2020-267_345 - No definition line - 246 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 248 - ds2020-267_213 - No definition line - 276 - - - - - 17919 - 3004588 - 55 - 74704591 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 249 - ds2020-267_387 - No definition line - 241 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 250 - ds2020-267_404 - No definition line - 239 - - - 1 - gnl|CDD|366050 - pfam00361, Proton_antipo_M, Proton-conducting membrane transporter. This is a family of membrane transporters that inlcudes some 7 of potentially 14-16 TM regions. In many instances the family forms part of complex I that catalyzes the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane, and in this context is a combination predominantly of subunits 2, 4, 5, 14, L, M and N. In many bacterial species these proteins are probable stand-alone transporters not coupled with oxidoreduction. The family in total represents homologs across the phyla. - 366050 - 291 - - - 1 - 37.675 - 88 - 3.50341e-05 - 70 - 219 - 53 - 98 - 1 - 0 - 18 - 24 - 4 - 50 - CSMIYGSTGATHFDQLAKILTGYEITGARSSGIFMGILSIAVGFLFKITA - IFLMYNYTGTLSFTELSKALDF----GLNSWGLLLLFLLILVGFLFKSAQ - ++Y TG F +L+K L G S G+ + L I VGFLFK - - - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - - - 251 - ds2020-267_1229 - No definition line - 60 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 252 - ds2020-267_873 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 253 - ds2020-267_850 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 254 - ds2020-267_389 - No definition line - 241 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 255 - ds2020-267_961 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 256 - ds2020-267_827 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 257 - ds2020-267_485 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 258 - ds2020-267_312 - No definition line - 252 - - - 1 - gnl|CDD|278982 - pfam00585, Thr_dehydrat_C, C-terminal regulatory domain of Threonine dehydratase. Threonine dehydratases pfam00291 all contain a carboxy terminal region. This region may have a regulatory role. Some members contain two copies of this region. This family is homologous to the pfam01842 domain. - 278982 - 91 - - - 1 - 37.6361 - 88 - 1.52007e-05 - 29 - 166 - 17 - 62 - 2 - 0 - 18 - 24 - 2 - 47 - IPERTGAFLDFCRSLKGRN-ITVFNYRINTNPKYDGQCVALSVSKEQ - FPEQPGALLTFLDLLGGRNNITLFEYR-KHGDKNGCVLVGVELSQAE - PE+ GA L F L GRN IT+F YR K V + +S+ + - - - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - - - 259 - ds2020-267_1134 - No definition line - 66 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 260 - ds2020-267_121 - No definition line - 339 - - - - - 17919 - 3004588 - 70 - 75261094 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 261 - ds2020-267_81 - No definition line - 415 - - - - - 17919 - 3004588 - 78 - 96414360 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 262 - ds2020-267_176 - No definition line - 291 - - - 1 - gnl|CDD|376500 - pfam01235, Na_Ala_symp, Sodium:alanine symporter family. - 376500 - 389 - - - 1 - 106.748 - 268 - 1.13408e-29 - 115 - 243 - 5 - 47 - 1 - 0 - 34 - 38 - 0 - 43 - GVSSFQALAMSLAGRVGTGNIAGVATAITFGGPGALFWMWMVA - GISSFQALCTSLAARVGTGNIAGVATAIALGGPGAVFWMWVIA - G+SSFQAL SLA RVGTGNIAGVATAI GGPGA+FWMW++A - - - - - - - 17919 - 3004588 - 59 - 73999946 - 0.041 - 0.267 - 0.14 - - - - - 263 - ds2020-267_244 - No definition line - 265 - - - - - 17919 - 3004588 - 52 - 74620800 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 264 - ds2020-267_740 - No definition line - 212 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 265 - ds2020-267_570 - No definition line - 221 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 266 - ds2020-267_388 - No definition line - 241 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 45.9143 - 109 - 6.16383e-08 - 35 - 214 - 369 - 432 - -1 - 0 - 30 - 33 - 8 - 66 - TTFINSVLNSIYTDKITKGAR--EVGDSLHNGDDVLIGTHSLKVARESL----RLGRKFNTRIQSA - TTFINSVLNCAYA--ELAGAPWADVPTSIHMGDDVLEGLRTPADATSLLDKYARLGFKVNPSKQSV - TTFINSVLN Y GA +V S+H GDDVL G + A L RLG K N QS - - - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - - - 267 - ds2020-267_527 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 268 - ds2020-267_106 - No definition line - 366 - - - - - 17919 - 3004588 - 76 - 75566224 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 269 - ds2020-267_253 - No definition line - 262 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.080313 - 0.267 - 0.14 - - - No hits found - - - 270 - ds2020-267_759 - No definition line - 211 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 271 - ds2020-267_669 - No definition line - 215 - - - 1 - gnl|CDD|380037 - pfam17862, AAA_lid_3, AAA+ lid domain. This entry represents the alpha helical AAA+ lid domain that is found to the C-terminus of AAA domains. - 380037 - 45 - - - 1 - 37.5358 - 88 - 4.46873e-06 - 33 - 122 - 8 - 37 - -1 - 0 - 12 - 20 - 0 - 30 - AGLSEGYTGSDLLELCKKAAYFPIRDLLDE - AERTEGFSGADLEALCREAALAALRRGLEA - A +EG++G+DL LC++AA +R L+ - - - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - - - 272 - ds2020-267_1094 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 273 - ds2020-267_187 - No definition line - 287 - - - 1 - gnl|CDD|376891 - pfam02673, BacA, Bacitracin resistance protein BacA. Bacitracin resistance protein (BacA) is a putative undecaprenol kinase. BacA confers resistance to bacitracin, probably by phosphorylation of undecaprenol. More recent studies show that BacA has undecaprenyl pyrophosphate phosphatase activity. Undecaprenyl phosphate is a key lipid intermediate involved in the synthesis of various bacterial cell wall polymers. Bacitracin, a mixture of related cyclic polypeptide antibiotics, is used to treat surface tissue infections. Its primary mode of action is the inhibition of bacterial cell wall synthesis through sequestration of the essential carrier lipid undecaprenyl pyrophosphate, C55-PP, resulting in the loss of cell integrity and lysis. The characteristic phosphatase sequence-motif in this family is likely to be the PGxSRSGG, compared with the PSGH of the PAP family of phosphatases. - 376891 - 259 - - - 1 - 60.5192 - 148 - 3.59766e-13 - 7 - 156 - 10 - 58 - 1 - 0 - 24 - 28 - 1 - 50 - LTVFLPISSTGHLILADSLLNFWTKDKADLFIAVIQLGAISAVIYLYWGR - LTEFLPVSSSGHLILVPHLLGFSE-DGLAAFDVVIHLGTILAVLVYFRKD - LT FLP+SS+GHLIL LL F D F VI LG I AV+ + - - - - - - - 17919 - 3004588 - 57 - 75361790 - 0.041 - 0.267 - 0.14 - - - - - 274 - ds2020-267_852 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 275 - ds2020-267_1036 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 276 - ds2020-267_91 - No definition line - 395 - - - - - 17919 - 3004588 - 77 - 87740550 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 277 - ds2020-267_821 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 278 - ds2020-267_810 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 279 - ds2020-267_1112 - No definition line - 69 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 280 - ds2020-267_1146 - No definition line - 65 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 281 - ds2020-267_641 - No definition line - 216 - - - 1 - gnl|CDD|366315 - pfam00804, Syntaxin, Syntaxin. Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins (pfam05739), and an N-terminal domain that is featured in this entry. This domain varies between syntaxin isoforms; in syntaxin 1A it is found as three alpha-helices with a left-handed twist. It may fold back on the SNARE domain to allow the molecule to adopt a 'closed' configuration that prevents formation of the core fusion complex - it thus has an auto-inhibitory role. The function of syntaxins is determined by their localization. They are involved in neuronal exocytosis, ER-Golgi transport and Golgi-endosome transport, for example. They also interact with other proteins as well as those involved in SNARE complexes. These include vesicle coat proteins, Rab GTPases, and tethering factors. - 366315 - 200 - - - 1 - 83.7113 - 208 - 9.72957e-23 - 23 - 187 - 80 - 133 - -3 - 0 - 24 - 36 - 1 - 55 - GPGSSADRTRTSVVSGLGKKLKDMMDDFQGLRGRMTSEYKETIERRYFTITGEKA - GPGSAVDRIRKSQTAALRKKLKEVMFEYNELRERIREECKERIQRQ-LEVTGKEV - GPGS+ DR R S + L KKLK++M ++ LR R+ E KE I+R+ +TG++ - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 282 - ds2020-267_71 - No definition line - 444 - - - - - 17919 - 3004588 - 79 - 109640103 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 283 - ds2020-267_808 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 284 - ds2020-267_832 - No definition line - 208 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 285 - ds2020-267_464 - No definition line - 231 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 286 - ds2020-267_360 - No definition line - 244 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 287 - ds2020-267_1248 - No definition line - 58 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 288 - ds2020-267_1031 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 289 - ds2020-267_482 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 290 - ds2020-267_190 - No definition line - 285 - - - - - 17919 - 3004588 - 57 - 75361790 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 291 - ds2020-267_252 - No definition line - 262 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 292 - ds2020-267_305 - No definition line - 253 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 293 - ds2020-267_801 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 294 - ds2020-267_650 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 295 - ds2020-267_597 - No definition line - 219 - - - 1 - gnl|CDD|366090 - pfam00421, PSII, Photosystem II protein. - 366090 - 499 - - - 1 - 98.737 - 246 - 8.10522e-27 - 22 - 207 - 267 - 324 - 1 - 0 - 42 - 46 - 4 - 62 - PIELFGPTRYQWDQGYFQPEIYRRIGAGLAENQSLSEAWSKIPEKLAFYDYIGNNPAKGGSF - PSELFGPTRYQWDSGYFQQEIDRRVQAG----ASQAQAWTFIPRDLAFYDYIGNAPAKGGLF - P ELFGPTRYQWD GYFQ EI RR+ AG S ++AW+ IP LAFYDYIGN PAKGG F - - - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - - - 296 - ds2020-267_1254 - No definition line - 57 - - - - - 17919 - 3004588 - 0 - 57087172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 297 - ds2020-267_1211 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 298 - ds2020-267_34 - No definition line - 669 - - - - - 17919 - 3004588 - 83 - 212423540 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 299 - ds2020-267_426 - No definition line - 235 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 300 - ds2020-267_649 - No definition line - 216 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 301 - ds2020-267_490 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 302 - ds2020-267_179 - No definition line - 290 - - - - - 17919 - 3004588 - 58 - 74680868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 303 - ds2020-267_522 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 304 - ds2020-267_147 - No definition line - 313 - - - - - 17919 - 3004588 - 64 - 74310880 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 305 - ds2020-267_502 - No definition line - 226 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 306 - ds2020-267_1081 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 307 - ds2020-267_1007 - No definition line - 97 - - - - - 17919 - 3004588 - 6 - 75323924 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 308 - ds2020-267_379 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 309 - ds2020-267_328 - No definition line - 249 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 310 - ds2020-267_580 - No definition line - 220 - - - - - 17919 - 3004588 - 40 - 75498324 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 311 - ds2020-267_262 - No definition line - 260 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 312 - ds2020-267_424 - No definition line - 236 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 313 - ds2020-267_371 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 314 - ds2020-267_151 - No definition line - 311 - - - - - 17919 - 3004588 - 63 - 75027640 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 315 - ds2020-267_268 - No definition line - 259 - - - 1 - gnl|CDD|280316 - pfam02123, RdRP_4, Viral RNA-directed RNA-polymerase. This family includes RNA-dependent RNA polymerase proteins (RdRPs) from Luteovirus, Totivirus and Rotavirus. - 280316 - 465 - - - 1 - 83.6639 - 207 - 3.22949e-21 - 18 - 251 - 215 - 291 - 3 - 0 - 32 - 47 - 1 - 78 - MASEFVETNPLPTWDGTTHVSKSAKLEHGKTRAIFACDTRSYFGFSWILDATQQAWKNERVVMDPGKGGKCGMTQRLR - MLFEPQNNNEI-AWWGSVPSKPSMKLEHGKSRAIYACDTRSYLAFEYLLAPVEKAWANKSVILNPGEGDISGFDWSVQ - M E N + W G+ S KLEHGK+RAI+ACDTRSY F ++L ++AW N+ V+++PG+G G ++ - - - - - - - 17919 - 3004588 - 50 - 75910968 - 0.059998248 - 0.267 - 0.14 - - - - - 316 - ds2020-267_1170 - No definition line - 63 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 317 - ds2020-267_351 - No definition line - 245 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 354 - ds2020-267_1080 - No definition line - 73 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 355 - ds2020-267_418 - No definition line - 237 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 356 - ds2020-267_719 - No definition line - 213 - - - 1 - gnl|CDD|333815 - pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. - 333815 - 111 - - - 1 - 56.0033 - 136 - 9.1657e-13 - 45 - 185 - 65 - 111 - -2 - 0 - 19 - 28 - 0 - 47 - RAAGKHTPVLFLTAKDDLSDRIKGIEIGGDDYLTKPFAFAELIVRIK - RRRDPTTPVIILTAHGDEDDAVEALEAGADDFLSKPFDPDELLAALR - R TPV+ LTA D D ++ +E G DD+L+KPF EL+ ++ - - - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - - - 357 - ds2020-267_893 - No definition line - 179 - - - - - 17919 - 3004588 - 29 - 74548110 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 406 - ds2020-267_811 - No definition line - 208 - - - 1 - gnl|CDD|285265 - pfam07991, IlvN, Acetohydroxy acid isomeroreductase, NADPH-binding domain. Acetohydroxy acid isomeroreductase catalyzes the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine. This N-terminal region of the enzyme carries the binding-site for NADPH. The active-site for enzymatic activity lies in the C-terminal part, IlvC, pfam01450. - 285265 - 165 - - - 1 - 45.9993 - 110 - 1.80927e-08 - 20 - 190 - 79 - 132 - -1 - 0 - 20 - 32 - 3 - 57 - EKVFSHMKPNSILGLSHGFLLGHLQSVGLDFPKNISVIAVCPKGMGPSVRRLYVQGK - EEIAPNLKEGAALAFAHGF---NIHFGQIKPPKDVDVIMVAPKGPGHLVRREYEEGG - E++ ++K + L +HGF ++ + PK++ VI V PKG G VRR Y +G - - - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - - - 407 - ds2020-267_917 - No definition line - 133 - - - - - 17919 - 3004588 - 16 - 76100752 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 408 - ds2020-267_515 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 409 - ds2020-267_1064 - No definition line - 74 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 410 - ds2020-267_776 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 411 - ds2020-267_1110 - No definition line - 70 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 412 - ds2020-267_421 - No definition line - 236 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 413 - ds2020-267_1088 - No definition line - 72 - - - - - 17919 - 3004588 - 0 - 72110112 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 414 - ds2020-267_279 - No definition line - 258 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 415 - ds2020-267_676 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 416 - ds2020-267_381 - No definition line - 242 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 417 - ds2020-267_983 - No definition line - 117 - - - - - 17919 - 3004588 - 12 - 75318120 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 418 - ds2020-267_1123 - No definition line - 67 - - - - - 17919 - 3004588 - 0 - 66100936 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 419 - ds2020-267_462 - No definition line - 231 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 420 - ds2020-267_952 - No definition line - 126 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 421 - ds2020-267_907 - No definition line - 141 - - - - - 17919 - 3004588 - 19 - 74595556 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 422 - ds2020-267_716 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 423 - ds2020-267_487 - No definition line - 228 - - - - - 17919 - 3004588 - 43 - 73724343 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 424 - ds2020-267_157 - No definition line - 307 - - - - - 17919 - 3004588 - 62 - 75744400 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 425 - ds2020-267_54 - No definition line - 486 - - - - - 17919 - 3004588 - 80 - 128827576 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 426 - ds2020-267_642 - No definition line - 216 - - - 1 - gnl|CDD|367225 - pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain. This family includes the ATP synthase alpha and beta subunits the ATP synthase associated with flagella. - 367225 - 69 - - - 1 - 32.8867 - 76 - 0.000376273 - 2 - 121 - 27 - 66 - -3 - 0 - 16 - 20 - 0 - 40 - VVLVEFEEGTIGIALNLESNNVGVVLMGDGLMIQEGSSVK - VELVEFGTGVLGEVLNLGEDKVRVQVFGGTSGLSRGDEVK - V LVEF G +G LNL + V V + G + G VK - - - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - - - 427 - ds2020-267_849 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 428 - ds2020-267_334 - No definition line - 248 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 429 - ds2020-267_936 - No definition line - 129 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 430 - ds2020-267_178 - No definition line - 290 - - - - - 17919 - 3004588 - 58 - 74680868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 431 - ds2020-267_629 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 432 - ds2020-267_700 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 433 - ds2020-267_216 - No definition line - 275 - - - - - 17919 - 3004588 - 54 - 75367594 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 434 - ds2020-267_778 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 435 - ds2020-267_633 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 436 - ds2020-267_255 - No definition line - 261 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 437 - ds2020-267_79 - No definition line - 421 - - - - - 17919 - 3004588 - 78 - 99628172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 438 - ds2020-267_538 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 439 - ds2020-267_990 - No definition line - 115 - - - - - 17919 - 3004588 - 11 - 75801933 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 440 - ds2020-267_504 - No definition line - 226 - - - 1 - gnl|CDD|307628 - pfam01578, Cytochrom_C_asm, Cytochrome C assembly protein. This family consists of various proteins involved in cytochrome c assembly from mitochondria and bacteria; CycK from Rhizobium, CcmC from E. coli and Paracoccus denitrificans and orf240 from wheat mitochondria. The members of this family are probably integral membrane proteins with six predicted transmembrane helices. It has been proposed that members of this family comprise a membrane component of an ABC (ATP binding cassette) transporter complex. It is also proposed that this transporter is necessary for transport of some component needed for cytochrome c assembly. One member CycK contains a putative heme-binding motif, orf240 also contains a putative heme-binding motif and is a proposed ABC transporter with c-type heme as its proposed substrate. However it seems unlikely that all members of this family transport heme nor c-type apocytochromes because CcmC in the putative CcmABC transporter transports neither. CcmF forms a working module with CcmH and CcmI, CcmFHI, and itself is unlikely to bind haem directly. - 307628 - 211 - - - 1 - 36.1828 - 84 - 0.000112784 - 28 - 135 - 63 - 98 - -2 - 0 - 10 - 18 - 0 - 36 - LPPLLQDPGLIFHPPMLYMGFVGAVVPFAFAMAALW - LNPGLQSPILMLHVPLALLSYATLIIAALLSIALLL - L P LQ P L+ H P+ + + ++ ++A L - - - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - - - 441 - ds2020-267_441 - No definition line - 234 - - - - - 17919 - 3004588 - 44 - 75349168 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 442 - ds2020-267_258 - No definition line - 261 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 443 - ds2020-267_500 - No definition line - 227 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 444 - ds2020-267_963 - No definition line - 125 - - - - - 17919 - 3004588 - 14 - 74350494 - 0.076703376 - 0.267 - 0.14 - - - No hits found - - - 445 - ds2020-267_399 - No definition line - 239 - - - - - 17919 - 3004588 - 45 - 74739922 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 446 - ds2020-267_701 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 447 - ds2020-267_204 - No definition line - 279 - - - - - 17919 - 3004588 - 56 - 74041588 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 448 - ds2020-267_271 - No definition line - 259 - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 449 - ds2020-267_1108 - No definition line - 71 - - - - - 17919 - 3004588 - 0 - 69105524 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 450 - ds2020-267_625 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 451 - ds2020-267_274 - No definition line - 258 - - - 1 - gnl|CDD|367619 - pfam03713, DUF305, Domain of unknown function (DUF305). Domain found in small family of bacterial secreted proteins with no known function. Also found in Paramecium bursaria chlorella virus 1. This domain is short and found in one or two copies. The domain has a conserved HH motif that may be functionally important. This domain belongs to the ferritin superfamily. It contains two sequence similar repeats each of which is composed of two alpha helices. - 367619 - 151 - - - 1 - 48.8384 - 117 - 2.00811e-09 - 24 - 185 - 98 - 151 - -2 - 0 - 18 - 29 - 0 - 54 - PDMIFVNTMLSHFDEIIALANIEQRYGKNPELLDLAQDIISSRQNESQILQNWL - FDRLFLELMIPHHQGAVEMARDALDRGTNPEVRALAQDIITAQQAEIAQMRQLL - D +F+ M+ H + +A G NPE+ LAQDII+++Q E ++ L - - - 2 - 46.9124 - 112 - 9.45376e-09 - 24 - 173 - 4 - 53 - -2 - 0 - 16 - 29 - 0 - 50 - FVNTMLSHFDEIIALANIEQRYGKNPELLDLAQDIISSRQNESQILQNWL - FAQDMIPHHQQAVEMAELALERAQDPEVRALAQDIIAAQQPEIGQMRGWL - F M+ H + + +A + ++PE+ LAQDII+++Q E ++ WL - - - - - - - 17919 - 3004588 - 50 - 75910968 - 0.041 - 0.267 - 0.14 - - - - - 452 - ds2020-267_688 - No definition line - 214 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 453 - ds2020-267_934 - No definition line - 129 - - - - - 17919 - 3004588 - 16 - 73382868 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 454 - ds2020-267_859 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 455 - ds2020-267_301 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 456 - ds2020-267_42 - No definition line - 575 - - - 1 - gnl|CDD|366000 - pfam00284, Cytochrom_B559a, Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit. This family is the lumenal portion of cytochrome b559 alpha chain, matches to this family should be accompanied by a match to the pfam00283 family also. The Prosite pattern pattern matches the transmembrane region of the cytochrome b559 alpha and beta subunits. - 366000 - 38 - - - 1 - 81.1398 - 201 - 1.02897e-21 - 187 - 300 - 1 - 38 - 1 - 0 - 24 - 34 - 0 - 38 - LAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEF - LAYDVFGTPRPNEYFTQERQELPIVSDRFEAKQQIDEF - LAYDVFG+PRPNEYFT+ RQ +P+++ RF++ +Q+DEF - - - - - 2 - gnl|CDD|365999 - pfam00283, Cytochrom_B559, Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits. - 365999 - 29 - - - 1 - 46.6507 - 111 - 1.54942e-08 - 79 - 165 - 1 - 29 - 1 - 0 - 12 - 21 - 0 - 29 - GERSFADIITSIRYWVIHSITIPSLFIAG - GERPFSYPIFTVRWLAIHALTVPTVFFLG - GER F+ I ++R+ IH++T+P++F G - - - 2 - 43.1839 - 102 - 2.95472e-07 - 325 - 411 - 1 - 29 - 1 - 0 - 19 - 21 - 0 - 29 - MTIDRTYPIFTVRWLAVHGLAVPTVSFLG - GERPFSYPIFTVRWLAIHALTVPTVFFLG - +YPIFTVRWLA+H L VPTV FLG - - - - - - - 17919 - 3004588 - 82 - 167340070 - 0.041 - 0.267 - 0.14 - - - - - 457 - ds2020-267_260 - No definition line - 261 - - - - - 17919 - 3004588 - 51 - 75265884 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 458 - ds2020-267_788 - No definition line - 210 - - - - - 17919 - 3004588 - 38 - 74357312 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 459 - ds2020-267_541 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 460 - ds2020-267_317 - No definition line - 251 - - - - - 17919 - 3004588 - 48 - 75056660 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 461 - ds2020-267_839 - No definition line - 207 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 462 - ds2020-267_1195 - No definition line - 61 - - - - - 17919 - 3004588 - 0 - 60091760 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 463 - ds2020-267_303 - No definition line - 254 - - - - - 17919 - 3004588 - 49 - 74429495 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 464 - ds2020-267_680 - No definition line - 215 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 465 - ds2020-267_632 - No definition line - 217 - - - - - 17919 - 3004588 - 39 - 76089651 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 466 - ds2020-267_59 - No definition line - 474 - - - - - 17919 - 3004588 - 79 - 125529973 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 467 - ds2020-267_354 - No definition line - 245 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 468 - ds2020-267_366 - No definition line - 243 - - - - - 17919 - 3004588 - 47 - 73521430 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 469 - ds2020-267_523 - No definition line - 225 - - - - - 17919 - 3004588 - 42 - 74315670 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 470 - ds2020-267_874 - No definition line - 206 - - - - - 17919 - 3004588 - 36 - 75504128 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 471 - ds2020-267_24 - No definition line - 827 - - - - - 17919 - 3004588 - 85 - 281479870 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 472 - ds2020-267_125 - No definition line - 335 - - - - - 17919 - 3004588 - 69 - 74263434 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 473 - ds2020-267_453 - No definition line - 232 - - - - - 17919 - 3004588 - 43 - 75958414 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 474 - ds2020-267_537 - No definition line - 224 - - - - - 17919 - 3004588 - 41 - 74906997 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 475 - ds2020-267_1012 - No definition line - 92 - - - - - 17919 - 3004588 - 4 - 76255712 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 476 - ds2020-267_711 - No definition line - 213 - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 477 - ds2020-267_1041 - No definition line - 76 - - - - - 17919 - 3004588 - 0 - 75114700 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 478 - ds2020-267_283 - No definition line - 257 - - - 1 - gnl|CDD|372443 - pfam13041, PPR_2, PPR repeat family. This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. - 372443 - 50 - - - 1 - 38.4936 - 91 - 3.148e-06 - 13 - 114 - 15 - 48 - 1 - 0 - 13 - 22 - 0 - 34 - KLG*VEKSLEMFSEMKKCGVAPNEITFIGVLGAC - KNGKVEEAFKLFNEMKKRGIKPNVYTYTILINGL - K G VE++ ++F+EMKK G+ PN T+ ++ - - - - - - - 17919 - 3004588 - 50 - 73802330 - 0.041 - 0.267 - 0.14 - - - - - 479 - ds2020-267_955 - No definition line - 126 - - - - - 17919 - 3004588 - 15 - 73866681 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 480 - ds2020-267_224 - No definition line - 272 - - - - - 17919 - 3004588 - 54 - 73330632 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 481 - ds2020-267_1161 - No definition line - 64 - - - - - 17919 - 3004588 - 0 - 63096348 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 482 - ds2020-267_111 - No definition line - 353 - - - - - 17919 - 3004588 - 73 - 74646044 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 483 - ds2020-267_175 - No definition line - 291 - - - - - 17919 - 3004588 - 59 - 73999946 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 484 - ds2020-267_77 - No definition line - 422 - - - - - 17919 - 3004588 - 78 - 99628172 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 485 - ds2020-267_342 - No definition line - 246 - - - - - 17919 - 3004588 - 47 - 75683825 - 0.073678116 - 0.267 - 0.14 - - - No hits found - - - 486 - ds2020-267_395 - No definition line - 240 - - - - - 17919 - 3004588 - 46 - 74130676 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 487 - ds2020-267_805 - No definition line - 209 - - - - - 17919 - 3004588 - 37 - 74930720 - 0.041 - 0.267 - 0.14 - - - No hits found - - - 488 - ds2020-267_685 - No definition line - 214 - - - 1 - gnl|CDD|370442 - pfam09334, tRNA-synt_1g, tRNA synthetases class I (M). This family includes methionyl tRNA synthetases. - 370442 - 391 - - - 1 - 63.8538 - 156 - 1.80219e-14 - 16 - 117 - 124 - 157 - -2 - 0 - 18 - 22 - 0 - 34 - PKKGMFLSDRFIKGTCPKCKSEDQYGDSCEDIGT - PSDERFLPDRYVEGTCPHCGSEDARGDQCENCGR - P FL DR+++GTCP C SED GD CE+ G - - - - - - - 17919 - 3004588 - 39 - 73783904 - 0.041 - 0.267 - 0.14 - - - - - 489 - ds2020-267_60 - No definition line - 471 - - - - - 17919 - 3004588 - 79 - 123940986 - 0.041 - 0.267 - 0.14 - - - No hits found - diff -r 84d20d9c292d -r fd7104249a3c virAnnot_rps2tsv.xml --- a/virAnnot_rps2tsv.xml Sat May 18 18:14:29 2024 +0000 +++ b/virAnnot_rps2tsv.xml Wed Aug 21 13:13:28 2024 +0000 @@ -1,4 +1,4 @@ - + Convert xml rpstblast results to tab file with taxonomic informations macros.xml @@ -28,19 +28,11 @@ - + - - - - - - - - - - + +