comparison PDAUG_Peptide_Core_Functions/test-data/out1.fasta @ 0:7557b48b2872 draft

"planemo upload for repository https://github.com/jaidevjoshi83/pdaug commit a9bd83f6a1afa6338cb6e4358b63ebff5bed155e"
author jay
date Wed, 28 Oct 2020 02:10:12 +0000
parents
children
comparison
equal deleted inserted replaced
-1:000000000000 0:7557b48b2872
1 >ACP0
2 GFWSKIQEVGKEAAKAAAVAAGKAALGAVSEAV