|
0
|
1 Protein(s) Sequence Variable Modifications Fixed Modifications Spectrum File Spectrum Title Spectrum Scan Number RT m/z Measured Charge Identification Charge Theoretical Mass Isotope Number Precursor m/z Error [ppm] Localization Confidence Probabilistic PTM score D-score Confident Phosphosites #Confident Phosphosites Ambiguous Phosphosites #Ambiguous Phosphosites Confidence [%] Validation
|
|
|
2 1 P30740 LGVQDLFNSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42979 (Experiment 1) 42979 72.404 604.32019 2+ 2+ 1206.6244519773002 0 1.1377169445543516 100.0 Confident
|
|
|
3 2 P15259, P18669, Q8N0Y7 HYGGLTGLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15926 (Experiment 1) 15926 38.245 530.282898 2+ 2+ 1058.5508931142201 0 0.32996752546837377 99.73045822102425 Confident
|
|
|
4 3 P49327 AGLYGLPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31918 (Experiment 1) 31918 57.964 464.230042 2+ 2+ 925.4422677895602 1 -0.09872263809433697 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65034965034964) Y4 1 0 99.73614775725594 Confident
|
|
|
5 4 Q9NZT2 GTGTVGRAQNYQK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21349 (Experiment 1) 21349 45.224 730.334473 2+ 2+ 1458.6616560225305 0 -4.972324537127415 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Doubtful
|
|
|
6 5 P68104, Q05639, Q5VTE0 IGGIGTVPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26949 (Experiment 1) 26949 52.168 513.309326 2+ 2+ 1024.60292868708 0 1.1400344498829633 100.0 Confident
|
|
|
7 6 P07900 IMKDILEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20653 (Experiment 1) 20653 44.304 495.28952 2+ 2+ 988.5627036678802 0 1.8003628530197229 100.0 Confident
|
|
|
8 7 P49368 IPGGIIEDSCVLR Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38940 (Experiment 1) 38940 66.281 714.878845 2+ 2+ 1427.7442498401501 0 -0.7782947530783138 97.55434782608695 Confident
|
|
|
9 8 O75937 LLLDQEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21774 (Experiment 1) 21774 45.918 493.779602 2+ 2+ 985.5444107514504 0 0.2433423567884188 99.73474801061008 Confident
|
|
|
10 9 O43390 STAYEDYYYHPPPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25835 (Experiment 1) 25835 50.883 613.586731 3+ 3+ 1837.7348805324402 0 1.8921930883410392 Phosphorylation of Y (4: Random) Phosphorylation of Y (8: 0.0, 9: 0.0) Phosphorylation of Y (8: 0.0) 0 Y4-{Y4 Y7 Y8 Y9} 1 100.0 Confident
|
|
|
11 10 P46781 LFEGNALLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37446 (Experiment 1) 37446 64.463 516.795837 2+ 2+ 1031.57637958607 0 0.7173827502509798 99.73890339425587 Confident
|
|
|
12 11 P48643, P50991 SIHDALCVIR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29815 (Experiment 1) 29815 55.513 395.21344 3+ 3+ 1182.6179271282201 0 0.4752466681080597 99.38650306748467 Confident
|
|
|
13 12 O75534 EAFGFIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38122 (Experiment 1) 38122 65.287 484.746124 2+ 2+ 967.4763311916302 0 1.4067948118756286 99.73753280839895 Confident
|
|
|
14 13 P27348, P31946, P31947, P61981, P62258, P63104, Q04917 NLLSVAYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32924 (Experiment 1) 32924 59.11 454.26532 2+ 2+ 906.5174677276202 0 -1.519661622029727 99.73333333333333 Confident
|
|
|
15 14 P18621 YSLDPENPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24829 (Experiment 1) 24829 49.708 582.283264 2+ 2+ 1162.5506183307004 0 1.1650148132105416 100.0 Confident
|
|
|
16 15 GSTP1_HUMAN, P09211 ASCLYGQLPK Phosphorylation of Y(5) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26922 (Experiment 1) 26922 52.134 608.775513 2+ 2+ 1215.5359104742201 0 0.46206886097144845 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
17 16 P07195 GLTSVINQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22443 (Experiment 1) 22443 46.784 480.279297 2+ 2+ 958.5447451046202 0 -0.7329461550348265 100.0 Confident
|
|
|
18 17 P0DMV8 AQIHDLVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29700 (Experiment 1) 29700 55.38 489.275574 3+ 3+ 1464.80487595076 0 0.011342486083281108 100.0 Confident
|
|
|
19 18 P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1 AGLQFPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34131 (Experiment 1) 34131 60.511 472.769287 2+ 2+ 943.5239500903901 0 0.07506408861235064 100.0 Confident
|
|
|
20 19 P26373 STESLQANVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14394 (Experiment 1) 14394 35.891 616.814819 2+ 2+ 1231.6156781987502 0 -0.4808023986747297 100.0 Confident
|
|
|
21 20 P62995 AAQDRDQIYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9039 (Experiment 1) 9039 26.698 439.197662 3+ 3+ 1314.5717783889702 0 -0.4719128891534078 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
22 21 P22626 YHTINGHNAEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8123 (Experiment 1) 8123 24.694 470.900421 3+ 3+ 1409.6800097908101 0 -0.40786472431578064 99.28057553956835 Confident
|
|
|
23 22 P17844 NFYQEHPDLAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21019 (Experiment 1) 21019 44.746 735.314148 2+ 2+ 1468.6136432009503 0 0.0679066442111905 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.16055846422339) Y3 1 0 96.24664879356568 Doubtful
|
|
|
24 23 P23921 LNSAIIYDR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28290 (Experiment 1) 28290 53.749 572.771484 2+ 2+ 1143.5325393459402 0 -3.600270641154372 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.7340425531915 Confident
|
|
|
25 24 P14324 ATPEQYQILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28044 (Experiment 1) 28044 53.452 595.824951 2+ 2+ 1189.6342883850102 0 0.8900955793063253 99.45945945945947 Confident
|
|
|
26 25 P00390 GIYAVGDVCGK Phosphorylation of Y(3) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26504 (Experiment 1) 26504 51.655 609.764526 2+ 2+ 1217.5151750296402 0 -0.554281907818625 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
27 26 P14866 SSSGLLEWESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37035 (Experiment 1) 37035 63.97 611.800781 2+ 2+ 1221.5877321154103 0 -0.5909183426772361 100.0 Confident
|
|
|
28 27 P48643 MLVIEQCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24471 (Experiment 1) 24471 49.295 511.269989 2+ 2+ 1019.5143735764702 1 7.534443622841497 99.1869918699187 Doubtful
|
|
|
29 28 P08238 LGIHEDSTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9811 (Experiment 1) 9811 28.228 571.284607 2+ 2+ 1140.5523496662001 0 2.0229889125561833 97.56756756756756 Confident
|
|
|
30 29 Q9NRZ9 KQEIFYTAIVNR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34711 (Experiment 1) 34711 61.184 521.26355 3+ 3+ 1560.77014384235 0 -0.8461757117854006 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
31 30 Q13162 TREEECHFYAGGQVYPGEASR Phosphorylation of Y(15) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23112 (Experiment 1) 23112 47.582 841.685974 3+ 3+ 2522.0322018162806 0 1.5408712981796213 Phosphorylation of Y (15: Doubtfull) Phosphorylation of Y (15: 13.010422045779276) Phosphorylation of Y (9: 97.73828756058158) 0 Y15-{Y9 Y15} 1 92.5925925925926 Doubtful
|
|
|
32 31 Q99729 EVYQQQQYGSGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13284 (Experiment 1) 13284 34.129 750.347046 2+ 2+ 1498.68006936046 0 -0.3533657523326055 100.0 Confident
|
|
|
33 32 P84103 DSCPLDCK Carbamidomethylation of C(3, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13000 (Experiment 1) 13000 33.729 497.702148 2+ 2+ 993.3895669861702 0 0.17689318582979516 97.8891820580475 Confident
|
|
|
34 33 Q9Y619 TYSQVGFR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21268 (Experiment 1) 21268 45.104 519.225586 2+ 2+ 1036.4379106851102 0 -1.243791872556536 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 90.92495636998254) Y2 1 0 92.43243243243244 Confident
|
|
|
35 34 P30041 LPFPIIDDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44500 (Experiment 1) 44500 75.404 543.303833 2+ 2+ 1084.5916952970401 0 1.3047682526574569 100.0 Confident
|
|
|
36 35 P07900 ELHINLIPNKQDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27794 (Experiment 1) 27794 53.167 530.630066 3+ 3+ 1588.86853883648 0 -0.10694010045463341 96.71052631578947 Confident
|
|
|
37 36 Q9H4M9, Q9NZN3, Q9NZN4 LLPLEEHYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27510 (Experiment 1) 27510 52.824 625.301941 2+ 2+ 1248.5903885752302 0 -0.8471970796711754 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 98.60383944153578) Y8 1 0 98.91304347826086 Confident
|
|
|
38 37 Q6P2Q9 TNHIYVSSDDIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21740 (Experiment 1) 21740 45.87 491.222595 3+ 3+ 1470.6391892424504 0 4.591528871355824 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 95.63812600969305) Y5 1 0 97.74436090225565 Confident
|
|
|
39 38 O75533 GAEYVSAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9233 (Experiment 1) 9233 27.131 466.698029 2+ 2+ 931.3800614558202 0 1.5466240469973638 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 85.29886914378028) Y4 1 0 96.48648648648648 Confident
|
|
|
40 39 P61247 TSYAQHQQVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6110 (Experiment 1) 6110 20.31 406.538483 3+ 3+ 1216.5948831845203 0 -1.0360508701704279 100.0 Confident
|
|
|
41 40 P62917 ASGNYATVISHNPETKK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13614 (Experiment 1) 13614 34.66 632.967102 3+ 3+ 1895.8778563680203 0 0.853247570548678 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
42 41 P07900, P08238, Q58FF6, Q58FF7 VILHLKEDQTEYLEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29147 (Experiment 1) 29147 54.746 672.352844 3+ 3+ 2014.0371202832105 0 -0.20707557735279472 100.0 Confident
|
|
|
43 42 Q9Y295 IGFVGFPSVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43817 (Experiment 1) 43817 73.805 554.313538 2+ 2+ 1106.6124307416203 0 0.08327846687974895 96.75675675675676 Confident
|
|
|
44 43 Q8NC51 PGHLQEGFGCVVTNR Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25175 (Experiment 1) 25175 50.112 557.606873 3+ 3+ 1669.7994733004903 0 -0.4087112743590119 100.0 Confident
|
|
|
45 44 P24534 SIQADGLVWGSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37284 (Experiment 1) 37284 64.262 674.348938 2+ 2+ 1346.6830294825802 0 0.2176794853329661 100.0 Confident
|
|
|
46 45 Q14566 VSGVDGYETEGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25174 (Experiment 1) 25174 50.111 691.333069 2+ 2+ 1380.6521232771202 0 -0.3892555982674392 100.0 Confident
|
|
|
47 46 P55209 KYAVLYQPLFDKR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36279 (Experiment 1) 36279 63.074 574.299377 3+ 3+ 1719.8749432640602 0 0.7884021407948746 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 4.524113279641968) Phosphorylation of Y (6: 0.7558777175368706) 0 Y6-{Y2 Y6} 1 100.0 Confident
|
|
|
48 47 P06276, P68104, Q05639, Q5VTE0 QLIVGVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21517 (Experiment 1) 21517 45.499 435.7742 2+ 2+ 869.5334521449302 0 0.4531264412793118 100.0 Confident
|
|
|
49 48 E9PAV3, Q13765 IEDLSQQAQLAAAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28978 (Experiment 1) 28978 54.551 807.921509 2+ 2+ 1613.8260648878106 0 1.485405515120204 99.7289972899729 Confident
|
|
|
50 49 P11142 DAGTIAGLNVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42119 (Experiment 1) 42119 70.92 600.340454 2+ 2+ 1198.66698549562 0 -0.525059496655302 98.93617021276596 Confident
|
|
|
51 50 Q96AG4 LQQLPADFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31143 (Experiment 1) 31143 57.054 572.808472 2+ 2+ 1143.60365696307 0 -1.1049900247621283 100.0 Confident
|
|
|
52 51 P78371 ILIANTGMDTDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27875 (Experiment 1) 27875 53.258 646.331177 2+ 2+ 1290.6489524729802 0 -0.8907241517271113 99.73333333333333 Confident
|
|
|
53 52 P55209, Q99733 FYEEVHDLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25060 (Experiment 1) 25060 49.978 446.210449 3+ 3+ 1335.6095301891503 0 -0.009404819514532673 100.0 Confident
|
|
|
54 53 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43621 (Experiment 1) 43621 73.47 586.326111 3+ 3+ 1755.9559568585505 0 0.3108288334089308 100.0 Confident
|
|
|
55 54 Q7KZF4 SSHYDELLAAEAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28897 (Experiment 1) 28897 54.46 514.559692 3+ 3+ 1540.6559019357505 0 0.8710780665557134 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.51534733441034) Y4 1 0 100.0 Confident
|
|
|
56 55 P62899 EYTINIHKR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11985 (Experiment 1) 11985 32.09 418.539398 3+ 3+ 1252.5965365848303 0 -0.1369725634175551 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.70759289176091) Y2 1 0 100.0 Confident
|
|
|
57 56 Q02878 FVIATSTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21187 (Experiment 1) 21187 44.98 433.752563 2+ 2+ 865.4909186266102 0 -0.3983378150775732 99.73118279569893 Confident
|
|
|
58 57 P07900, Q14568 ELISNSSDALDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23600 (Experiment 1) 23600 48.191 646.321777 2+ 2+ 1290.6303252033804 0 -1.0243625507100564 99.45799457994579 Confident
|
|
|
59 58 P16401 KATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24054 (Experiment 1) 24054 48.78 447.597443 3+ 3+ 1339.7711162109902 0 -0.45920067436193274 100.0 Confident
|
|
|
60 59 P27635, Q96L21 VHIGQVIMSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36198 (Experiment 1) 36198 62.976 418.244904 3+ 3+ 1251.7121618662302 0 0.5744112607890343 98.49624060150376 Confident
|
|
|
61 60 Q14103 DLKDYFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32675 (Experiment 1) 32675 58.827 508.260712 2+ 2+ 1014.5022115863003 0 4.583771009439568 100.0 Confident
|
|
|
62 61 Q8WWY3 IYEYVESR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21437 (Experiment 1) 21437 45.35 569.747437 2+ 2+ 1137.4743557634804 0 5.235068854042567 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 4: 0.0) Phosphorylation of Y (2: 71.29144851657941) 0 Y2-{Y2 Y4} 1 99.72972972972973 Doubtful
|
|
|
63 62 Q99623 FNASQLITQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34211 (Experiment 1) 34211 60.607 589.32074 2+ 2+ 1176.6251206836403 0 1.5325996367072108 100.0 Confident
|
|
|
64 63 P62191, P62195, Q8NB90 GVLLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31587 (Experiment 1) 31587 57.58 619.813354 2+ 2+ 1237.6107896666401 0 1.1014616181275079 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 99.7289972899729 Confident
|
|
|
65 64 P26641 LDPGSEETQTLVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25667 (Experiment 1) 25667 50.691 722.864136 2+ 2+ 1443.7205371901102 0 -4.716025626614718 99.73045822102425 Doubtful
|
|
|
66 65 O94776 TLLADQGEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25916 (Experiment 1) 25916 50.974 558.306641 2+ 2+ 1114.5982372294602 0 0.44047222099201877 99.45799457994579 Confident
|
|
|
67 66 Q92598 MFEELGQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28452 (Experiment 1) 28452 53.94 505.241486 2+ 2+ 1008.4698659122 0 -1.431833877827951 99.48453608247422 Confident
|
|
|
68 67 P28066 ITSPLMEPSSIEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34212 (Experiment 1) 34212 60.608 716.37439 2+ 2+ 1430.7326820969404 0 1.0783265865726896 99.45652173913044 Confident
|
|
|
69 68 B2RPK0, P09429, P26583 MSSYAFFVQTCR Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41923 (Experiment 1) 41923 70.557 748.837341 2+ 2+ 1495.6588059640305 0 0.8834385265217706 100.0 Confident
|
|
|
70 69 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25915 (Experiment 1) 25915 50.973 523.252197 2+ 2+ 1044.4892775516303 0 0.5384736579269738 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
71 70 P26368 ELLTSFGPLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43318 (Experiment 1) 43318 73.001 552.819092 2+ 2+ 1103.62266107215 0 0.8773169113545851 99.45652173913044 Confident
|
|
|
72 71 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34159 (Experiment 1) 34159 60.543 630.796875 2+ 2+ 1259.5798834611805 0 -0.5440693022156452 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
73 72 P61326, Q96A72 IGSLIDVNQSKDPEGLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30717 (Experiment 1) 30717 56.556 614.331482 3+ 3+ 1839.9690407233902 0 1.9402571287983736 100.0 Confident
|
|
|
74 73 P21127, Q9UQ88 IEEGTYGVVYR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26673 (Experiment 1) 26673 51.846 683.309326 2+ 2+ 1364.6013471817503 0 2.013648915882647 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 10: 0.0) Phosphorylation of Y (6: 98.60383944153578) 0 Y6-{Y6 Y10} 1 99.7289972899729 Confident
|
|
|
75 74 P32119 GLFIIDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41593 (Experiment 1) 41593 70.05 431.754852 2+ 2+ 861.4960040070503 0 -0.9877594052163768 97.6 Confident
|
|
|
76 75 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32593 (Experiment 1) 32593 58.737 616.267334 2+ 2+ 1230.5209716027305 0 -0.6949384724032491 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 29.623691721910546) Phosphorylation of Y (3: 62.882144033976495) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
77 76 Q8TCJ2 ESDYFTPQGEFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38121 (Experiment 1) 38121 65.285 778.308777 2+ 2+ 1554.6028037337305 0 0.12677016892552195 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
78 77 P30041 VVFVFGPDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40800 (Experiment 1) 40800 68.891 504.281464 2+ 2+ 1006.5487678559002 0 -0.38945450026624295 100.0 Confident
|
|
|
79 78 TRYP_PIG VATVSLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23032 (Experiment 1) 23032 47.485 421.757507 2+ 2+ 841.5021520166501 0 -2.004643493349334 99.73045822102425 Confident
|
|
|
80 79 P09382 SFVLNLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38611 (Experiment 1) 38611 65.882 439.260071 2+ 2+ 876.5069030439201 0 -1.4956692692705729 99.18478260869566 Confident
|
|
|
81 80 Q14444 DGYQQNFK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12831 (Experiment 1) 12831 33.491 540.214233 2+ 2+ 1078.4120898600902 0 1.6874873439076907 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.65095986038395) Y3 1 0 99.45799457994579 Confident
|
|
|
82 81 P62158 DTDSEEEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12242 (Experiment 1) 12242 32.525 547.236023 2+ 2+ 1092.4571118686802 0 0.34829380060429543 96.4769647696477 Confident
|
|
|
83 82 Q53GQ0 SYAEELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18499 (Experiment 1) 18499 41.667 455.729187 2+ 2+ 909.4443623570103 0 -0.5938727737098363 92.43243243243244 Confident
|
|
|
84 83 Q9NR30 TFHHVYSGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5827 (Experiment 1) 5827 19.683 385.83725 3+ 3+ 1154.4910088871302 0 -0.940194812686852 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 99.37888198757764 Confident
|
|
|
85 84 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28612 (Experiment 1) 28612 54.125 600.288086 3+ 3+ 1797.84107693648 0 0.7505641208417713 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
86 85 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGRPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29317 (Experiment 1) 29317 54.94 599.856445 2+ 2+ 1197.69822605425 0 0.09253225258847216 100.0 Confident
|
|
|
87 86 Q02878 VLATVTKPVGGDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13444 (Experiment 1) 13444 34.39 428.922485 3+ 3+ 1283.7449014631502 0 0.5627565560113915 100.0 Confident
|
|
|
88 87 O75746, Q9UJS0 KIYSTLAGTR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15678 (Experiment 1) 15678 37.872 595.302856 2+ 2+ 1188.5903885752302 0 0.6471425733225004 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.67689822294022) Y3 1 0 100.0 Confident
|
|
|
89 88 P11908, P21108, P60891 VYAILTHGIFSGPAISR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45204 (Experiment 1) 45204 77.022 627.991943 3+ 3+ 1880.9549844899102 0 -0.5227720102262337 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
90 89 P02786 VEYHFLSPYVSPK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36698 (Experiment 1) 36698 63.565 549.260193 3+ 3+ 1644.7589104523104 0 -0.0976178095092125 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 28.694997620669156) Phosphorylation of Y (3: 15.545863386177523) 0 Y3-{Y3 Y9} 1 100.0 Confident
|
|
|
91 90 O60506 LKDYAFIHFDER Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35662 (Experiment 1) 35662 62.289 545.252197 3+ 3+ 1632.7337583336305 0 0.6133348656290125 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.60383944153578) Y4 1 0 99.4186046511628 Confident
|
|
|
92 91 P13639 IKPVLMMNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22363 (Experiment 1) 22363 46.685 537.314636 2+ 2+ 1072.6136936949201 0 0.9541638783854479 100.0 Confident
|
|
|
93 92 Q92614 REDMAPHIYAVAQTAYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29146 (Experiment 1) 29146 54.745 691.31958 3+ 3+ 2070.9346600514905 0 1.0851471979056435 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 5.529757514608989) Phosphorylation of Y (9: 25.040387722132472) 0 Y9-{Y9 Y16} 1 100.0 Confident
|
|
|
94 93 P23284 VLEGMEVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29701 (Experiment 1) 29701 55.382 516.280457 2+ 2+ 1030.5481162329004 0 -1.6998159792413712 100.0 Confident
|
|
|
95 94 O14979, Q14103, Q99729 FGEVVDCTIK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28450 (Experiment 1) 28450 53.937 584.288757 2+ 2+ 1166.5641602198602 0 -1.0261640665059493 100.0 Confident
|
|
|
96 95 P30044 LLADPTGAFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34132 (Experiment 1) 34132 60.513 545.301086 2+ 2+ 1088.5866099166003 0 0.9253151473059585 99.73262032085562 Confident
|
|
|
97 96 P13639 IMGPNYTPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20074 (Experiment 1) 20074 43.639 539.273438 2+ 2+ 1076.5324661687603 0 -0.13268071003413973 99.18478260869566 Confident
|
|
|
98 97 P61247 ACQSIYPLHDVFVR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39669 (Experiment 1) 39669 67.278 568.955872 3+ 3+ 1703.8453608637503 0 0.24942527234712486 100.0 Confident
|
|
|
99 98 O95373 AIFQTIQNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28207 (Experiment 1) 28207 53.656 545.804382 2+ 2+ 1089.5930922793702 0 1.0248984702391264 99.72972972972973 Confident
|
|
|
100 99 O75608 ASFPQGPIGGANR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25665 (Experiment 1) 25665 50.689 636.328796 2+ 2+ 1270.6418333769402 0 0.9473801794685359 99.7289972899729 Confident
|
|
|
101 100 P62995 AAQDRDQIYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9151 (Experiment 1) 9151 26.949 439.198059 3+ 3+ 1314.5717783889702 0 0.432007707471799 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
102 101 Q9NUU7, Q9UMR2 LKPQLLQGVYAMGFNRPSK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41948 (Experiment 1) 41948 70.608 743.054199 3+ 3+ 2226.1384452384805 0 1.0418098285039168 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.30191972076788) Y10 1 0 99.24812030075188 Confident
|
|
|
103 102 P07737 CYEMASHLR Phosphorylation of Y(2) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16264 (Experiment 1) 16264 38.675 416.162781 3+ 3+ 1245.4671792914 0 -0.5331979948212491 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
104 103 P10696 VQHASPAGAYAHTVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10539 (Experiment 1) 10539 29.665 560.285339 3+ 3+ 1677.8335503100907 0 0.3791459284331951 100.0 Confident
|
|
|
105 104 P00505 EFSIYMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36001 (Experiment 1) 36001 62.713 509.749725 2+ 2+ 1017.4841189940103 0 0.763191151956956 96.22641509433963 Confident
|
|
|
106 105 P42677 DLLHPSPEEEKRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12662 (Experiment 1) 12662 33.199 526.614136 3+ 3+ 1576.8209199377206 0 -0.2160583113022681 97.74436090225565 Confident
|
|
|
107 106 P23396 KPLPDHVSIVEPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20315 (Experiment 1) 20315 43.914 486.948456 3+ 3+ 1457.8242144130104 0 -0.4626178434339644 100.0 Confident
|
|
|
108 107 P29401 LGQSDPAPLQHQMDIYQK Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28614 (Experiment 1) 28614 54.129 716.996216 3+ 3+ 2147.9711051298605 0 -1.9928146800740238 Phosphorylation of Y (16: Very Confident) Phosphorylation of Y (16: 100.0) Phosphorylation of Y (16: 100.0) Y16 1 0 100.0 Confident
|
|
|
109 108 P62266 ANPFGGASHAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9756 (Experiment 1) 9756 28.138 528.765198 2+ 2+ 1055.5148419586703 0 0.9466476397427135 99.7289972899729 Confident
|
|
|
110 109 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33489 (Experiment 1) 33489 59.759 630.797485 2+ 2+ 1259.5798834611805 0 0.4229609611623073 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
111 110 P10412, P16402, P16403 SGVSLAALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28870 (Experiment 1) 28870 54.429 423.258484 2+ 2+ 844.5018176634801 0 0.7057192474423357 99.46666666666667 Confident
|
|
|
112 111 P27695 EGYSGVGLLSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34577 (Experiment 1) 34577 61.033 609.280945 2+ 2+ 1216.5489176860701 0 -1.2971172470148709 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
113 112 Q96FW1 LLTSGYLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28871 (Experiment 1) 28871 54.431 525.802551 2+ 2+ 1049.5869442697701 0 3.427911252789689 96.4769647696477 Confident
|
|
|
114 113 P07900, P08238, Q14568 HNDDEQYAWESSAGGSFTVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35665 (Experiment 1) 35665 62.294 752.658447 3+ 3+ 2254.9515527359404 0 0.8675317605022779 100.0 Confident
|
|
|
115 114 P01911, P01912, Q5Y7A7, Q9GIY3 HNYGVVESFTVQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32255 (Experiment 1) 32255 58.347 539.247131 3+ 3+ 1614.7191708986504 0 0.2427464677111352 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
116 115 O00487 AVAVVVDPIQSVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36277 (Experiment 1) 36277 63.072 662.895203 2+ 2+ 1323.7762015914302 0 -0.2628808905843702 100.0 Confident
|
|
|
117 116 Q14444 EKPVCGTTYK Phosphorylation of Y(9) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6358 (Experiment 1) 6358 20.788 631.777405 2+ 2+ 1261.5413897774802 0 -0.8964471345754867 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 94.58987783595113) Y9 1 0 93.76693766937669 Confident
|
|
|
118 117 P19338 EAMEDGEIDGNKVTLDWAKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34576 (Experiment 1) 34576 61.032 587.287109 4+ 4+ 2345.1209265601606 0 -0.6795766072306796 100.0 Doubtful
|
|
|
119 118 P07900 NPDDITNEEYGEFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36752 (Experiment 1) 36752 63.63 917.395264 2+ 2+ 1832.7740888846006 0 1.0280103834701506 100.0 Confident
|
|
|
120 119 Q9UKD2 SPSDEYKDNLHQVSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10613 (Experiment 1) 10613 29.792 609.602966 3+ 3+ 1825.7883726572807 0 -0.7130634523787324 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82758620689656) Y6 1 0 99.24812030075188 Confident
|
|
|
121 120 Q9Y2X3 TQLYEYLQNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38069 (Experiment 1) 38069 65.221 704.319519 2+ 2+ 1406.6231452554903 0 0.9511394500752492 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 6: 0.0) Phosphorylation of Y (4: 0.16155088852988692) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
122 121 P06748 ADKDYHFKVDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21401 (Experiment 1) 21401 45.292 644.055969 4+ 4+ 2572.1942426127903 0 0.20476483988193472 100.0 Doubtful
|
|
|
123 122 P14625, Q58FF3 GLFDEYGSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33873 (Experiment 1) 33873 60.199 548.222717 2+ 2+ 1094.4321565983303 0 -1.1633323747931765 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.73684210526315 Confident
|
|
|
124 123 P53675, Q00610 GQFSTDELVAEVEKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40470 (Experiment 1) 40470 68.434 569.956909 3+ 3+ 1706.8475286083806 0 0.8006408075141892 96.2406015037594 Confident
|
|
|
125 124 P13796 VYALPEDLVEVNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43461 (Experiment 1) 43461 73.206 793.426819 2+ 2+ 1584.8399240468007 0 -0.5287065934088726 100.0 Confident
|
|
|
126 125 Q6UUV9 SQYLQLGPSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29646 (Experiment 1) 29646 55.319 614.790588 2+ 2+ 1227.56490210338 0 1.399635451499415 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
127 126 P06733, P13929 VNQIGSVTESIQACK Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31169 (Experiment 1) 31169 57.086 817.412781 2+ 2+ 1632.8141203051202 0 -1.9030977345361844 100.0 Confident
|
|
|
128 127 P23246 FAQHGTFEYEYSQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24132 (Experiment 1) 24132 48.878 588.264648 3+ 3+ 1761.7746980212903 0 -1.4638637861404789 100.0 Confident
|
|
|
129 128 P0DMV8, P11142, P17066, P34931, P48741, P54652 TTPSYVAFTDTER Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31168 (Experiment 1) 31168 57.085 784.337036 2+ 2+ 1566.6603186098505 0 -0.5096935567195194 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
130 129 P31949 ISSPTETER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9918 (Experiment 1) 9918 28.403 510.254364 2+ 2+ 1018.4931034545803 0 1.0500771739857175 99.7289972899729 Confident
|
|
|
131 130 P17987 YPVNSVNILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33344 (Experiment 1) 33344 59.59 573.829651 2+ 2+ 1145.6444591458903 0 0.25261901183638563 97.86666666666667 Confident
|
|
|
132 131 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34631 (Experiment 1) 34631 61.092 954.45752 2+ 2+ 1906.8978635366104 0 1.374358374370048 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 10.436287809638344) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y5} 1 100.0 Confident
|
|
|
133 132 O15144 YFQFQEEGKEGENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23965 (Experiment 1) 23965 48.67 587.600464 3+ 3+ 1759.7801773245506 0 -0.34872038058997407 98.7012987012987 Confident
|
|
|
134 133 P26639 IYGISFPDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42538 (Experiment 1) 42538 71.584 608.786133 2+ 2+ 1215.5576914646201 0 0.017741662339480883 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
135 134 Q1KMD3 EGCTEVSLLR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29315 (Experiment 1) 29315 54.938 582.290649 2+ 2+ 1162.56522284902 0 1.30709581902052 99.73045822102425 Confident
|
|
|
136 135 P18085, P61204, P84077, P84085 ILMVGLDAAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38067 (Experiment 1) 38067 65.219 544.313416 2+ 2+ 1086.6107164894604 0 1.4353671178364644 100.0 Confident
|
|
|
137 136 P04406 VIPELNGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21661 (Experiment 1) 21661 45.745 435.257721 2+ 2+ 868.5018176634801 0 -1.0667198634877189 97.289972899729 Confident
|
|
|
138 137 P19338 EAMEDGEIDGNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15509 (Experiment 1) 15509 37.626 654.276123 2+ 2+ 1306.5347105663802 0 2.279241660049499 98.6449864498645 Confident
|
|
|
139 138 P06733 DATNVGDEGGFAPNILENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41833 (Experiment 1) 41833 70.417 980.966248 2+ 2+ 1959.9173990733505 0 0.27727415558261215 100.0 Confident
|
|
|
140 139 P53701 TYSVPAHQER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8622 (Experiment 1) 8622 25.82 634.276245 2+ 2+ 1266.5394156315303 0 -1.1655516368211654 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.7289972899729 Confident
|
|
|
141 140 P05141 AAYFGIYDTAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39807 (Experiment 1) 39807 67.469 650.286499 2+ 2+ 1298.5584197406101 0 0.019472775731016422 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 33.59790818475573) Phosphorylation of Y (7: 10.131012094362879) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
142 141 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28292 (Experiment 1) 28292 53.751 609.260071 2+ 2+ 1216.5053215385904 0 0.21955143382241052 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 35.432414957046376) Phosphorylation of Y (3: 3.4904013961605584) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
143 142 Q9NR30 LLDSVPPTAISHFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34237 (Experiment 1) 34237 60.637 508.952148 3+ 3+ 1523.8347790967102 0 -0.10773581827294523 100.0 Confident
|
|
|
144 143 Q08211 LETHMTPEMFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30215 (Experiment 1) 30215 55.981 464.553467 3+ 3+ 1390.6373422434604 0 0.8821067077582139 100.0 Confident
|
|
|
145 144 Q9UJZ1 APVPGTPDSLSSGSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20655 (Experiment 1) 20655 44.306 757.875366 2+ 2+ 1513.7372498834102 0 -0.7064593506472471 98.91598915989161 Confident
|
|
|
146 145 Q96A33 LNQENEHIYNLWCSGR Phosphorylation of Y(9) Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38147 (Experiment 1) 38147 65.316 704.970703 3+ 3+ 2111.8884381350604 0 0.8707057371024091 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
147 146 Q86XP3 SEYTQPTPIQCQGVPVALSGR Phosphorylation of Y(3) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39200 (Experiment 1) 39200 66.621 790.038513 3+ 3+ 2367.0930111676903 0 0.2946827138162504 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
148 147 Q9Y2X3 TQLYEYLQNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37862 (Experiment 1) 37862 64.964 704.318115 2+ 2+ 1406.6231452554903 0 -1.0422758926838664 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 6: 0.0) Phosphorylation of Y (4: 1.1308562197092082) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
149 148 Q02790 VGEVCHITCKPEYAYGSAGSPPK Phosphorylation of Y(13) Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20156 (Experiment 1) 20156 43.735 863.05011 3+ 3+ 2586.1284107002402 0 0.03472155539364804 Phosphorylation of Y (15: Doubtfull) Phosphorylation of Y (15: 6.531290984664615) Phosphorylation of Y (13: 0.0) 0 Y15-{Y13 Y15} 1 100.0 Confident
|
|
|
150 149 P15144 SEYMEGNVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15425 (Experiment 1) 15425 37.515 582.72406 2+ 2+ 1163.4318393285 0 1.4824687667529992 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.65095986038395) Y3 1 0 100.0 Confident
|
|
|
151 150 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24554 (Experiment 1) 24554 49.391 420.23526 3+ 3+ 1257.68296991293 0 0.7778876025428992 99.24812030075188 Confident
|
|
|
152 151 Q7L5N7 HLDEYASIASSSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18145 (Experiment 1) 18145 41.193 496.552094 3+ 3+ 1486.6341038620105 0 0.23410610851716038 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
153 152 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36699 (Experiment 1) 36699 63.567 964.384521 2+ 2+ 1926.7560694694905 0 -0.8193836511202574 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 14: 0.0) Phosphorylation of Y (10: 3.311793214862682) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
154 153 P62805 ISGLIYEETR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30998 (Experiment 1) 30998 56.883 590.815002 2+ 2+ 1179.6135529404305 0 1.606364926501868 100.0 Confident
|
|
|
155 154 P78527 SIGEYDVLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33346 (Experiment 1) 33346 59.592 566.258545 2+ 2+ 1130.5009048644902 0 1.441218196627768 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
156 155 P50991 AYILNLVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40803 (Experiment 1) 40803 68.894 467.292542 2+ 2+ 932.5695033004804 0 1.099704075718369 97.84946236559139 Confident
|
|
|
157 156 P13796 GSVSDEEMMELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32949 (Experiment 1) 32949 59.137 691.800171 2+ 2+ 1381.58536624025 0 0.3055985475674535 100.0 Confident
|
|
|
158 157 P23284 HYGPGWVSMANAGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29725 (Experiment 1) 29725 55.41 777.833496 2+ 2+ 1553.6486488106805 0 2.436424343695637 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
159 158 P62249 EIKDILIQYDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37786 (Experiment 1) 37786 64.875 469.2612 3+ 3+ 1404.76127980328 0 0.3486306097997088 99.29078014184397 Confident
|
|
|
160 159 Q96RP9 EYGCPCITGKPK Phosphorylation of Y(2) Carbamidomethylation of C(4, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14477 (Experiment 1) 14477 36.023 497.21167 3+ 3+ 1488.61423744791 0 -0.7085162188394 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.30191972076788) Y2 1 0 99.24812030075188 Confident
|
|
|
161 160 P62241 IIDVVYNASNNELVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39392 (Experiment 1) 39392 66.889 859.959106 2+ 2+ 1717.8998985344103 0 2.18646454324762 100.0 Confident
|
|
|
162 161 P57721, Q15366 LVVPASQCGSLIGK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31801 (Experiment 1) 31801 57.83 714.897156 2+ 2+ 1427.7806353488702 0 -0.6128727397653555 99.45652173913044 Confident
|
|
|
163 162 Q9Y490 LAQAAQSSVATITR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21515 (Experiment 1) 21515 45.494 708.895203 2+ 2+ 1415.7732414693105 0 1.842022533791373 95.39295392953929 Confident
|
|
|
164 163 Q06323 KKGEDEDKGPPCGPVNCNEK Carbamidomethylation of C(12, 17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7601 (Experiment 1) 7601 23.688 565.257629 4+ 4+ 2257.01033056536 0 -3.9452795315776292 100.0 Doubtful
|
|
|
165 164 P04406 VPTANVSVVDLTCR Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36196 (Experiment 1) 36196 62.974 510.936523 3+ 3+ 1529.7871772812903 0 0.3668547558197566 100.0 Confident
|
|
|
166 165 P35579 ALELDSNLYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36173 (Experiment 1) 36173 62.946 637.294495 2+ 2+ 1272.5751324339103 0 -0.5455618717719145 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.86914378029078) Y9 1 0 99.45652173913044 Confident
|
|
|
167 166 P83881 GKDSLYAQGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7733 (Experiment 1) 7733 23.924 573.763245 2+ 2+ 1145.5118039013603 0 0.11604527839169737 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
168 167 P54886 GDECGLALGR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22521 (Experiment 1) 22521 46.88 524.247009 2+ 2+ 1046.48149322506 0 -1.934350340566906 99.74358974358975 Confident
|
|
|
169 168 Q9UPU5 MSEHYWTPQSNVSNETSTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25913 (Experiment 1) 25913 50.972 788.660828 3+ 3+ 2361.957305540521 1 -0.0024434705038485654 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
170 169 P53999 EQISDIDDAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27680 (Experiment 1) 27680 53.03 630.807312 2+ 2+ 1259.5993594282702 0 0.5640696402759153 100.0 Confident
|
|
|
171 170 P63241, Q9GZV4 IVEMSTSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11488 (Experiment 1) 11488 31.303 447.732941 2+ 2+ 893.4528188657303 0 -1.6637114886832371 100.0 Confident
|
|
|
172 171 P07900 KHLEINPDHSIIETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28894 (Experiment 1) 28894 54.457 639.018738 3+ 3+ 1914.0323096862903 0 1.0823446408425292 100.0 Confident
|
|
|
173 172 P13796, P13797 ALENDPDCR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9614 (Experiment 1) 9614 27.884 545.234924 2+ 2+ 1088.45567240004 0 -0.3460283970645723 98.73096446700508 Confident
|
|
|
174 173 O60256 VQVYQEPNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12165 (Experiment 1) 12165 32.386 606.776306 2+ 2+ 1211.5336019751003 0 3.672776607584572 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.86914378029078) Y4 1 0 99.73333333333333 Confident
|
|
|
175 174 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37038 (Experiment 1) 37038 63.973 473.279388 2+ 2+ 944.5443511818 0 -0.13534860158567702 100.0 Confident
|
|
|
176 175 Q96A65 KFLDTSHYSTAGSSSVR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18714 (Experiment 1) 18714 41.941 641.626282 3+ 3+ 1921.8571209234403 0 -0.05419762971650865 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 96.33507853403141) Y8 1 0 98.49624060150376 Confident
|
|
|
177 176 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33729 (Experiment 1) 33729 60.033 932.892578 2+ 2+ 1863.7750310922602 0 -2.3732718428268598 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 13.639845744958045) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
178 177 P49327 GTPLISPLIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39480 (Experiment 1) 39480 67.015 519.831299 2+ 2+ 1037.64848189717 0 -0.4201657457345377 100.0 Confident
|
|
|
179 178 P62263 VKADRDESSPYAAMLAAQDVAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34817 (Experiment 1) 34817 61.307 623.810608 4+ 4+ 2491.2125355292205 0 0.31684447633045415 100.0 Doubtful
|
|
|
180 179 P10809 TVIIEQSWGSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33621 (Experiment 1) 33621 59.91 672.861694 2+ 2+ 1343.7085159544301 0 0.2371304714955769 100.0 Confident
|
|
|
181 180 P07203 DYTQMNELQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24826 (Experiment 1) 24826 49.705 689.278015 2+ 2+ 1376.5431806826302 0 -1.235796088095876 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 99.7289972899729 Confident
|
|
|
182 181 P61158 DYEEIGPSICR Phosphorylation of Y(2) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30719 (Experiment 1) 30719 56.558 709.779846 2+ 2+ 1417.5584963936 0 -9.409397586489202 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Doubtful
|
|
|
183 182 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16262 (Experiment 1) 16262 38.673 514.763855 2+ 2+ 1027.5120650773501 0 1.0606709983766187 100.0 Confident
|
|
|
184 183 P07900, P08238, Q58FF7, Q58FF8 IRYESLTDPSKLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24301 (Experiment 1) 24301 49.096 452.98996 4+ 4+ 1807.9315925855103 0 -0.47377007631926316 100.0 Doubtful
|
|
|
185 184 P11021 TWNDPSVQQDIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27182 (Experiment 1) 27182 52.437 715.84906 2+ 2+ 1429.6837577585702 0 -0.1331930008670059 100.0 Confident
|
|
|
186 185 P31943 GLPWSCSADEVQR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34210 (Experiment 1) 34210 60.606 752.846619 2+ 2+ 1503.6776268323104 0 0.7028223163992806 100.0 Confident
|
|
|
187 186 P46782 AQCPIVER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12936 (Experiment 1) 12936 33.641 486.750336 2+ 2+ 971.4858503295102 0 0.2760521361927986 99.73045822102425 Confident
|
|
|
188 187 P43487 ICANHYITPMMELKPNAGSDR Phosphorylation of Y(6) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37286 (Experiment 1) 37286 64.266 625.280518 4+ 4+ 2497.09533675015 0 -0.9478206513685942 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Doubtful
|
|
|
189 188 P49773 MVVNEGSDGGQSVYHVHLHVLGGR Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29225 (Experiment 1) 29225 54.834 876.413513 3+ 3+ 2626.2111692377603 0 2.8678940997016023 Phosphorylation of Y (14: Very Confident) Phosphorylation of Y (14: 100.0) Phosphorylation of Y (14: 100.0) Y14 1 0 100.0 Confident
|
|
|
190 189 P61077, P62837 SQWSPALTISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34997 (Experiment 1) 34997 61.521 609.329529 2+ 2+ 1216.6451874218803 0 -0.5599229070486461 99.73333333333333 Confident
|
|
|
191 190 P22314 LDQPMTEIVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31805 (Experiment 1) 31805 57.835 644.833557 2+ 2+ 1287.6492868261503 0 2.5388323101889587 100.0 Confident
|
|
|
192 191 O14950, P19105 GNFNYIEFTR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41414 (Experiment 1) 41414 69.778 670.78772 2+ 2+ 1339.5598167229405 0 0.7978263894026244 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
193 192 P14618 KGVNLPGAAVDLPAVSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35300 (Experiment 1) 35300 61.868 589.000061 3+ 3+ 1763.9781488551105 0 0.11587122576816226 91.72932330827068 Doubtful
|
|
|
194 193 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 IIAPPERK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9814 (Experiment 1) 9814 28.231 462.287384 2+ 2+ 922.5600012459402 0 0.23126359568061527 92.40837696335078 Confident
|
|
|
195 194 P26641 STFVLDEFKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35689 (Experiment 1) 35689 62.321 621.329529 2+ 2+ 1240.6451874218803 0 -0.5491088850498944 100.0 Confident
|
|
|
196 195 P14625 SILFVPTSAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39808 (Experiment 1) 39808 67.47 594.343872 2+ 2+ 1186.6710082469 0 1.8363304368332398 100.0 Confident
|
|
|
197 196 P62266 KGHAVGDIPGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13281 (Experiment 1) 13281 34.126 402.562897 3+ 3+ 1204.66765420196 0 -0.6562965122433619 100.0 Confident
|
|
|
198 197 P0DMV8, P11142, P17066, P34931, P54652 ITITNDKGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8427 (Experiment 1) 8427 25.404 509.288025 2+ 2+ 1016.5614577979202 0 0.03855230782354811 99.45799457994579 Confident
|
|
|
199 198 P19338 EALNSCNKR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4347 (Experiment 1) 4347 16.948 546.268921 2+ 2+ 1090.51894136294 0 3.9794692414154236 90.83557951482479 Confident
|
|
|
200 199 Q9BY44 LYQYPNFAGPHAALANK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33266 (Experiment 1) 33266 59.499 652.311401 3+ 3+ 1953.9138479539204 0 -0.7533994975749788 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.68655920921578) Phosphorylation of Y (2: 75.1194685766576) 0 Y2-{Y2 Y4} 1 99.24812030075188 Confident
|
|
|
201 200 Q00534 HLETFEHPNVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18816 (Experiment 1) 18816 42.068 493.26001 3+ 3+ 1476.7473610746406 0 7.325145700557746 100.0 Doubtful
|
|
|
202 201 P42166, P42167 PEFLEDPSVLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41198 (Experiment 1) 41198 69.466 687.861633 2+ 2+ 1373.7078472480905 0 0.6293553737332883 99.46380697050938 Confident
|
|
|
203 202 P52566 TLLGDGPVVTDPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31804 (Experiment 1) 31804 57.834 656.361023 2+ 2+ 1310.7081816012603 0 -0.5245089966535967 100.0 Confident
|
|
|
204 203 P46778 HGVVPLATYMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30477 (Experiment 1) 30477 56.279 622.334412 2+ 2+ 1242.6543126369404 0 -0.03339889476844018 100.0 Confident
|
|
|
205 204 P26038 SGYLAGDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11654 (Experiment 1) 11654 31.554 405.703033 2+ 2+ 809.3919328613301 0 -0.5173670181227665 100.0 Confident
|
|
|
206 205 ALDOA_RABIT, P04075 ADDGRPFPQVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26507 (Experiment 1) 26507 51.658 448.241699 3+ 3+ 1341.7040992803304 0 -0.6184760394028438 100.0 Confident
|
|
|
207 206 P62753 LIEVDDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19905 (Experiment 1) 19905 43.431 494.751007 2+ 2+ 987.4872897981502 0 0.17308530265481267 100.0 Confident
|
|
|
208 207 Q99729 EVYQQQQYGSGGR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11622 (Experiment 1) 11622 31.495 790.33136 2+ 2+ 1578.64639988121 0 1.1180039354238922 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 8.243795040643178) Phosphorylation of Y (3: 92.65734265734265) 0 Y3-{Y3 Y8} 1 100.0 Confident
|
|
|
209 208 Q9Y3U8 EELSNVLAAMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44359 (Experiment 1) 44359 75.041 616.81842 2+ 2+ 1231.6230720783103 0 -0.636339163666476 100.0 Confident
|
|
|
210 209 P50502, Q8IZP2 VAAIEALNDGELQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33955 (Experiment 1) 33955 60.297 735.890869 2+ 2+ 1469.7725727629704 0 -3.6606493565452896 100.0 Confident
|
|
|
211 210 Q96AE4 IGGDAGTSLNSNDYGYGGQK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23940 (Experiment 1) 23940 48.64 1027.428955 2+ 2+ 2052.84259305811 0 0.3718060242401615 Phosphorylation of Y (14: Random) Phosphorylation of Y (14: 0.0, 16: 0.0) Phosphorylation of Y (14: 0.0) 0 Y14-{Y14 Y16} 1 100.0 Confident
|
|
|
212 211 P62263 VKADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33627 (Experiment 1) 33627 59.916 858.06842 3+ 3+ 2571.1788660499706 0 1.7731910341088515 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
213 212 Q06323 TENLLGSYFPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43991 (Experiment 1) 43991 74.117 634.830322 2+ 2+ 1267.6448530687103 0 0.9750628079935478 99.74489795918367 Confident
|
|
|
214 213 E9PAV3, Q13765 DIELVMSQANVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39305 (Experiment 1) 39305 66.768 731.372681 2+ 2+ 1460.7293280520005 0 1.0124905627774337 96.7479674796748 Confident
|
|
|
215 214 P52565 YKEALLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16797 (Experiment 1) 16797 39.325 475.276764 2+ 2+ 948.53926580136 0 -0.30585851968360794 98.72122762148338 Confident
|
|
|
216 215 P04075 PYQYPALTPEQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29726 (Experiment 1) 29726 55.412 757.850342 2+ 2+ 1513.6854111588805 0 0.4749670200896767 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 15.214780343797543) Phosphorylation of Y (2: 0.16155088852988692) 0 Y2-{Y2 Y4} 1 100.0 Confident
|
|
|
217 216 Q96T37 IEAVYVSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22024 (Experiment 1) 22024 46.261 508.744354 2+ 2+ 1015.4739618406602 0 0.18990456703514658 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 91.97207678883072) Y5 1 0 97.5609756097561 Confident
|
|
|
218 217 Q8IZD4 KITSSSAIYDNPNLIKPIPVKPSENQQQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28808 (Experiment 1) 28808 54.358 837.184509 4+ 4+ 3344.7129698179006 0 -1.2063291401229552 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Doubtful
|
|
|
219 218 P30626 ALTTMGFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30218 (Experiment 1) 30218 55.984 448.736267 2+ 2+ 895.4585729525102 0 -0.6595029054539918 99.46091644204851 Confident
|
|
|
220 219 Q00610 NNLAGAEELFAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40553 (Experiment 1) 40553 68.551 652.833496 2+ 2+ 1303.6520637074705 0 0.28748449301399137 93.22493224932249 Confident
|
|
|
221 220 Q12906 VPTWGPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35586 (Experiment 1) 35586 62.199 463.267303 2+ 2+ 924.5181364339601 0 2.068607441539196 99.72972972972973 Confident
|
|
|
222 221 O15144 DNTINLIHTFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38040 (Experiment 1) 38040 65.185 448.574463 3+ 3+ 1342.6993482530604 0 1.6432427015817863 99.29577464788733 Confident
|
|
|
223 222 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29987 (Experiment 1) 29987 55.716 677.842834 2+ 2+ 1353.6693671719202 0 1.2893082449772573 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
224 223 Q9NWQ8 ENDYESISDLQQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30473 (Experiment 1) 30473 56.273 578.572937 3+ 3+ 1732.6941379192701 0 1.6383327384726198 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
225 224 B2RXH8, B7ZW38, O60812, P07910 KSDVEAIFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26265 (Experiment 1) 26265 51.38 562.304199 2+ 2+ 1122.5920892198603 0 1.5612983685076642 100.0 Confident
|
|
|
226 225 Q06830 DISLSDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27374 (Experiment 1) 27374 52.663 510.718201 2+ 2+ 1019.4212575614604 0 0.5790916175729687 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
227 226 O60869 INEKPQVIADYESGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23714 (Experiment 1) 23714 48.337 573.629272 3+ 3+ 1717.8635130256903 0 1.4373844746010258 100.0 Confident
|
|
|
228 227 O00194, O95716, P20336, P20337, P20338, P20340, P51159, P59190, P61006, P61018, P61026, P61106, P62820, Q14964, Q15286, Q15771, Q5JT25, Q6IQ22, Q7Z6P3, Q86YS6, Q8IZ41, Q92928, Q92930, Q96AX2, Q96DA2, Q96E17, Q9BZG1, Q9H082, Q9H0U4, Q9NP90, Q9NRW1 LQIWDTAGQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34710 (Experiment 1) 34710 61.183 658.833069 2+ 2+ 1315.6520637074702 0 -0.3632490102485918 100.0 Confident
|
|
|
229 228 P04406 VVDLMAHMASK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27682 (Experiment 1) 27682 53.033 601.306335 2+ 2+ 1200.5995001827605 0 -1.1500916533236956 100.0 Confident
|
|
|
230 229 P61247 LIPDSIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23113 (Experiment 1) 23113 47.583 421.752472 2+ 2+ 841.4909186266102 0 -0.6254378328199289 99.49622166246851 Confident
|
|
|
231 230 Q9UBQ7 GDVVNQDDLYQALASGK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41311 (Experiment 1) 41311 69.619 936.925049 2+ 2+ 1871.8302374692603 0 2.832463575769311 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 88.04523424878836) Y10 1 0 90.27027027027027 Doubtful
|
|
|
232 231 P50502, Q8IZP2, Q8NFI4 AIDLFTDAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44524 (Experiment 1) 44524 75.462 553.807983 2+ 2+ 1105.6019256275704 0 -0.46276053523580385 96.7479674796748 Confident
|
|
|
233 232 Q9NZ63 NAEDCLYELPENIR Phosphorylation of Y(7) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42453 (Experiment 1) 42453 71.417 908.383423 2+ 2+ 1814.7546300008503 0 -1.286313361319644 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 82.02443280977312) Y7 1 0 95.39295392953929 Confident
|
|
|
234 233 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 QLFHPEQLITGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36671 (Experiment 1) 36671 63.533 705.89093 2+ 2+ 1409.7666995368902 0 0.43032834204477116 99.73333333333333 Confident
|
|
|
235 234 P23368 VTEYLYANK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23111 (Experiment 1) 23111 47.581 590.768005 2+ 2+ 1179.5213059559003 0 0.1278932623688187 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 10.33452891645359) Phosphorylation of Y (6: 22.358248209033547) 0 Y6-{Y4 Y6} 1 99.73890339425587 Confident
|
|
|
236 235 P38159 SDLYSSGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9838 (Experiment 1) 9838 28.267 482.692261 2+ 2+ 963.3698906949401 0 0.08118158157466422 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 88.30715532286213) Y4 1 0 96.7479674796748 Confident
|
|
|
237 236 P22102 AIAFLQQPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34993 (Experiment 1) 34993 61.516 522.303711 2+ 2+ 1042.5923640033802 0 0.4834957412997696 100.0 Confident
|
|
|
238 237 P28074 AIYQATYR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17105 (Experiment 1) 17105 39.735 533.241333 2+ 2+ 1064.4692108133902 0 -1.0293143238965765 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 7: 0.0) Phosphorylation of Y (3: 99.82547993019197) 0 Y3-{Y3 Y7} 1 100.0 Confident
|
|
|
239 238 P04406 LVINGNPITIFQERDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44082 (Experiment 1) 44082 74.288 681.041504 3+ 3+ 2040.1003892461104 0 1.1224749223064148 100.0 Confident
|
|
|
240 239 Q16698 VAGHPNIVINNAAGNFISPTER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35582 (Experiment 1) 35582 62.193 764.402161 3+ 3+ 2290.18182745429 0 1.232400473870203 100.0 Confident
|
|
|
241 240 P40227, Q92526 QADLYISEGLHPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29122 (Experiment 1) 29122 54.716 500.259674 3+ 3+ 1497.7575914051702 0 -0.26573232586178436 99.28057553956835 Confident
|
|
|
242 241 Q99460 SGMYTVAMAYCGSGNNK Phosphorylation of Y(4) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35323 (Experiment 1) 35323 61.896 945.864868 2+ 2+ 1889.7147564181603 0 0.2255334383575793 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 10: 0.0) Phosphorylation of Y (4: 95.28795811518324) 0 Y4-{Y4 Y10} 1 99.1891891891892 Doubtful
|
|
|
243 242 O00148, Q13838 GSYVSIHSSGFR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22500 (Experiment 1) 22500 46.854 459.538849 3+ 3+ 1375.5921794803803 0 1.8410658585282058 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.03069466882067) Y3 1 0 100.0 Confident
|
|
|
244 243 P13796 NEALIALLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45067 (Experiment 1) 45067 76.722 506.811493 2+ 2+ 1011.6076797143501 0 0.7432276066135707 99.73190348525469 Confident
|
|
|
245 244 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21412 (Experiment 1) 21412 45.306 506.908508 3+ 3+ 1517.7014551458406 0 1.4726240770465153 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.65095986038395) Y11 1 0 100.0 Confident
|
|
|
246 245 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35800 (Experiment 1) 35800 62.464 630.798096 2+ 2+ 1259.5798834611805 0 1.3915765198696306 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
247 246 P40925 GEFVTTVQQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20657 (Experiment 1) 20657 44.308 582.80603 2+ 2+ 1163.5934862021902 0 3.4495851526196515 100.0 Confident
|
|
|
248 247 P61254, Q9UNX3 FNPFVTSDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34992 (Experiment 1) 34992 61.514 541.766968 2+ 2+ 1081.5192586327703 0 0.11484053776431268 100.0 Confident
|
|
|
249 248 O00571, O15523, P17844, Q92841 MLDMGFEPQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42952 (Experiment 1) 42952 72.36 668.82373 2+ 2+ 1335.63152858703 0 1.0305262092469032 100.0 Confident
|
|
|
250 249 P52209 TIFQGIAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30973 (Experiment 1) 30973 56.854 474.779572 2+ 2+ 947.5440168286304 0 0.6047417862023142 99.73684210526315 Confident
|
|
|
251 250 P27635, Q96L21 GAFGKPQGTVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10860 (Experiment 1) 10860 30.237 396.88739 3+ 3+ 1187.6411051009502 0 -0.6420804444595076 100.0 Confident
|
|
|
252 251 P49411 GTVVTGTLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19081 (Experiment 1) 19081 42.391 516.788208 2+ 2+ 1031.5611234447501 0 0.7155950383985096 99.72972972972973 Confident
|
|
|
253 252 Q02878 AIPQLQGYLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39802 (Experiment 1) 39802 67.463 579.835693 2+ 2+ 1157.65569253593 0 0.9834954809482186 100.0 Confident
|
|
|
254 253 P33991 DYIAYAHSTIMPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33261 (Experiment 1) 33261 59.494 539.908325 3+ 3+ 1616.7058293336302 0 -1.6569045122021346 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 6.766660331122675) Phosphorylation of Y (2: 0.17452006980802792) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
255 254 P68431, Q16695, Q71DI3 KSAPATGGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4039 (Experiment 1) 4039 16.602 458.266632 2+ 2+ 914.5185303567803 0 0.1971664734562798 100.0 Confident
|
|
|
256 255 Q16658 YLAPSGPSGTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21744 (Experiment 1) 21744 45.874 595.823914 2+ 2+ 1189.6342883850102 0 -0.8503500354652295 97.8319783197832 Confident
|
|
|
257 256 Q9HCS7 AAEIYGVTHTR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17602 (Experiment 1) 17602 40.424 433.20285 3+ 3+ 1296.58636582395 0 0.272986593445268 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
258 257 P07195 LIAPVAEEEATVPNNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29728 (Experiment 1) 29728 55.414 565.638611 3+ 3+ 1693.8886651443706 0 3.1459851361226847 98.7012987012987 Confident
|
|
|
259 258 P11142 TVTNAVVTVPAYFNDSQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41091 (Experiment 1) 41091 69.316 661.337402 3+ 3+ 1980.9905044439602 0 -0.06443729915072922 94.8905109489051 Confident
|
|
|
260 259 P07900, P08238, Q14568, Q58FF8 ADLINNLGTIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39801 (Experiment 1) 39801 67.46 621.856323 2+ 2+ 1241.6979512707305 0 0.11400998606800582 100.0 Confident
|
|
|
261 260 P62917 ASGNYATVISHNPETKK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13783 (Experiment 1) 13783 34.918 632.967102 3+ 3+ 1895.8778563680203 0 0.853247570548678 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
262 261 P61247 TSYAQHQQVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6114 (Experiment 1) 6114 20.323 609.306763 2+ 2+ 1216.5948831845203 0 3.35618758103707 99.45945945945947 Confident
|
|
|
263 262 P52272 MVPAGMGAGLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27978 (Experiment 1) 27978 53.375 594.796448 2+ 2+ 1187.5790990913501 0 -0.635532118797961 98.92183288409704 Confident
|
|
|
264 263 P62158 VFDKDGNGYISAAELR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31565 (Experiment 1) 31565 57.553 612.284546 3+ 3+ 1833.8298435464403 0 1.0697941225639298 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
265 264 Q99623 IVQAEGEAEAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11678 (Experiment 1) 11678 31.591 608.315247 2+ 2+ 1214.6142812164205 0 1.3643026605486293 92.99191374663073 Confident
|
|
|
266 265 P08238 HLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30328 (Experiment 1) 30328 56.109 446.492859 4+ 4+ 1781.94243205273 0 -0.05706696658627241 100.0 Doubtful
|
|
|
267 266 P62263 ADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37860 (Experiment 1) 37860 64.961 782.345459 3+ 3+ 2344.0154891229804 0 -0.40115400351024033 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
268 267 Q9P258 DVACGANHTLVLDSQKR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18477 (Experiment 1) 18477 41.637 628.651001 3+ 3+ 1882.9319440220204 0 -0.4085054826206806 100.0 Confident
|
|
|
269 268 P50990 HFSGLEEAVYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28973 (Experiment 1) 28973 54.546 694.306091 2+ 2+ 1386.5969305076505 0 0.5030627599724282 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
270 269 P40926 IQEAGTEVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13503 (Experiment 1) 13503 34.495 537.295898 2+ 2+ 1072.5764391557204 0 0.7481085001342006 99.72972972972973 Confident
|
|
|
271 270 P50395 MTGSEFDFEEMKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33420 (Experiment 1) 33420 59.676 536.234497 3+ 3+ 1605.6803292542504 0 0.8282113046330443 99.28057553956835 Confident
|
|
|
272 271 P20292 TGTLAFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23488 (Experiment 1) 23488 48.046 447.7388 2+ 2+ 893.4606811274903 0 2.642104210010737 93.01075268817205 Confident
|
|
|
273 272 P23526 SKFDNLYGCR Phosphorylation of Y(7) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19403 (Experiment 1) 19403 42.788 670.278137 2+ 2+ 1338.54278675981 0 -0.7949629624948115 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
274 273 P61313 SLQSVAEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17543 (Experiment 1) 17543 40.348 509.76181 2+ 2+ 1017.5090878718904 0 -0.02040709351833744 100.0 Confident
|
|
|
275 274 P47756 STLNEIYFGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39398 (Experiment 1) 39398 66.895 626.286987 2+ 2+ 1250.5584197406104 0 0.799415113726335 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
276 275 P52597 YGDSEFTVQSTTGHCVHMR Carbamidomethylation of C(15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22600 (Experiment 1) 22600 46.972 553.746277 4+ 4+ 2210.9473363859806 0 3.9123426351725548 100.0 Doubtful
|
|
|
277 276 P62805 RISGLIYEETR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25662 (Experiment 1) 25662 50.686 446.245239 3+ 3+ 1335.7146639640305 0 -0.5799232860519776 100.0 Confident
|
|
|
278 277 P54577 IDVGEAEPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17862 (Experiment 1) 17862 40.763 493.250275 2+ 2+ 984.4876241513202 0 -1.6493475452666861 99.7289972899729 Confident
|
|
|
279 278 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43625 (Experiment 1) 43625 73.476 895.9505 2+ 2+ 1789.88464239309 0 1.0071287998046068 100.0 Confident
|
|
|
280 279 P78527 FVPLLPGNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37139 (Experiment 1) 37139 64.095 506.800537 2+ 2+ 1011.5865503469502 0 -0.028887669858773817 99.73190348525469 Confident
|
|
|
281 280 P62888 KSEIEYYAMLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35890 (Experiment 1) 35890 62.575 482.582184 3+ 3+ 1444.7272027936804 0 -1.7131381622032704 100.0 Confident
|
|
|
282 281 Q9Y6E2 NYAQVFNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21797 (Experiment 1) 21797 45.953 532.23407 2+ 2+ 1062.4535607492503 0 0.02472326335053438 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
283 282 Q06323 QPHVGDYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8784 (Experiment 1) 8784 26.183 526.222229 2+ 2+ 1050.4284086305702 0 1.4218687950521736 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.72826086956522 Confident
|
|
|
284 283 P04843 DVPAYSQDTFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27683 (Experiment 1) 27683 53.035 635.801025 2+ 2+ 1269.5877321154103 0 -0.1848447720140766 100.0 Confident
|
|
|
285 284 P49736 IFASIAPSIYGHEDIKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32913 (Experiment 1) 32913 59.097 480.010803 4+ 4+ 1916.0155969929904 0 -0.7764716291085746 100.0 Doubtful
|
|
|
286 285 P36873, P62136, P62140 AHQVVEDGYEFFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35901 (Experiment 1) 35901 62.587 547.263306 3+ 3+ 1638.7678217357006 0 0.162544491087567 100.0 Confident
|
|
|
287 286 P16298, Q08209 HLTEYFTFK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37262 (Experiment 1) 37262 64.237 633.28302 2+ 2+ 1264.5529404373503 0 -1.1474879800452384 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.50959860383944) Y5 1 0 98.9247311827957 Confident
|
|
|
288 287 O00299, Q96NY7, Q9NZA1, Q9Y696 IGNCPFSQR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18635 (Experiment 1) 18635 41.843 539.758606 2+ 2+ 1077.5025630228101 0 0.08896900685600857 96.4769647696477 Confident
|
|
|
289 288 P62826 LVLVGDGGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23960 (Experiment 1) 23960 48.664 508.292816 2+ 2+ 1014.57095985246 0 0.11726895047285106 100.0 Confident
|
|
|
290 289 P61088, Q5JXB2 WSPALQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35169 (Experiment 1) 35169 61.716 485.774323 2+ 2+ 969.53960015453 0 -5.668328560467586 96.75675675675676 Doubtful
|
|
|
291 290 P16070 NLQNVDMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15903 (Experiment 1) 15903 38.213 481.242371 2+ 2+ 960.4698659122002 0 0.33575003344404036 93.6 Confident
|
|
|
292 291 Q6UXN9 YTHAANTVVYSSNK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11544 (Experiment 1) 11544 31.375 545.579407 3+ 3+ 1633.7137511650405 0 1.61323218883926 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 6.3894912415474625) Phosphorylation of Y (10: 96.33507853403141) 0 Y10-{Y1 Y10} 1 97.74436090225565 Confident
|
|
|
293 292 P32119 LSEDYGVLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27771 (Experiment 1) 27771 53.14 552.255981 2+ 2+ 1102.4947568548903 0 2.401257700687475 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.16055846422339) Y5 1 0 99.7289972899729 Confident
|
|
|
294 293 P04083 CATSKPAFFAEK Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20711 (Experiment 1) 20711 44.369 452.892761 3+ 3+ 1355.6543722065906 0 1.5319271590059313 100.0 Confident
|
|
|
295 294 P26038 KTQEQLALEMAELTAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41313 (Experiment 1) 41313 69.622 611.324951 3+ 3+ 1830.9509481311006 0 1.1316789916251657 100.0 Confident
|
|
|
296 295 Q9BQ48 GNEYQPSNIK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11732 (Experiment 1) 11732 31.681 615.263855 2+ 2+ 1228.5125321773503 0 0.5078222439726523 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 84.81675392670157) Y4 1 0 96.2059620596206 Confident
|
|
|
297 296 P78527 HGDLPDIQIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27959 (Experiment 1) 27959 53.354 568.309814 2+ 2+ 1134.6033226099003 0 1.5418167470548565 99.73045822102425 Confident
|
|
|
298 297 O43423, O95626, P39687, Q92688 IKDLSTIEPLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28306 (Experiment 1) 28306 53.768 419.587738 3+ 3+ 1255.7387534535503 0 2.0902672434146563 96.37681159420289 Confident
|
|
|
299 298 P04899, P08754, P63096 EIYTHFTCATDTK Phosphorylation of Y(3) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23135 (Experiment 1) 23135 47.606 833.845276 2+ 2+ 1665.6745887750005 0 0.8456560279006894 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
300 299 P52272 INEILSNALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35587 (Experiment 1) 35587 62.2 557.826843 2+ 2+ 1113.6393737654503 0 -0.21574707761150336 100.0 Confident
|
|
|
301 300 Q06323 TENLLGSYFPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43839 (Experiment 1) 43839 73.853 634.830139 2+ 2+ 1267.6448530687103 0 0.6867965231496259 98.91598915989161 Confident
|
|
|
302 301 P61247 LMELHGEGSSSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13449 (Experiment 1) 13449 34.396 666.317688 2+ 2+ 1330.6187149738603 0 1.5818999617483738 99.1869918699187 Confident
|
|
|
303 302 P08238, Q58FF7 RAPFDLFENKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31584 (Experiment 1) 31584 57.575 455.582764 3+ 3+ 1363.7248347249106 0 1.1910580769292647 96.2962962962963 Confident
|
|
|
304 303 P50395 FKIPGSPPESMGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28456 (Experiment 1) 28456 53.944 468.241425 3+ 3+ 1401.70747040861 0 -3.5770657355852307 94.73684210526316 Confident
|
|
|
305 304 P50990 FAEAFEAIPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38499 (Experiment 1) 38499 65.753 575.798096 2+ 2+ 1149.58185888933 0 -0.19088541088980396 100.0 Confident
|
|
|
306 305 P25398 LGEWVGLCK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37058 (Experiment 1) 37058 63.998 531.276428 2+ 2+ 1060.5375515492 0 0.7072755986415429 100.0 Confident
|
|
|
307 306 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35303 (Experiment 1) 35303 61.873 631.303833 2+ 2+ 1259.5798834611805 1 7.8272122248334 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.95287958115183) Y6 1 0 99.73118279569893 Doubtful
|
|
|
308 307 P12955 AVYEAVLR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27352 (Experiment 1) 27352 52.636 500.747009 2+ 2+ 999.4790472211002 0 0.41722211280742916 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
309 308 P09651, P22626, Q32P51 KIFVGGIKEDTEEHHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18715 (Experiment 1) 18715 41.942 502.771057 4+ 4+ 2007.0537734068607 0 0.6706465979338566 100.0 Doubtful
|
|
|
310 309 P11940, Q9H361 GFGFVSFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43882 (Experiment 1) 43882 73.93 523.258545 2+ 2+ 1044.5028802926402 0 -0.32796994426646014 100.0 Confident
|
|
|
311 310 P60866 DTGKTPVEPEVAIHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18201 (Experiment 1) 18201 41.269 412.972046 4+ 4+ 1647.8580337224305 0 0.6322528315192607 100.0 Doubtful
|
|
|
312 311 Q13263 LTEDKADVQSIIGLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35249 (Experiment 1) 35249 61.81 595.996033 3+ 3+ 1784.9632270669601 0 1.7016543807275297 91.72932330827068 Doubtful
|
|
|
313 312 P14866 LCFSTAQHAS Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20577 (Experiment 1) 20577 44.217 561.256409 2+ 2+ 1120.4971432892003 0 0.9993456453838881 98.91598915989161 Confident
|
|
|
314 313 P30086 GNDISSGTVLSDYVGSGPPK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37343 (Experiment 1) 37343 64.338 677.308472 3+ 3+ 2028.9041306855102 0 -0.2677685883066507 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 98.42931937172776) Y13 1 0 100.0 Confident
|
|
|
315 314 P38646 VQQTVQDLFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37342 (Experiment 1) 37342 64.337 645.841125 2+ 2+ 1289.6727991520502 0 -3.9499385559626607 100.0 Confident
|
|
|
316 315 P10768 SGYHQSASEHGLVVIAPDTSPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26108 (Experiment 1) 26108 51.198 796.705383 3+ 3+ 2387.090702668571 0 1.513288995573314 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.67689822294022) Y3 1 0 100.0 Confident
|
|
|
317 316 P30101 TVAYTEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8864 (Experiment 1) 8864 26.374 470.242371 2+ 2+ 938.4709114580203 0 -0.7681050601717164 98.93617021276596 Confident
|
|
|
318 317 P59998 ELLLQPVTISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41509 (Experiment 1) 41509 69.923 634.882751 2+ 2+ 1267.7499868435902 0 0.757796233420699 98.9501312335958 Confident
|
|
|
319 318 P52272 LGSTVFVANLDYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41358 (Experiment 1) 41358 69.702 713.883423 2+ 2+ 1425.7503807664104 0 1.339366110107231 99.45652173913044 Confident
|
|
|
320 319 Q06830 TIAQDYGVLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28455 (Experiment 1) 28455 53.943 594.288086 2+ 2+ 1186.5635051210502 0 -1.5868159953869803 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 86.38743455497382) Y6 1 0 92.9539295392954 Confident
|
|
|
321 320 P62995 RPHTPTPGIYMGRPTYGSSR Phosphorylation of Y(16, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22128 (Experiment 1) 22128 46.39 797.687622 3+ 3+ 2390.03921538055 0 0.7610416031229049 Phosphorylation of Y (10: Very Confident, 16: Very Confident) Phosphorylation of Y (10: 99.65095986038395, 16: 99.65095986038395) Y10, Y16 2 0 99.37888198757764 Confident
|
|
|
322 321 P52272 FESPEVAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19349 (Experiment 1) 19349 42.724 532.25592 2+ 2+ 1062.4981888350203 0 -0.8471186949391571 100.0 Confident
|
|
|
323 322 P14618 GDYPLEAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28893 (Experiment 1) 28893 54.454 510.261963 2+ 2+ 1018.5083595959002 0 0.9930893891998691 99.72972972972973 Confident
|
|
|
324 323 P62244 HGYIGEFEIIDDHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34998 (Experiment 1) 34998 61.523 567.605652 3+ 3+ 1699.7954334658702 0 -0.1802109439010991 100.0 Confident
|
|
|
325 324 Q06830, Q13162 GLFIIDDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41839 (Experiment 1) 41839 70.425 460.75824 2+ 2+ 919.5014833103103 0 0.4815500201330074 99.73333333333333 Confident
|
|
|
326 325 P10599, THIO_HUMAN VGEFSGANK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11144 (Experiment 1) 11144 30.775 454.727448 2+ 2+ 907.4399456829101 0 0.4369470562368573 100.0 Confident
|
|
|
327 326 Q9BZZ5 DAYQVILDGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43677 (Experiment 1) 43677 73.558 610.83429 2+ 2+ 1219.6448530687103 0 7.509456089406097 92.22520107238606 Doubtful
|
|
|
328 327 P36578 SNYNLPMHK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16356 (Experiment 1) 16356 38.788 395.170135 3+ 3+ 1182.4892946349703 0 -0.6065193245821036 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 100.0 Confident
|
|
|
329 328 Q9GZR7 VQHVIHYQVPR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15653 (Experiment 1) 15653 37.836 485.914246 3+ 3+ 1454.7183830530103 0 1.7325079819397964 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
330 329 Q16629 GHYAYDCHR Phosphorylation of Y(3) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6585 (Experiment 1) 6585 21.253 420.153564 3+ 3+ 1257.43865604444 0 0.16387274845295596 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 5: 0.0) Phosphorylation of Y (3: 2.4432809773123907) 0 Y3-{Y3 Y5} 1 100.0 Confident
|
|
|
331 330 P41091, Q2VIR3 HILILQNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20319 (Experiment 1) 20319 43.918 489.80896 2+ 2+ 977.6022004110903 0 1.1909303121301151 99.46091644204851 Confident
|
|
|
332 331 P62269 IPDWFLNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45126 (Experiment 1) 45126 76.855 530.782593 2+ 2+ 1059.5501648382303 0 0.4410735753794921 99.7340425531915 Confident
|
|
|
333 332 P62829 VHPAVVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13049 (Experiment 1) 13049 33.797 445.781921 2+ 2+ 889.5497709154101 0 -0.540453471658705 99.45799457994579 Confident
|
|
|
334 333 P63104 YLAEVAAGDDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14370 (Experiment 1) 14370 35.847 427.222168 3+ 3+ 1278.6455813447003 0 -0.7074730376363576 100.0 Confident
|
|
|
335 334 P62937, PPIA_HUMAN KITIADCGQLE Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27514 (Experiment 1) 27514 52.829 624.318909 2+ 2+ 1246.62273772514 0 0.4223334027290332 98.93048128342245 Confident
|
|
|
336 335 P09651, Q32P51 SSGPYGGGGQYFAK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24138 (Experiment 1) 24138 48.886 728.301697 2+ 2+ 1454.5867597467704 0 1.4288876353990476 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 9.688517651233688) Phosphorylation of Y (11: 99.82547993019197) 0 Y11-{Y5 Y11} 1 99.72826086956522 Confident
|
|
|
337 336 Q08211 GISHVIVDEIHER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26096 (Experiment 1) 26096 51.184 501.935944 3+ 3+ 1502.7841405061804 0 1.2366091122294092 100.0 Confident
|
|
|
338 337 P26038 EDAVLEYLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41151 (Experiment 1) 41151 69.401 540.285583 2+ 2+ 1078.5546410819802 0 1.8249496714478335 98.6449864498645 Confident
|
|
|
339 338 Q9UBQ7 GDVVNQDDLYQALASGK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41481 (Experiment 1) 41481 69.872 936.924011 2+ 2+ 1871.8302374692603 0 1.7245809962618321 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
340 339 P11310 IYQIYEGTSQIQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32570 (Experiment 1) 32570 58.71 839.896667 2+ 2+ 1677.7763514216003 0 1.446397149297357 Phosphorylation of Y (5: Random) Phosphorylation of Y (2: 0.0, 5: 0.0) Phosphorylation of Y (5: 82.16813727284932) 0 Y5-{Y2 Y5} 1 100.0 Confident
|
|
|
341 340 Q92945 DAFADAVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24075 (Experiment 1) 24075 48.805 496.743286 2+ 2+ 991.4723084403502 0 -0.29127106286590215 99.7340425531915 Confident
|
|
|
342 341 P62241 ADGYVLEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20095 (Experiment 1) 20095 43.664 476.242126 2+ 2+ 950.4709114580203 0 -1.2728715445594243 98.7146529562982 Confident
|
|
|
343 342 O60361, P15531, P22392 GDFCIQVGR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31040 (Experiment 1) 31040 56.933 526.253479 2+ 2+ 1050.49166398594 0 0.7041102692411855 99.45652173913044 Confident
|
|
|
344 343 Q15717 DANLYISGLPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42532 (Experiment 1) 42532 71.571 649.814209 2+ 2+ 1297.6067669153601 0 5.461707119847888 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82578397212544) Y5 1 0 100.0 Doubtful
|
|
|
345 344 O00267 TPHYGSQTPLHDGSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9736 (Experiment 1) 9736 28.1 578.252502 3+ 3+ 1731.7366118679402 0 -0.5391346448367605 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.38219895287958) Y4 1 0 99.24812030075188 Confident
|
|
|
346 345 Q99623 ESVFTVEGGHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20310 (Experiment 1) 20310 43.908 406.535217 3+ 3+ 1216.5836497944802 0 0.14086939322127368 99.24812030075188 Confident
|
|
|
347 346 P13639 VNFTVDQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32572 (Experiment 1) 32572 58.713 546.295532 2+ 2+ 1090.57710786206 0 -0.5462202446474956 100.0 Confident
|
|
|
348 347 Q9Y224 LTALDYHNPAGFNCKDETEFR Phosphorylation of Y(6) Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33349 (Experiment 1) 33349 59.597 860.040649 3+ 3+ 2577.099553100111 0 0.21878794419408057 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.38219895287958) Y6 1 0 97.74436090225565 Confident
|
|
|
349 348 P04406 VIPELNGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21831 (Experiment 1) 21831 46.0 435.258301 2+ 2+ 868.5018176634801 0 0.26582256673846166 99.45799457994579 Confident
|
|
|
350 349 P84090 ADTQTYQPYNK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11206 (Experiment 1) 11206 30.874 704.791077 2+ 2+ 1407.5707753294603 0 -2.251912687248272 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 9: 0.0) Phosphorylation of Y (6: 66.37895263549714) 0 Y6-{Y6 Y9} 1 96.24664879356568 Confident
|
|
|
351 350 P06733 IGAEVYHNLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18395 (Experiment 1) 18395 41.527 612.295105 2+ 2+ 1222.5747385110903 0 0.7500925346946685 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
352 351 Q00610 LLYNNVSNFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34652 (Experiment 1) 34652 61.116 648.839905 2+ 2+ 1295.66223446835 0 2.329237954458527 100.0 Confident
|
|
|
353 352 P07900, P08238, Q14568, Q58FF8 YIDQEELNK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19348 (Experiment 1) 19348 42.723 616.268066 2+ 2+ 1230.5169488514503 0 3.7566706561652405 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 99.65095986038395) Y1 1 0 99.45799457994579 Confident
|
|
|
354 353 Q14566 LGFSEYCR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27898 (Experiment 1) 27898 53.284 516.234192 2+ 2+ 1030.4542158480601 0 -0.37268118503464154 100.0 Confident
|
|
|
355 354 P23193 DTYVSSFPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28718 (Experiment 1) 28718 54.249 576.24176 2+ 2+ 1150.4696047362102 0 -0.5533003035755126 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
356 355 P0DME0, Q01105 EFHLNESGDPSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18409 (Experiment 1) 18409 41.549 482.888275 3+ 3+ 1445.64228686941 0 0.48923014387617275 97.74436090225565 Confident
|
|
|
357 356 P23743 RPHGDIYGINQALGATAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27434 (Experiment 1) 27434 52.735 654.659424 3+ 3+ 1960.9520243677905 0 2.249638794708066 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
358 357 P07900, P08238, Q58FF6, Q58FF7 VILHLKEDQTEYLEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29169 (Experiment 1) 29169 54.771 504.516266 4+ 4+ 2014.0371202832105 0 -0.5758733006780193 88.23529411764706 Doubtful
|
|
|
359 358 P25705 LTDADAMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11739 (Experiment 1) 11739 31.691 432.710999 2+ 2+ 863.4058686733104 0 1.8215343969283837 99.45652173913044 Confident
|
|
|
360 359 O76094 ELYGQVLYR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33600 (Experiment 1) 33600 59.886 610.789856 2+ 2+ 1219.5638394742202 0 1.080235344532531 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 16.720558547877676) Phosphorylation of Y (3: 99.82547993019197) 0 Y3-{Y3 Y8} 1 99.73614775725594 Confident
|
|
|
361 360 P00519 LGGGQYGEVYEGVWKK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33160 (Experiment 1) 33160 59.38 617.289734 3+ 3+ 1848.8447653345906 0 1.407911876932177 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 17.367359723167326) Phosphorylation of Y (10: 3.4904013961605584) 0 Y10-{Y6 Y10} 1 100.0 Confident
|
|
|
362 361 Q13422 SGLIYLTNHIAPHAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35517 (Experiment 1) 35517 62.117 581.963562 3+ 3+ 1741.8665038386803 1 -0.574292862801945 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.95287958115183) Y5 1 0 100.0 Confident
|
|
|
363 362 P62753 DIPGLTDTTVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36755 (Experiment 1) 36755 63.633 642.843689 2+ 2+ 1283.6721304457103 0 0.5402721165322206 100.0 Confident
|
|
|
364 363 P62906 KYDAFLASESLIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39390 (Experiment 1) 39390 66.886 495.605377 3+ 3+ 1483.7922455783903 0 1.3828367704099551 100.0 Confident
|
|
|
365 364 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13718 (Experiment 1) 13718 34.822 601.28833 2+ 2+ 1199.5587540937802 1 -0.001552301849927169 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
366 365 P50914 ALVDGPCTQVR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21014 (Experiment 1) 21014 44.74 608.310852 2+ 2+ 1214.60775636734 0 -0.4975257807006744 100.0 Confident
|
|
|
367 366 P12004 SEGFDTYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18406 (Experiment 1) 18406 41.545 527.697327 2+ 2+ 1053.3804553786404 0 -0.33571531206026256 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.33507853403141) Y7 1 0 99.19354838709677 Confident
|
|
|
368 367 P61247 NCLTNFHGMDLTR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34135 (Experiment 1) 34135 60.517 526.909912 3+ 3+ 1577.7078814147699 0 0.015932384805531934 100.0 Confident
|
|
|
369 368 Q53FD0 ELILDKVYTHPK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36276 (Experiment 1) 36276 63.071 768.390015 2+ 2+ 1534.7796458968903 0 -9.219731910327269 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 97.55671902268762) Y8 1 0 97.55434782608695 Doubtful
|
|
|
370 369 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27770 (Experiment 1) 27770 53.138 565.21521 2+ 2+ 1128.4165065341901 0 -0.565684929677775 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 20.308660229654866) Phosphorylation of Y (2: 99.83844911147011) 0 Y2-{Y2 Y6} 1 100.0 Confident
|
|
|
371 370 P08238 KHLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24556 (Experiment 1) 24556 49.394 478.516693 4+ 4+ 1910.0373950667304 0 0.14161787029687875 100.0 Doubtful
|
|
|
372 371 P31946 YLIPNATQPESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26696 (Experiment 1) 26696 51.873 680.859253 2+ 2+ 1359.7034305739905 0 0.3837008775473079 100.0 Confident
|
|
|
373 372 P50991 IDDVVNTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15493 (Experiment 1) 15493 37.603 466.243744 2+ 2+ 930.4770594676202 0 -4.4229901794802515 99.7289972899729 Doubtful
|
|
|
374 373 P62241 QWYESHYALPLGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39702 (Experiment 1) 39702 67.325 567.259399 3+ 3+ 1698.7555564073702 0 0.47667350647745427 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 9.990620534539762) Phosphorylation of Y (7: 0.1743680488412962) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
375 374 P37840, Q16143 EGVLYVGSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26844 (Experiment 1) 26844 52.044 516.243713 2+ 2+ 1030.4736274874904 0 -0.7306825675226457 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.54604200323102) Y5 1 0 99.45799457994579 Confident
|
|
|
376 375 P60709, P62736, P63261, P63267, P68032, P68133 DSYVGDEAQSKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10114 (Experiment 1) 10114 28.844 452.216064 3+ 3+ 1353.6160721215704 0 7.585279743509487 100.0 Doubtful
|
|
|
377 376 P35237, P50452 TGTQYLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24394 (Experiment 1) 24394 49.203 476.265564 2+ 2+ 950.51853035678 0 -2.0527270268073337 98.64864864864865 Confident
|
|
|
378 377 P61106 IYQNIQDGSLDLNAAESGVQHKPSAPQGGR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30409 (Experiment 1) 30409 56.202 808.387268 4+ 4+ 3229.5153326405107 0 1.4329452799993259 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Doubtful
|
|
|
379 378 P22626 GGGGNFGPGPGSNFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24077 (Experiment 1) 24077 48.807 689.31897 2+ 2+ 1376.6221605615199 0 0.8896505105684462 100.0 Confident
|
|
|
380 379 P09651 SSGPYGGGGQYFAKPR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20312 (Experiment 1) 20312 43.91 570.254333 3+ 3+ 1707.7406346192204 0 0.31271456729062 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 8.490395398958714) Phosphorylation of Y (5: 0.0) 0 Y5-{Y5 Y11} 1 100.0 Confident
|
|
|
381 380 P62249 GGGHVAQIYAIR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22215 (Experiment 1) 22215 46.502 441.218262 3+ 3+ 1320.6339847227102 0 -0.7767299741904657 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 94.4153577661431) Y9 1 0 97.9020979020979 Confident
|
|
|
382 381 P50990 TVGATALPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17206 (Experiment 1) 17206 39.876 443.261536 2+ 2+ 884.50796567308 0 0.6242292603335033 100.0 Confident
|
|
|
383 382 Q96SB3 ETQAQYQALER Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16431 (Experiment 1) 16431 38.876 708.812134 2+ 2+ 1415.6082234673404 0 1.052183317254671 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.38219895287958) Y6 1 0 97.289972899729 Confident
|
|
|
384 383 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26846 (Experiment 1) 26846 52.046 523.252441 2+ 2+ 1044.4892775516303 0 1.0047882433962936 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
385 384 P78527 DILETHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25331 (Experiment 1) 25331 50.292 498.777618 2+ 2+ 995.5399940773502 0 0.690678046582456 93.78378378378378 Confident
|
|
|
386 385 P11142 MVNHFIAEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32571 (Experiment 1) 32571 58.712 618.320007 2+ 2+ 1234.6168644990605 0 6.951600286247587 100.0 Doubtful
|
|
|
387 386 P15954 SHYEEGPGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5244 (Experiment 1) 5244 18.627 542.210938 2+ 2+ 1082.4070044796501 0 0.2937849433620993 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 99.73684210526315 Confident
|
|
|
388 387 P42768 LYGLQAGR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21346 (Experiment 1) 21346 45.221 479.230988 2+ 2+ 956.44808144599 0 -0.6869121343995315 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 97.5767366720517) Y2 1 0 98.91598915989161 Confident
|
|
|
389 388 Q9BZZ5 PTVEELYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25661 (Experiment 1) 25661 50.684 543.746582 2+ 2+ 1085.4794411439202 0 -0.7632939114139082 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
390 389 O75179 EHYPVSSPSSPSPPAQPGGVSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20918 (Experiment 1) 20918 44.612 767.351196 3+ 3+ 2299.02703978285 0 2.049833423143654 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.50959860383944) Y3 1 0 97.8102189781022 Confident
|
|
|
391 390 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34387 (Experiment 1) 34387 60.812 630.796692 2+ 2+ 1259.5798834611805 0 -0.8341783811929855 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
392 391 P08574 GLLSSLDHTSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34570 (Experiment 1) 34570 61.024 433.572937 3+ 3+ 1297.6990138998904 0 -1.56244157748781 98.49624060150376 Confident
|
|
|
393 392 P05141, P12236 QIFLGGVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31244 (Experiment 1) 31244 57.171 488.776733 2+ 2+ 975.5389314481902 0 -0.01880389607646082 99.72826086956522 Confident
|
|
|
394 393 P28906 LGILDFTEQDVASHQSYSQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43419 (Experiment 1) 43419 73.148 756.040161 3+ 3+ 2265.0913406840405 0 3.224228675981349 91.72932330827068 Doubtful
|
|
|
395 394 P47914 AQAAAPASVPAQAPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14807 (Experiment 1) 14807 36.496 689.377991 2+ 2+ 1376.7412130650405 0 0.15666395789724288 100.0 Confident
|
|
|
396 395 P16949 SKESVPEFPLSPPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32834 (Experiment 1) 32834 59.008 514.612122 3+ 3+ 1540.8137092989602 0 0.5358735325981945 100.0 Confident
|
|
|
397 396 Q02790 VGEVCHITCKPEYAYGSAGSPPK Phosphorylation of Y(13) Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20713 (Experiment 1) 20713 44.373 863.052185 3+ 3+ 2586.1284107002402 0 2.438985280054955 Phosphorylation of Y (13: Random) Phosphorylation of Y (13: 0.0, 15: 0.0) Phosphorylation of Y (13: 81.57699630212718) 0 Y13-{Y13 Y15} 1 92.53731343283582 Doubtful
|
|
|
398 397 Q16658 YSVQTADHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8821 (Experiment 1) 8821 26.285 538.760071 2+ 2+ 1075.5046711977902 0 0.8518349976003444 95.13513513513514 Confident
|
|
|
399 398 O43175 AGTGVDNVDLEAATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27773 (Experiment 1) 27773 53.143 744.869507 2+ 2+ 1487.72159981927 0 1.9206401754409599 100.0 Confident
|
|
|
400 399 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 KESYSIYVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27512 (Experiment 1) 27512 52.826 680.31427 2+ 2+ 1358.6159346167303 0 -1.4313587504936467 Phosphorylation of Y (7: Random) Phosphorylation of Y (7: 0.0, 9: 0.0) Phosphorylation of Y (7: 0.16155088852988692) 0 Y7-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
401 400 A5A3E0, P0CG38, P0CG39, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3 AGFAGDDAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14791 (Experiment 1) 14791 36.474 488.727631 2+ 2+ 975.4410083120702 0 -0.3061476204007756 100.0 Confident
|
|
|
402 401 P26583 IKSEHPGLSIGDTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14454 (Experiment 1) 14454 35.987 518.282288 3+ 3+ 1551.8256709649902 0 -0.40927835441564636 100.0 Confident
|
|
|
403 402 P55084 NVVVVDGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21680 (Experiment 1) 21680 45.786 478.78006 2+ 2+ 955.54507945779 0 0.5092200731097135 92.48704663212435 Confident
|
|
|
404 403 P23458 ERFYESRCR Phosphorylation of Y(4) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40630 (Experiment 1) 40630 68.651 692.28656 2+ 2+ 1381.55983380628 1 -3.3403174766381385 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 93.89179755671903) Y4 1 0 92.99191374663073 Confident
|
|
|
405 404 P0DMV8, P17066 IINEPTAAAIAYGLDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43480 (Experiment 1) 43480 73.233 844.455627 2+ 2+ 1686.8940848779803 0 1.5490408048758448 100.0 Confident
|
|
|
406 405 P13639 KEDLYLKPIQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22948 (Experiment 1) 22948 47.381 741.889465 2+ 2+ 1481.7643301859202 0 0.031595311194961805 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
407 406 O14979 DLTEYLSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38889 (Experiment 1) 38889 66.221 538.737549 2+ 2+ 1075.4587056993403 0 1.7071115415024662 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
408 407 Q9BTY7 LLPFLAPGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44222 (Experiment 1) 44222 74.641 527.824402 2+ 2+ 1053.63350053937 0 0.710963282934779 99.47780678851174 Confident
|
|
|
409 408 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27308 (Experiment 1) 27308 52.583 523.252136 2+ 2+ 1044.4892775516303 0 0.4218950113966914 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
410 409 P68104, Q5VTE0 YYVTIIDAPGHR Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34651 (Experiment 1) 34651 61.115 742.8479 2+ 2+ 1483.68607986522 0 -3.2528752681395665 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.0) 0 Y1-{Y1 Y2} 1 100.0 Confident
|
|
|
411 410 P43246 DIYQDLNR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24478 (Experiment 1) 24478 49.303 558.739197 2+ 2+ 1115.4648537089402 0 -0.9061845420147633 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 99.74358974358975 Confident
|
|
|
412 411 Q92598 AGGIETIANEFSDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42535 (Experiment 1) 42535 71.574 740.356445 2+ 2+ 1478.7001360987 0 -1.2149756719295102 100.0 Confident
|
|
|
413 412 P62158 DTDSEEEIREAFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33341 (Experiment 1) 33341 59.587 532.908447 3+ 3+ 1595.7063436779504 0 -1.7714571082072883 96.99248120300751 Confident
|
|
|
414 413 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44590 (Experiment 1) 44590 75.64 625.278748 2+ 2+ 1248.5427696764702 0 0.13865010613878317 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
415 414 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44141 (Experiment 1) 44141 74.436 935.933594 2+ 2+ 1869.85097291384 0 0.887965782182974 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
416 415 P02786 LLNENSYVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26924 (Experiment 1) 26924 52.137 602.821594 2+ 2+ 1203.6247863304702 0 3.1922779726133954 99.7289972899729 Confident
|
|
|
417 416 Q9HB71 KAELLDNEKPAAVVAPITTGYTVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34313 (Experiment 1) 34313 60.723 632.855835 4+ 4+ 2527.3897545318605 0 1.7696008199682143 100.0 Doubtful
|
|
|
418 417 Q8N163 VVTQNICQYR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20509 (Experiment 1) 20509 44.14 640.824646 2+ 2+ 1279.63430546835 0 0.3383126533062779 99.73474801061008 Confident
|
|
|
419 418 P01911, P01912, P04440, P20039, Q5Y7A7, Q95IE3 FDSDVGEFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29042 (Experiment 1) 29042 54.626 536.241028 2+ 2+ 1070.4668887067403 0 0.5728394093980367 100.0 Confident
|
|
|
420 419 P17844, Q92841 STCIYGGAPK Phosphorylation of Y(5) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13367 (Experiment 1) 13367 34.264 567.238647 2+ 2+ 1132.4624111807902 0 0.2907820926098347 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.30191972076788) Y5 1 0 99.74811083123426 Confident
|
|
|
421 420 P22626 RGFGFVTFDDHDPVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37218 (Experiment 1) 37218 64.186 617.960449 3+ 3+ 1850.8587619984203 0 0.4075781079734149 99.26470588235294 Confident
|
|
|
422 421 P35579 ALEEAMEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16436 (Experiment 1) 16436 38.882 524.752991 2+ 2+ 1047.4906609264303 0 0.7319067454616576 96.19565217391303 Confident
|
|
|
423 422 P12004 SEGFDTYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18632 (Experiment 1) 18632 41.84 527.698853 2+ 2+ 1053.3804553786404 0 2.5560929454998647 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
424 423 P49736 AGIVTSLQAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25062 (Experiment 1) 25062 49.981 508.298431 2+ 2+ 1014.5821932425001 0 0.1139329595339632 97.5609756097561 Confident
|
|
|
425 424 P07900 NPDDITNEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35643 (Experiment 1) 35643 62.266 957.377869 2+ 2+ 1912.7404194053506 0 0.399874154322035 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 7.166341886207292) Phosphorylation of Y (10: 0.9693053311793215) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
426 425 P13051 TLYSFFSPSPAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45624 (Experiment 1) 45624 77.949 726.832581 2+ 2+ 1451.6486317273402 0 1.3602456583564408 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
427 426 P21964 GSSCFECTHYQSFLEYR Phosphorylation of Y(16) Carbamidomethylation of C(4, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38885 (Experiment 1) 38885 66.217 750.960022 3+ 3+ 2249.8547550482804 0 1.5453803850170094 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 4.690677236065243) Phosphorylation of Y (10: 96.50959860383944) 0 Y16-{Y10 Y16} 1 97.74436090225565 Confident
|
|
|
428 427 Q96GX9 HGDEIYIAPSGVQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25257 (Experiment 1) 25257 50.206 797.369263 2+ 2+ 1592.7235875727504 0 0.2417284792910565 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
429 428 P27797 IDDPTDSKPEDWDKPEHIPDPDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27309 (Experiment 1) 27309 52.586 690.822449 4+ 4+ 2759.256233732661 0 1.612718030623517 100.0 Doubtful
|
|
|
430 429 Q6UXV4 KVYATSQQIFGAVK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31725 (Experiment 1) 31725 57.739 540.610168 3+ 3+ 1618.8120086543306 0 -2.055731412400343 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.42931937172776) Y3 1 0 99.24812030075188 Confident
|
|
|
431 430 Q04837 DVAYQYVK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23363 (Experiment 1) 23363 47.892 533.236755 2+ 2+ 1064.4579774233503 0 0.9185825211102518 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 7.442311830823952) Phosphorylation of Y (6: 2.9668411867364743) 0 Y6-{Y4 Y6} 1 99.45652173913044 Confident
|
|
|
432 431 P62917 ASGNYATVISHNPETK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17817 (Experiment 1) 17817 40.706 590.268311 3+ 3+ 1767.7828933540202 0 0.1187288136508116 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
433 432 P13639 CLYASVLTAQPR Phosphorylation of Y(3) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35972 (Experiment 1) 35972 62.677 729.846741 2+ 2+ 1457.6738009293601 0 3.5131725220977543 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
434 433 P36578 KLDELYGTWR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33879 (Experiment 1) 33879 60.205 454.21524 3+ 3+ 1359.6224169795003 0 1.0814415190533426 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
435 434 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35496 (Experiment 1) 35496 62.093 616.267944 2+ 2+ 1230.5209716027305 0 0.2948910098438913 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 8: 0.0) Phosphorylation of Y (6: 3.664921465968586) 0 Y6-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
436 435 O75368 IGFEEKDIAANEENRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20318 (Experiment 1) 20318 43.917 621.647217 3+ 3+ 1861.9170051505305 0 1.5102098692588553 100.0 Confident
|
|
|
437 436 O00571, O15523, P17844 TIVFVETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29045 (Experiment 1) 29045 54.629 468.774597 2+ 2+ 935.5327834385903 0 1.981369594671177 99.7289972899729 Confident
|
|
|
438 437 P61353 NIDDGTSDRPYSHALVAGIDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28499 (Experiment 1) 28499 53.994 568.780029 4+ 4+ 2271.0879866391006 0 1.3289397988162528 100.0 Doubtful
|
|
|
439 438 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37948 (Experiment 1) 37948 65.069 952.980042 2+ 2+ 1903.9444793758603 0 0.551790724667021 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
440 439 P36578 NIPGITLLNVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44467 (Experiment 1) 44467 75.325 634.882324 2+ 2+ 1267.7499868435902 0 0.0852305937785191 100.0 Confident
|
|
|
441 440 P62899 SAINEVVTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19747 (Experiment 1) 19747 43.222 494.775269 2+ 2+ 987.5349086969104 0 1.087736901864986 99.74811083123426 Confident
|
|
|
442 441 Q6PI48 FYSLPQSPQQFK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37010 (Experiment 1) 37010 63.941 775.360352 2+ 2+ 1548.7013955761904 0 3.0666416954609446 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.06138933764136) Y2 1 0 99.45799457994579 Confident
|
|
|
443 442 P61604 VLLPEYGGTK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28024 (Experiment 1) 28024 53.427 578.786377 2+ 2+ 1155.5576914646201 0 0.44023321933665654 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
444 443 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30058 (Experiment 1) 30058 55.797 452.23053 3+ 3+ 1353.6693671719202 0 0.28999056297061243 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.90575916230367) Y4 1 0 97.77777777777777 Confident
|
|
|
445 444 P15311, P26038, P35241 QLFDQVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32316 (Experiment 1) 32316 58.415 488.776489 2+ 2+ 975.5389314481904 0 -0.5180093185201874 99.7289972899729 Confident
|
|
|
446 445 P11142 SQIHDIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27431 (Experiment 1) 27431 52.732 741.407776 2+ 2+ 1480.79979057032 0 0.8150015955256751 100.0 Confident
|
|
|
447 446 Q12906 AYAALAALEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35768 (Experiment 1) 35768 62.427 510.789063 2+ 2+ 1019.5651461960304 0 -1.5398990951128015 100.0 Confident
|
|
|
448 447 P16949, Q93045 DLSLEEIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33805 (Experiment 1) 33805 60.12 537.787415 2+ 2+ 1073.5604547384103 0 -0.16518795354072396 100.0 Confident
|
|
|
449 448 P11586 GVPTGFILPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46009 (Experiment 1) 46009 78.762 585.35675 2+ 2+ 1168.69682907192 0 1.8091516734051876 100.0 Confident
|
|
|
450 449 P62851 DKLNNLVLFDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38881 (Experiment 1) 38881 66.213 440.250061 3+ 3+ 1317.7292513990103 0 -0.6797643093831126 100.0 Confident
|
|
|
451 450 Q8TEM1 AVDPTSGQLYGLAR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34656 (Experiment 1) 34656 61.12 764.366028 2+ 2+ 1526.71302288905 0 2.9306577553037303 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
452 451 P50991 VIDPATATSVDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32835 (Experiment 1) 32835 59.011 679.371399 2+ 2+ 1356.72489429456 0 2.4660885666041406 100.0 Confident
|
|
|
453 452 Q15233 FACHSASLTVR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16164 (Experiment 1) 16164 38.55 416.877319 3+ 3+ 1247.60809072051 0 1.6286824912596582 99.24812030075188 Confident
|
|
|
454 453 P09496 LEALDANSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17068 (Experiment 1) 17068 39.688 494.756775 2+ 2+ 987.4985231881903 0 0.4789003775486571 98.7012987012987 Confident
|
|
|
455 454 P61247 TSYAQHQQVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5328 (Experiment 1) 5328 18.823 433.194702 3+ 3+ 1296.5612137052703 0 0.8178733165715791 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
456 455 ALDOA_RABIT, P04075 ALSDHHIYLEGTLLKPNMVTPGHACTQK Phosphorylation of Y(8) Carbamidomethylation of C(25) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34860 (Experiment 1) 34860 61.358 643.115112 5+ 5+ 3210.5355401332404 0 1.1312241763141746 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Doubtful
|
|
|
457 456 Q9BXJ9 MVYYLDPSSQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34056 (Experiment 1) 34056 60.422 705.804199 2+ 2+ 1409.5938192731603 0 0.018272217801473253 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (4: 0.0) 0 Y3-{Y3 Y4} 1 96.19565217391303 Confident
|
|
|
458 457 Q15052 VIEAYCTSANFQQGHGSSTR Phosphorylation of Y(5) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20234 (Experiment 1) 20234 43.823 764.994568 3+ 3+ 2291.9630596273005 0 -0.5163553548825212 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
459 458 P08238 YHTSQSGDEMTSLSEYVSR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32501 (Experiment 1) 32501 58.63 752.974792 3+ 3+ 2255.9042073385003 0 -0.7351896031492223 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 39.46515752045704) Phosphorylation of Y (16: 100.0) 0 Y16-{Y1 Y16} 1 100.0 Confident
|
|
|
460 459 P62805 TVTAMDVVYALKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46538 (Experiment 1) 46538 79.632 516.261963 3+ 3+ 1545.7626159337606 0 0.9321282944083704 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
461 460 O75564 GDPGEGEEVAWEQAAVAFDAVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.13 min, Period: 1, Cycle(s): 1866 (Experiment 1) 1866 7.735 806.390015 2+ 3+ 2415.134268125181 1 4.380460216636593 100.0 Doubtful
|
|
|
462 461 Q12906 VLGMDPLPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33796 (Experiment 1) 33796 60.109 528.791992 2+ 2+ 1055.56851732431 0 0.8639908217153958 100.0 Confident
|
|
|
463 462 Q9NSD9 AAGASDVVLYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24660 (Experiment 1) 24660 49.512 587.282471 2+ 2+ 1172.5478550569103 0 2.1574072593299425 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.03069466882067) Y10 1 0 99.74489795918367 Confident
|
|
|
464 463 Q13347 GHFGPINSVAFHPDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28147 (Experiment 1) 28147 53.577 560.614624 3+ 3+ 1678.8215886440603 0 0.2699154385525216 100.0 Confident
|
|
|
465 464 P27635, Q96L21 EHVIEALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16832 (Experiment 1) 16832 39.372 483.771576 2+ 2+ 965.5294293936502 0 -0.8581803920879082 99.73474801061008 Confident
|
|
|
466 465 P62249 TLLVADPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24951 (Experiment 1) 24951 49.85 442.76239 2+ 2+ 883.51271670035 0 -2.8114707014795384 96.7479674796748 Confident
|
|
|
467 466 P19338 GIAYIEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38206 (Experiment 1) 38206 65.387 470.760315 2+ 2+ 939.5065686907503 0 -0.5221596870971656 99.73753280839895 Confident
|
|
|
468 467 P61247 APAMFNIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34058 (Experiment 1) 34058 60.424 460.244843 2+ 2+ 918.4745573698201 0 0.625424624300242 99.74811083123426 Confident
|
|
|
469 468 P11142 RFDDAVVQSDMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22190 (Experiment 1) 22190 46.471 470.894012 3+ 3+ 1409.6609141390104 0 -0.5008480847537458 100.0 Confident
|
|
|
470 469 P40926 SQETECTYFSTPLLLGKK Phosphorylation of Y(8) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42275 (Experiment 1) 42275 71.158 728.344299 3+ 3+ 2181.0064875790704 1 0.5609738133655694 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
471 470 Q07955 TKDIEDVFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30530 (Experiment 1) 30530 56.34 419.883331 3+ 3+ 1256.6288686514004 0 -0.5597201172030698 97.74436090225565 Confident
|
|
|
472 471 P60174 IIYGGSVTGATCK Phosphorylation of Y(3) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20494 (Experiment 1) 20494 44.123 703.824829 2+ 2+ 1405.63126741104 0 2.7262932766630508 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
473 472 Q8NBX0 SAIYGFGDQSNLRK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26322 (Experiment 1) 26322 51.445 818.376892 2+ 2+ 1634.7453856464901 0 -3.7602216239709865 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
474 473 Q9H910 TSDIFGSPVTATSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33080 (Experiment 1) 33080 59.287 719.862366 2+ 2+ 1437.7099725064104 0 0.14347186681438748 90.29649595687331 Doubtful
|
|
|
475 474 P61019, Q8WUD1 LQIWDTAGQESFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41753 (Experiment 1) 41753 70.303 775.884583 5+ 2+ 1549.7525060247303 0 1.357833724717046 99.73684210526315 Confident
|
|
|
476 475 P62241 LLACIASRPGQCGR Carbamidomethylation of C(4, 12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20230 (Experiment 1) 20230 43.819 520.269592 3+ 3+ 1557.7868004418099 0 0.09364232828272975 100.0 Confident
|
|
|
477 476 P78527 YFEGVSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21081 (Experiment 1) 21081 44.83 463.733276 2+ 2+ 925.4545331178902 0 -2.73222207855772 99.19137466307278 Confident
|
|
|
478 477 Q15717 SLFSSIGEVESAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42639 (Experiment 1) 42639 71.777 677.349976 2+ 2+ 1352.6823607762406 0 2.2427822079526276 99.73262032085562 Confident
|
|
|
479 478 P05204 LSAKPAPPKPEPKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6512 (Experiment 1) 6512 21.095 396.992096 4+ 4+ 1583.9399128715904 0 -0.39971739434513787 100.0 Doubtful
|
|
|
480 479 P49411 ILAEGGGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8722 (Experiment 1) 8722 26.045 408.234833 2+ 2+ 814.4548674710602 0 0.3008016095988919 91.42091152815013 Confident
|
|
|
481 480 P00492 DLNHVCVISETGK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23884 (Experiment 1) 23884 48.568 491.245636 3+ 3+ 1470.7136779878604 0 0.9503820031825181 92.61744966442953 Doubtful
|
|
|
482 481 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10181 (Experiment 1) 10181 28.999 405.50766 3+ 3+ 1213.5016331404804 0 -0.39665565963341237 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
483 482 Q92598 RGPFELEAFYSDPQGVPYPEAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46268 (Experiment 1) 46268 79.219 859.729431 3+ 3+ 2576.1624706265006 0 1.5481534464789615 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 15.99213183977579) Phosphorylation of Y (10: 88.64963792265893) 0 Y10-{Y10 Y18} 1 100.0 Confident
|
|
|
484 483 P60842 ATQALVLAPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26652 (Experiment 1) 26652 51.821 570.840942 2+ 2+ 1139.6662572196303 0 0.9405840372039045 100.0 Confident
|
|
|
485 484 O14950, P19105, P24844 EAFNMIDQNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29565 (Experiment 1) 29565 55.225 619.285583 2+ 2+ 1236.5557207944803 0 0.7204047395900818 100.0 Confident
|
|
|
486 485 Q7L5N7 IGIEEFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33463 (Experiment 1) 33463 59.728 453.749969 2+ 2+ 905.4858332461704 0 -0.49386182208512186 98.69109947643979 Confident
|
|
|
487 486 P07858 HYGYNSYSVSNSEK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16681 (Experiment 1) 16681 39.182 572.227234 3+ 3+ 1713.6671948954406 0 -4.265359522381006 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 4: 0.0) Phosphorylation of Y (2: 0.0) 0 Y2-{Y2 Y4 Y7} 1 100.0 Doubtful
|
|
|
488 487 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13635 (Experiment 1) 13635 34.699 600.786743 2+ 2+ 1199.5587540937802 0 0.14894854490373122 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
489 488 P49354 NYQVWHHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10957 (Experiment 1) 10957 30.42 407.176971 3+ 3+ 1218.5083902867702 0 0.5675772752409471 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.60383944153578) Y2 1 0 96.71052631578947 Confident
|
|
|
490 489 P22626 NYYEQWGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26929 (Experiment 1) 26929 52.142 584.228943 2+ 2+ 1166.4433899883702 0 -0.0487154841755345 Phosphorylation of Y (3: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (3: 5.5846422338568935) 0 Y3-{Y2 Y3} 1 100.0 Confident
|
|
|
491 490 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30532 (Experiment 1) 30532 56.343 609.260071 2+ 2+ 1216.5053215385904 0 0.21955143382241052 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 6.436646792675202) Phosphorylation of Y (6: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
492 491 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33793 (Experiment 1) 33793 60.105 977.536194 2+ 2+ 1953.0571274518006 0 0.36193791888834415 100.0 Confident
|
|
|
493 492 P25789 LLDEVFFSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45120 (Experiment 1) 45120 76.837 613.817383 2+ 2+ 1225.6230549949705 0 -2.314957261334867 99.73262032085562 Confident
|
|
|
494 493 P16333 ETVYCIGQR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18969 (Experiment 1) 18969 42.255 603.255798 2+ 2+ 1204.49477393823 0 1.880738171920887 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
495 494 P07339 LSPEDYTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30050 (Experiment 1) 30050 55.787 533.276917 2+ 2+ 1064.5389910178403 0 0.2719493430351848 93.6 Confident
|
|
|
496 495 P67936 IQALQQQADEAEDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20490 (Experiment 1) 20490 44.119 807.886414 2+ 2+ 1613.7645272604104 0 -3.8694609376525033 100.0 Confident
|
|
|
497 496 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39142 (Experiment 1) 39142 66.54 621.324097 3+ 3+ 1860.9498991094704 0 0.30176964868485207 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.50959860383944) Y5 1 0 97.74436090225565 Confident
|
|
|
498 497 P55209 KYAVLYQPLFDKR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35765 (Experiment 1) 35765 62.424 574.298523 3+ 3+ 1719.8749432640602 0 -0.6986283305951987 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 22.355510347592308) Phosphorylation of Y (2: 3.315881326352531) 0 Y2-{Y2 Y6} 1 100.0 Confident
|
|
|
499 498 Q13404 YPEAPPFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33460 (Experiment 1) 33460 59.725 538.282227 2+ 2+ 1074.5498304850603 0 0.06556162987293812 98.73737373737373 Confident
|
|
|
500 499 P11586 AAEEIGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16830 (Experiment 1) 16830 39.37 415.734985 2+ 2+ 829.4545331178902 0 1.0631164775092035 97.289972899729 Confident
|
|
|
501 500 P25685, Q9UDY4 VSLEEIYSGCTK Phosphorylation of Y(7) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32503 (Experiment 1) 32503 58.634 733.314087 2+ 2+ 1464.6207622969903 0 -4.869124955822071 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Doubtful
|
|
|
502 501 Q9NR30 AAVIGDVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29839 (Experiment 1) 29839 55.541 457.278992 2+ 2+ 912.5392658013602 0 4.554423075572348 100.0 Confident
|
|
|
503 502 P04406 VPTANVSVVDLTCR Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36357 (Experiment 1) 36357 63.167 765.901367 2+ 2+ 1529.7871772812903 0 0.6552970047535274 100.0 Confident
|
|
|
504 503 O75347 RLEAAYLDLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30531 (Experiment 1) 30531 56.342 449.917358 3+ 3+ 1346.7306483813402 0 -0.29915246153063846 100.0 Confident
|
|
|
505 504 P15311, P26038, P35241 KAPDFVFYAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36027 (Experiment 1) 36027 62.748 437.568054 3+ 3+ 1309.6819072837702 0 0.3239998348158699 100.0 Confident
|
|
|
506 505 P15311, P26038, P35241 NISFNDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11069 (Experiment 1) 11069 30.622 483.255768 2+ 2+ 964.4977949122003 0 -0.8399746015484002 96.4769647696477 Confident
|
|
|
507 506 Q12768 DYAQLGPR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19345 (Experiment 1) 19345 42.719 500.219482 2+ 2+ 998.4222606209701 0 2.1495064725103514 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 99.73474801061008 Confident
|
|
|
508 507 Q13185 KVEEAEPEEFVVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26192 (Experiment 1) 26192 51.295 554.614258 3+ 3+ 1660.8195825250407 0 0.8186324209120367 100.0 Confident
|
|
|
509 508 P10696 VQHASPAGAYAHTVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10684 (Experiment 1) 10684 29.92 560.285278 3+ 3+ 1677.8335503100907 0 0.2702727901316677 100.0 Confident
|
|
|
510 509 P78371 EALLSSAVDHGSDEVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25985 (Experiment 1) 25985 51.053 552.940674 3+ 3+ 1655.8002440627906 0 -0.031023958337215045 100.0 Confident
|
|
|
511 510 Q5JTH9 VLDPASSDFTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27687 (Experiment 1) 27687 53.038 604.302551 2+ 2+ 1206.58806646858 0 2.054105920241502 99.46091644204851 Confident
|
|
|
512 511 P60842, Q14240 GYDVIAQAQSGTGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23814 (Experiment 1) 23814 48.475 737.836914 2+ 2+ 1473.6500882793205 0 6.225524959241597 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Doubtful
|
|
|
513 512 P46940 LQQTYAALNSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17529 (Experiment 1) 17529 40.33 658.815674 2+ 2+ 1315.6173315990602 0 -0.40719467308143686 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
514 513 P33991 DYIAYAHSTIMPR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33481 (Experiment 1) 33481 59.749 809.360413 2+ 2+ 1616.7058293336302 0 0.2741256306777139 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 9.197281465312287) Phosphorylation of Y (2: 15.095986038394415) 0 Y2-{Y2 Y5} 1 99.5049504950495 Confident
|
|
|
515 514 P06576 AHGGYSVFAGVGER Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28908 (Experiment 1) 28908 54.472 496.220764 3+ 3+ 1485.6401923019605 0 0.1815708330669709 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
516 515 P18583 KKEADSVYGEWVPVEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28800 (Experiment 1) 28800 54.349 648.646301 3+ 3+ 1942.9077595139706 0 4.7864453299372585 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.65095986038395) Y8 1 0 99.37888198757764 Doubtful
|
|
|
517 516 O00571, O15523 DREEALHQFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14689 (Experiment 1) 14689 36.328 434.218567 3+ 3+ 1299.6319969692304 0 1.4390855771814468 97.74436090225565 Confident
|
|
|
518 517 P04083 DITSDTSGDFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25149 (Experiment 1) 25149 50.082 607.269592 2+ 2+ 1212.5258601348403 0 -1.0119617686074867 100.0 Confident
|
|
|
519 518 Q9UMS4 TVPEELVKPEELSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29085 (Experiment 1) 29085 54.675 533.294067 3+ 3+ 1596.8610534142006 0 -0.42616534225523844 99.37888198757764 Confident
|
|
|
520 519 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27856 (Experiment 1) 27856 53.236 609.259521 2+ 2+ 1216.5053215385904 0 -0.6831831240813536 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 33.54964448179688) Phosphorylation of Y (3: 0.34904013961605584) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
521 520 Q13263 KLIYFQLHR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33444 (Experiment 1) 33444 59.704 649.343384 2+ 2+ 1296.6743929827103 0 -1.6770115286280958 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 84.99127399650959) Y4 1 0 92.99191374663073 Confident
|
|
|
522 521 P78527 YNFPVEVEVPMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44926 (Experiment 1) 44926 76.403 804.890259 2+ 2+ 1607.7653792075505 0 0.3639372150759687 92.11956521739131 Confident
|
|
|
523 522 P49207 AFLIEEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29385 (Experiment 1) 29385 55.018 489.268768 2+ 2+ 976.5229470308802 0 0.036825871156711286 99.1891891891892 Confident
|
|
|
524 523 O75083 AHDGGIYAISWSPDSTHLLSASGDK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42219 (Experiment 1) 42219 71.064 667.055542 4+ 4+ 2664.1857252522204 0 2.7497338090944803 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Doubtful
|
|
|
525 524 O43390, O60506 TGYTLDVTTGQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26903 (Experiment 1) 26903 52.112 656.330322 2+ 2+ 1310.6466439738601 0 -0.4212111133755707 100.0 Confident
|
|
|
526 525 P37837 LVPVLSAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26940 (Experiment 1) 26940 52.156 413.773712 2+ 2+ 825.5323895157703 0 0.5819012566415521 99.46091644204851 Confident
|
|
|
527 526 P13639 VFSGLVSTGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36209 (Experiment 1) 36209 62.988 554.323547 2+ 2+ 1106.6335601090204 0 -0.9191759158460969 100.0 Confident
|
|
|
528 527 ALDOA_RABIT, P04075 ALANSLACQGK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16809 (Experiment 1) 16809 39.342 566.79303 2+ 2+ 1131.5706425826302 0 0.7626102997742515 100.0 Confident
|
|
|
529 528 P42704 VYLQNEYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18558 (Experiment 1) 18558 41.738 568.754761 2+ 2+ 1135.4950912080603 0 -0.10737639460346152 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 30.81684666379549) Phosphorylation of Y (7: 78.88307155322862) 0 Y7-{Y2 Y7} 1 91.05691056910568 Confident
|
|
|
530 529 P31942 DGMDNQGGYGSVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18454 (Experiment 1) 18454 41.607 706.795593 2+ 2+ 1411.57864106703 0 -1.4204940025239279 100.0 Confident
|
|
|
531 530 Q08945 NMSGSLYEMVSR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40928 (Experiment 1) 40928 69.068 727.297485 2+ 2+ 1452.5778519391904 0 1.7634680182360227 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.72826086956522 Confident
|
|
|
532 531 O15067 ELSDPAGAIIYTSR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40847 (Experiment 1) 40847 68.951 786.871155 2+ 2+ 1571.7232532195803 0 2.8618787564262216 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.30191972076788) Y11 1 0 99.45945945945947 Confident
|
|
|
533 532 HBA_HUMAN, P69905 TYFPHFDLSHGSAQVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34177 (Experiment 1) 34177 60.564 459.228577 4+ 4+ 1832.8845828234405 0 0.3371466580849001 100.0 Doubtful
|
|
|
534 533 P12268 FVPYLIAGIQHSCQDIGAK Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43586 (Experiment 1) 43586 73.402 706.367798 3+ 3+ 2116.07754562655 0 1.8965476848486782 99.25373134328358 Confident
|
|
|
535 534 P07195 IVVVTAGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22880 (Experiment 1) 22880 47.301 457.295837 2+ 2+ 912.5756513100803 0 1.6070107562921037 99.73333333333333 Confident
|
|
|
536 535 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33032 (Experiment 1) 33032 59.232 630.797974 2+ 2+ 1259.5798834611805 0 1.1981704671579947 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
537 536 P30101 GFPTIYFSPANKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40614 (Experiment 1) 40614 68.63 775.375183 2+ 2+ 1548.7377810849107 0 -1.2690733985571918 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
538 537 P63244 FSPNSSNPIIVSCGWDK Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40570 (Experiment 1) 40570 68.572 954.456726 2+ 2+ 1906.8883478745402 0 5.527359108331491 99.1869918699187 Doubtful
|
|
|
539 538 P23246 DKLESEMEDAYHEHQANLLR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33325 (Experiment 1) 33325 59.568 627.778015 4+ 4+ 2507.0788176555307 0 1.6472717808077264 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Doubtful
|
|
|
540 539 Q00839 YNILGTNTIMDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39962 (Experiment 1) 39962 67.689 691.853821 2+ 2+ 1381.6911516381303 0 1.4001736345970104 90.2439024390244 Doubtful
|
|
|
541 540 Q9H6Z4 DTGQLYAALHHR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26442 (Experiment 1) 26442 51.582 487.893127 3+ 3+ 1460.6561767192704 0 0.9393324814259234 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
542 541 P12268 HGFCGIPITDTGR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29209 (Experiment 1) 29209 54.815 477.566284 3+ 3+ 1429.6772329094902 0 -0.14679281339404993 100.0 Confident
|
|
|
543 542 P10412, P16402, P16403 ASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31488 (Experiment 1) 31488 57.458 599.837646 2+ 2+ 1197.6605031328502 0 0.19666452543145976 100.0 Confident
|
|
|
544 543 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 QVHPDTGISSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8061 (Experiment 1) 8061 24.572 390.203461 3+ 3+ 1167.5884008217504 0 0.13051125793343699 100.0 Confident
|
|
|
545 544 P13639 CLYASVLTAQPR Phosphorylation of Y(3) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36099 (Experiment 1) 36099 62.84 486.898651 3+ 3+ 1457.6738009293601 0 0.22090173820586126 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
546 545 Q00610 HDVVFLITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32993 (Experiment 1) 32993 59.189 536.313599 2+ 2+ 1070.61243074162 0 0.19981294424867108 92.36842105263158 Confident
|
|
|
547 546 Q13547 YYAVNYPLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35015 (Experiment 1) 35015 61.542 619.785461 2+ 2+ 1237.5532747905202 0 2.4962537640899862 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.17452006980802792) 0 Y2-{Y1 Y2 Y6} 1 100.0 Confident
|
|
|
548 547 P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0 FDSDVGEYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20254 (Experiment 1) 20254 43.846 584.221069 2+ 2+ 1166.4281338470503 0 -0.4696684574402634 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
549 548 P31942 VHIDIGADGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19683 (Experiment 1) 19683 43.137 526.778259 2+ 2+ 1051.54105670651 0 0.8621850214430236 99.74424552429667 Confident
|
|
|
550 549 P30041 DFTPVCTTELGR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34611 (Experiment 1) 34611 61.071 698.332031 2+ 2+ 1394.65001510214 0 -0.36231732065670524 100.0 Confident
|
|
|
551 550 P23396 FVADGIFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37633 (Experiment 1) 37633 64.694 448.747589 2+ 2+ 895.4803539429104 0 0.30208914128129366 99.72826086956522 Confident
|
|
|
552 551 P22087 NLVPGESVYGEK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26360 (Experiment 1) 26360 51.487 686.310852 2+ 2+ 1370.6119118654503 0 -3.4683864814390666 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 86.75282714054927) Y9 1 0 96.4769647696477 Confident
|
|
|
553 552 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27556 (Experiment 1) 27556 52.88 565.21582 2+ 2+ 1128.4165065341901 0 0.513549394153862 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 6: 0.0) Phosphorylation of Y (2: 99.82547993019197) 0 Y2-{Y2 Y6} 1 99.45652173913044 Confident
|
|
|
554 553 Q02543 SSGEIVYCGQVFEK Phosphorylation of Y(7) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35807 (Experiment 1) 35807 62.472 841.861023 2+ 2+ 1681.7058889032805 0 0.9527490761219691 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
555 554 Q8NFH5 ASTSDYQVISDR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20883 (Experiment 1) 20883 44.57 711.299683 2+ 2+ 1420.5871536695902 0 -1.6452976286633165 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
556 555 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21749 (Experiment 1) 21749 45.882 673.307861 2+ 2+ 1344.6002845525904 0 0.6568424472980522 Phosphorylation of Y (9: Random) Phosphorylation of Y (7: 0.0, 9: 0.0) Phosphorylation of Y (9: 0.16155088852988692) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
557 556 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21367 (Experiment 1) 21367 45.25 633.324585 2+ 2+ 1264.6339540318404 0 0.5234558219727818 99.7289972899729 Confident
|
|
|
558 557 P61619 GQYNTYPIK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21341 (Experiment 1) 21341 45.208 582.260986 2+ 2+ 1162.5059902449302 0 1.2269611335003694 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 10.223945022714512) Phosphorylation of Y (3: 10.471204188481675) 0 Y3-{Y3 Y6} 1 98.94736842105263 Confident
|
|
|
559 558 P15144 SEVYGPMK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16950 (Experiment 1) 16950 39.525 495.703186 2+ 2+ 989.3929346386403 0 -1.1252409107211185 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 73.82875605815832) Y4 1 0 91.32791327913279 Confident
|
|
|
560 559 O95478 PQNEYIELHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20055 (Experiment 1) 20055 43.615 460.209564 3+ 3+ 1377.6078295445202 0 -0.7003651920158513 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.33507853403141) Y5 1 0 97.74436090225565 Confident
|
|
|
561 560 O00567 VVSLSEYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22043 (Experiment 1) 22043 46.284 516.74231 2+ 2+ 1031.4688764602201 0 1.1520321679065966 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.68411867364746) Y7 1 0 98.92761394101876 Confident
|
|
|
562 561 P54136 VLTAEELNAAQTSVAYGCIK Phosphorylation of Y(16) Carbamidomethylation of C(18) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40686 (Experiment 1) 40686 68.73 740.022278 3+ 3+ 2217.0388503365107 0 2.7721147937421398 Phosphorylation of Y (16: Very Confident) Phosphorylation of Y (16: 100.0) Phosphorylation of Y (16: 99.82547993019197) Y16 1 0 100.0 Confident
|
|
|
563 562 P47756 SPWSNKYDPPLEDGAMPSAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34361 (Experiment 1) 34361 60.781 740.012451 3+ 3+ 2217.0160675688003 0 -0.24502700475298442 99.42528735632183 Confident
|
|
|
564 563 P26639 IYGISFPDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42395 (Experiment 1) 42395 71.332 608.785767 2+ 2+ 1215.5576914646201 0 -0.5834546965120141 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 94.18416801292408) Y2 1 0 99.20424403183023 Confident
|
|
|
565 564 P40227 ALQFLEEVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41316 (Experiment 1) 41316 69.629 538.803284 2+ 2+ 1075.5913609438705 0 0.607014583731337 99.72826086956522 Confident
|
|
|
566 565 P08238, P14625, Q58FF6, Q58FF7, Q58FF8 ELISNASDALDKIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36020 (Experiment 1) 36020 62.74 772.918823 2+ 2+ 1543.8205855845501 0 1.6220887746564647 92.53333333333333 Confident
|
|
|
567 566 Q9BZZ5 PTVEELYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25435 (Experiment 1) 25435 50.417 543.747131 2+ 2+ 1085.4794411439202 0 0.24636683700030976 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
568 567 A5A3E0, P0CG38, P0CG39, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3 AGFAGDDAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14617 (Experiment 1) 14617 36.214 488.727783 2+ 2+ 975.4410083120702 0 0.004863961180341345 100.0 Confident
|
|
|
569 568 P22234 TKEVYELLDSPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31161 (Experiment 1) 31161 57.076 493.596741 3+ 3+ 1477.76642475337 0 1.329593335467106 100.0 Confident
|
|
|
570 569 P12268 KYEQGFITDPVVLSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37714 (Experiment 1) 37714 64.791 607.66626 3+ 3+ 1819.9720008455104 0 2.715178719432894 100.0 Confident
|
|
|
571 570 P11172 GLQEVGLPLHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29966 (Experiment 1) 29966 55.69 406.903412 3+ 3+ 1217.68805529337 0 0.2877884403725333 92.14285714285715 Doubtful
|
|
|
572 571 P14550 GLEVTAYSPLGSSDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37683 (Experiment 1) 37683 64.756 776.386841 2+ 2+ 1550.75765097482 0 0.9519049555766711 100.0 Confident
|
|
|
573 572 O15143 EVEERPAPTPWGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20529 (Experiment 1) 20529 44.163 528.268433 3+ 3+ 1581.7787207725703 0 2.9964824236543377 100.0 Confident
|
|
|
574 573 Q92688 ELVLDNCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20499 (Experiment 1) 20499 44.128 495.750183 2+ 2+ 989.4851816231701 0 0.636856656605723 100.0 Confident
|
|
|
575 574 P08238 YHTSQSGDEMTSLSEYVSR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32738 (Experiment 1) 32738 58.9 752.974121 3+ 3+ 2255.9042073385003 0 -1.6263210378639275 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 18.391501264688678) Phosphorylation of Y (16: 100.0) 0 Y16-{Y1 Y16} 1 100.0 Confident
|
|
|
576 575 P52565 AEEYEFLTPVEEAPK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42518 (Experiment 1) 42518 71.541 916.40509 2+ 2+ 1830.7964777294908 0 -0.4641302898972191 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 93.01919720767889) Y4 1 0 96.2059620596206 Confident
|
|
|
577 576 O00148, Q13838 DFLLKPELLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43887 (Experiment 1) 43887 73.937 415.251373 3+ 3+ 1242.7336085034601 0 -1.0587181527926814 92.14285714285715 Doubtful
|
|
|
578 577 P26583 KHPDSSVNFAEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23212 (Experiment 1) 23212 47.696 531.59613 3+ 3+ 1591.7630707084306 0 2.1883146330907284 100.0 Confident
|
|
|
579 578 O43143 HRLDLGEDYPSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17840 (Experiment 1) 17840 40.735 496.247925 3+ 3+ 1485.72120589645 0 0.49686419782011687 100.0 Confident
|
|
|
580 579 P60842 GFKDQIYDIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45664 (Experiment 1) 45664 78.023 527.916992 3+ 3+ 1580.7276103240304 0 0.9700243581850455 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.28057553956835 Confident
|
|
|
581 580 P49458 LYLADPMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34007 (Experiment 1) 34007 60.364 475.75 2+ 2+ 949.4942897548901 0 -9.293332985813796 99.73333333333333 Doubtful
|
|
|
582 581 Q02790 VGEVCHITCKPEYAYGSAGSPPK Phosphorylation of Y(13) Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21288 (Experiment 1) 21288 45.134 863.048645 3+ 3+ 2586.1284107002402 0 -1.662746568351768 Phosphorylation of Y (13: Random) Phosphorylation of Y (13: 0.0, 15: 0.0) Phosphorylation of Y (13: 13.974114890345257) 0 Y13-{Y13 Y15} 1 100.0 Confident
|
|
|
583 582 Q15084 GESPVDYDGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16915 (Experiment 1) 16915 39.477 576.251648 2+ 2+ 1150.4890807033 0 -0.29295953108743394 99.73333333333333 Confident
|
|
|
584 583 P61978 TDYNASVSVPDSSGPER Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23316 (Experiment 1) 23316 47.832 930.886047 2+ 2+ 1859.7574664518204 0 0.04007717089454771 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
585 584 P51812 GAMAATYSALNR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24613 (Experiment 1) 24613 49.458 653.286438 2+ 2+ 1304.5584368239502 0 -0.08706560999341827 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
586 585 P00558 IQLINNMLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40398 (Experiment 1) 40398 68.326 601.335388 2+ 2+ 1200.6536439306003 0 2.1445114971874015 98.94736842105263 Confident
|
|
|
587 586 Q9UQ80 AFFSEVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32408 (Experiment 1) 32408 58.522 492.741943 2+ 2+ 983.4712458111903 0 -1.9409156546941957 99.72972972972973 Confident
|
|
|
588 587 A6NIZ1, P61224 VKDTDDVPMILVGNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35512 (Experiment 1) 35512 62.112 548.627502 3+ 3+ 1642.86000786838 0 0.40630570726380383 100.0 Confident
|
|
|
589 588 P13796 AECMLQQAER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19475 (Experiment 1) 19475 42.881 618.280029 2+ 2+ 1234.5434418586203 0 1.668508686405224 99.45799457994579 Confident
|
|
|
590 589 O43242 EMIDIYSTR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32694 (Experiment 1) 32694 58.849 604.256958 2+ 2+ 1206.4991906123303 0 0.14269928382461583 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
591 590 Q9P107 AQEAEALYQACVR Phosphorylation of Y(8) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26849 (Experiment 1) 26849 52.051 794.846741 2+ 2+ 1587.6752574813404 0 2.3096235575697697 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 97.38219895287958) Y8 1 0 99.72826086956522 Confident
|
|
|
592 591 Q92785 HRGPGLASGQLYSYPAR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20885 (Experiment 1) 20885 44.573 637.308594 3+ 3+ 1908.8995948721104 0 2.2792398256315205 Phosphorylation of Y (12: Random) Phosphorylation of Y (12: 0.0, 14: 0.0) Phosphorylation of Y (12: 20.331588132635254) 0 Y12-{Y12 Y14} 1 99.24812030075188 Confident
|
|
|
593 592 P17844, Q92841 STCIYGGAPK Phosphorylation of Y(5) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13516 (Experiment 1) 13516 34.518 567.238281 2+ 2+ 1132.4624111807902 0 -0.35444916648609115 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
594 593 Q9Y265 AVLLAGPPGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26242 (Experiment 1) 26242 51.354 540.824524 2+ 2+ 1079.63389446219 0 0.5552674598350275 100.0 Confident
|
|
|
595 594 P31146 DAGPLLISLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43885 (Experiment 1) 43885 73.934 513.812805 2+ 2+ 1025.6120963884503 0 -1.0113810059652828 100.0 Confident
|
|
|
596 595 Q9BZM2 QTCMCDKNMVLCLMNQTYR Carbamidomethylation of C(3, 5, 12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19700 (Experiment 1) 19700 43.161 823.02301 3+ 3+ 2465.0452192294 1 -0.5564952690250679 99.37888198757764 Confident
|
|
|
597 596 P13796 IGNFSTDIKDSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20592 (Experiment 1) 20592 44.235 442.229584 3+ 3+ 1323.6670450652703 0 -0.09230928862350568 100.0 Confident
|
|
|
598 597 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGRPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29191 (Experiment 1) 29191 54.796 400.239807 3+ 3+ 1197.69822605425 0 -0.5283951767680435 100.0 Confident
|
|
|
599 598 P20039, Q30134 YFYNQEEYVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31702 (Experiment 1) 31702 57.711 705.820984 2+ 2+ 1409.6251802532904 0 1.5831327447168497 100.0 Confident
|
|
|
600 599 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33560 (Experiment 1) 33560 59.84 978.039978 2+ 2+ 1953.0571274518006 1 2.516929084773741 98.64864864864865 Doubtful
|
|
|
601 600 Q13151 AVPKEDIYSGGGGGGSR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12813 (Experiment 1) 12813 33.464 562.920959 3+ 3+ 1685.7410285420399 0 0.011284902525971287 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
602 601 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19147 (Experiment 1) 19147 42.481 636.766357 2+ 2+ 1271.5183458337801 0 -0.1450825530408638 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
603 602 P12270 FKVESEQQYFEIEKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29663 (Experiment 1) 29663 55.338 680.652954 3+ 3+ 2038.9401222714107 0 -1.513089822312376 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.60383944153578) Y9 1 0 96.71052631578947 Confident
|
|
|
604 603 Q96AE4 IQFKPDDGTTPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18373 (Experiment 1) 18373 41.499 501.919067 3+ 3+ 1502.7365216074202 0 -0.763739982171903 100.0 Confident
|
|
|
605 604 Q9UPU5 MSEHYWTPQSNVSNETSTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25936 (Experiment 1) 25936 50.997 788.325317 3+ 3+ 2361.957305540521 0 -1.3462871235239275 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.33507853403141) Y5 1 0 96.2406015037594 Confident
|
|
|
606 605 P62942 GVQVETISPGDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21456 (Experiment 1) 21456 45.376 657.835327 2+ 2+ 1313.65754301073 0 -1.0959754779328792 100.0 Confident
|
|
|
607 606 Q7L1Q6 YFTEAGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24740 (Experiment 1) 24740 49.607 464.742096 2+ 2+ 927.4701831820303 0 -0.5853949323074404 99.72826086956522 Confident
|
|
|
608 607 P49327 SLLVNPEGPTLMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40597 (Experiment 1) 40597 68.611 713.889221 2+ 2+ 1425.7649852847303 0 -0.7677784455246631 100.0 Confident
|
|
|
609 608 P53396 LYRPGSVAYVSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20699 (Experiment 1) 20699 44.356 483.241333 3+ 3+ 1446.7020642825303 0 0.07264627022258073 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 21.201702136401888) Phosphorylation of Y (2: 85.85197524988102) 0 Y2-{Y2 Y9} 1 100.0 Confident
|
|
|
610 609 P23528, Q9Y281 YALYDATYETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30903 (Experiment 1) 30903 56.773 669.317139 2+ 2+ 1336.6186978905205 0 0.7673317951257677 100.0 Confident
|
|
|
611 610 P05556 DNTNEIYSGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11521 (Experiment 1) 11521 31.346 610.745239 2+ 2+ 1219.4758123154602 0 0.09230602124473411 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73333333333333 Confident
|
|
|
612 611 P23526 VAVVAGYGDVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24571 (Experiment 1) 24571 49.41 567.811462 2+ 2+ 1133.6080736371703 0 0.2619084884743114 100.0 Confident
|
|
|
613 612 P0DMV8, P17066, P48741 FEELCSDLFR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43699 (Experiment 1) 43699 73.59 658.302979 2+ 2+ 1314.59143759686 0 -0.024707835382121575 94.08602150537635 Confident
|
|
|
614 613 P30101 LAPEYEAAATR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18240 (Experiment 1) 18240 41.321 636.287659 2+ 2+ 1270.5594823697706 0 1.0079544054384917 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
615 614 P10809 LVQDVANNTNEEAGDGTTTATVLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29796 (Experiment 1) 29796 55.491 854.087708 3+ 3+ 2559.241252374861 0 0.016479456570874938 100.0 Confident
|
|
|
616 615 Q9UHF7 AGDDTPVGYSVPIKPLDSSR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34151 (Experiment 1) 34151 60.535 718.674927 3+ 3+ 2153.0041790799505 0 -0.5693254079245357 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.86914378029078) Y9 1 0 100.0 Confident
|
|
|
617 616 O75083 VFASLPQVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33724 (Experiment 1) 33724 60.027 573.820007 2+ 2+ 1144.6240580544802 1 -1.7022154021908795 92.65091863517061 Confident
|
|
|
618 617 P46778 VYNVTQHAVGIVVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28062 (Experiment 1) 28062 53.473 547.642029 3+ 3+ 1639.9045899920304 0 -0.2023173177072454 100.0 Confident
|
|
|
619 618 Q16881 LYAGSTVK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11780 (Experiment 1) 11780 31.753 459.720184 2+ 2+ 917.4259490190802 0 -0.14568936634150084 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 72.05169628432957) Y2 1 0 90.5149051490515 Doubtful
|
|
|
620 619 P25685, Q9UDY4 VSLEEIYSGCTK Phosphorylation of Y(7) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32736 (Experiment 1) 32736 58.897 733.31781 2+ 2+ 1464.6207622969903 0 0.20780175032495757 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
621 620 P36578 LAPGGHVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6563 (Experiment 1) 6563 21.199 432.246277 2+ 2+ 862.4773342511401 0 0.7713377603003717 99.45799457994579 Confident
|
|
|
622 621 P54819 AMVASGSELGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16582 (Experiment 1) 16582 39.06 525.270203 2+ 2+ 1048.5222954078802 0 3.386514715197093 99.73890339425587 Confident
|
|
|
623 622 P49368 IVLLDSSLEYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42058 (Experiment 1) 42058 70.799 640.360474 2+ 2+ 1278.7071189721005 0 -0.5652326657742578 97.58713136729223 Confident
|
|
|
624 623 P63244 DGQAMLWDLNEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44065 (Experiment 1) 44065 74.265 738.842834 2+ 2+ 1475.6714788227102 0 -0.2461661858417401 100.0 Confident
|
|
|
625 624 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33057 (Experiment 1) 33057 59.261 616.269287 2+ 2+ 1230.5209716027305 0 2.4741385417336814 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.714203795409155) Phosphorylation of Y (8: 0.17452006980802792) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
626 625 P60174 SNVSDAVAQSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16036 (Experiment 1) 16036 38.39 617.805969 2+ 2+ 1233.5949427541705 0 1.976605241321525 100.0 Confident
|
|
|
627 626 P30050 EILGTAQSVGCNVDGR Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27685 (Experiment 1) 27685 53.036 838.404114 2+ 2+ 1674.7995328701402 0 -3.493412784292836 100.0 Confident
|
|
|
628 627 P20042 TGFQAVTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17679 (Experiment 1) 17679 40.53 454.746277 2+ 2+ 907.4763311916302 0 1.83605440705152 99.20634920634922 Confident
|
|
|
629 628 Q07666 KDDEENYLDLFSHK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36706 (Experiment 1) 36706 63.575 611.596252 3+ 3+ 1831.7665745835404 0 0.19185646861248135 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
630 629 P07814 LNQWCNVVR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29141 (Experiment 1) 29141 54.738 594.800537 2+ 2+ 1187.5869613531102 0 -0.3701127891033568 98.70801033591732 Confident
|
|
|
631 630 Q9Y512 ETSYGLSFFKPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40639 (Experiment 1) 40639 68.661 504.569214 3+ 3+ 1510.6857455120503 0 0.04431999605042912 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.38219895287958) Y4 1 0 92.14285714285715 Doubtful
|
|
|
632 631 Q9NR30 GRAPQVLVLAPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27332 (Experiment 1) 27332 52.612 459.949219 3+ 3+ 1376.8252174725203 0 0.44217005444538043 100.0 Confident
|
|
|
633 632 P30085 KNPDSQYGELIEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19428 (Experiment 1) 19428 42.822 534.247131 3+ 3+ 1599.7181678391403 0 0.8708589203724956 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Confident
|
|
|
634 633 P50990 QYGNEVFLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30211 (Experiment 1) 30211 55.977 584.803833 2+ 2+ 1167.5924235730304 0 0.5895085780430368 99.72972972972973 Confident
|
|
|
635 634 P33991 THIDVIHYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18813 (Experiment 1) 18813 42.065 617.293579 2+ 2+ 1232.5703218369902 0 1.8493903759863644 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 98.87096774193549) Y8 1 0 99.45799457994579 Confident
|
|
|
636 635 Q96GX9 HGDEIYIAPSGVQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25410 (Experiment 1) 25410 50.386 531.915222 3+ 3+ 1592.7235875727504 0 0.15605673116782945 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
637 636 P39023 TVFAEHISDECK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20383 (Experiment 1) 20383 43.99 479.222656 3+ 3+ 1434.6449297217002 0 0.8408609686625544 100.0 Confident
|
|
|
638 637 Q14152 IGLINDMVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38739 (Experiment 1) 38739 66.041 515.789795 2+ 2+ 1029.56410065021 0 0.9077506233391437 99.46091644204851 Confident
|
|
|
639 638 P78371 GATQQILDEAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28802 (Experiment 1) 28802 54.351 665.833984 2+ 2+ 1329.6524576302902 0 0.7189755982783299 100.0 Confident
|
|
|
640 639 P11387 AEEVATFFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37740 (Experiment 1) 37740 64.821 556.785461 2+ 2+ 1111.5549754351505 0 1.2514990667212553 92.69521410579345 Confident
|
|
|
641 640 P09234 TTAAFQQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9136 (Experiment 1) 9136 26.913 476.248199 2+ 2+ 950.4821448480602 0 -0.31473251805758 98.91598915989161 Confident
|
|
|
642 641 P16989, P67809, Q9Y2T7 NGYGFINR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26048 (Experiment 1) 26048 51.128 510.718658 2+ 2+ 1019.4225949741403 0 0.16456444343928064 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
643 642 P00387 GPSGLLVYQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30234 (Experiment 1) 30234 56.002 559.814453 2+ 2+ 1117.6131590176103 0 1.0664694636529306 100.0 Confident
|
|
|
644 643 P04406 GALQNIIPASTGAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34717 (Experiment 1) 34717 61.19 706.398376 2+ 2+ 1410.7830778770206 0 -0.6220357576840251 100.0 Confident
|
|
|
645 644 P61081 LVICPDEGFYK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38492 (Experiment 1) 38492 65.745 670.831543 2+ 2+ 1339.6482241969902 0 0.23021387410264094 92.63157894736842 Confident
|
|
|
646 645 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28906 (Experiment 1) 28906 54.469 569.277039 2+ 2+ 1136.5389910178403 0 0.46905877924255224 100.0 Confident
|
|
|
647 646 P06276, P68104, Q05639, Q5VTE0 QLIVGVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21365 (Experiment 1) 21365 45.247 435.773834 2+ 2+ 869.5334521449302 0 -0.38675844825685407 94.3089430894309 Confident
|
|
|
648 647 Q02543 KSSGEIVYCGQVFEK Phosphorylation of Y(8) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29207 (Experiment 1) 29207 54.813 604.276733 3+ 3+ 1809.8008519172806 0 4.146948491414185 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
649 648 P07195 LKDDEVAQLKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11779 (Experiment 1) 11779 31.751 429.582062 3+ 3+ 1285.7241660185705 0 0.1478809588731684 97.76119402985076 Confident
|
|
|
650 649 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21284 (Experiment 1) 21284 45.13 636.766296 2+ 2+ 1271.5183458337801 0 -0.2408790574244032 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
651 650 Q9NY33 GDYAPILQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27972 (Experiment 1) 27972 53.368 542.757263 2+ 2+ 1083.5001765885002 0 -0.1874890490482008 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
652 651 O43175 ILQDGGLQVVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29691 (Experiment 1) 29691 55.37 649.869812 2+ 2+ 1297.7241660185705 0 0.6963305718455468 100.0 Confident
|
|
|
653 652 P07900, P08238, Q58FF7, Q58FF8 IRYESLTDPSKLDSGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23563 (Experiment 1) 23563 48.145 630.305969 3+ 3+ 1887.8979231062604 0 -0.9759836153176242 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
654 653 P62191, P62195, Q8NB90 GVLLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31820 (Experiment 1) 31820 57.852 619.813171 2+ 2+ 1237.6107896666401 0 0.8062111199264108 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.73474801061008 Confident
|
|
|
655 654 P29401 DAIAQAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16412 (Experiment 1) 16412 38.855 422.237854 2+ 2+ 842.4610154806603 0 0.16529278175652093 97.8319783197832 Confident
|
|
|
656 655 Q06830 KQGGLGPMNIPLVSDPKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33283 (Experiment 1) 33283 59.519 477.518219 4+ 4+ 1906.0458515754503 0 -1.0897178094209852 100.0 Doubtful
|
|
|
657 656 P31943, P55795 HTGPNSPDTANDGFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15943 (Experiment 1) 15943 38.269 562.261841 3+ 3+ 1683.76011058631 0 2.1241709845098202 100.0 Confident
|
|
|
658 657 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23445 (Experiment 1) 23445 47.992 420.570007 3+ 3+ 1257.68296991293 1 1.4807977528704612 100.0 Confident
|
|
|
659 658 Q02790 GEHSIVYLKPSYAFGSVGK Phosphorylation of Y(12, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41575 (Experiment 1) 41575 70.026 734.006165 3+ 3+ 2197.9850374660305 1 3.7588686605357484 Phosphorylation of Y (7: Very Confident, 12: Very Confident) Phosphorylation of Y (7: 99.82547993019197, 12: 99.82547993019197) Y7, Y12 2 0 100.0 Confident
|
|
|
660 659 Q9Y2W1 SGKWEGLVYAPPGK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32659 (Experiment 1) 32659 58.81 523.588501 3+ 3+ 1567.7435947413403 0 0.05020369207374911 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
661 660 P00519 GQGESDPLDHEPAVSPLLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38129 (Experiment 1) 38129 65.294 705.353271 3+ 3+ 2113.0439965688 0 -2.8415794833574743 96.73202614379085 Confident
|
|
|
662 661 Q6GTX8 AVSPQSTKPMAESITYAAVAR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34337 (Experiment 1) 34337 60.754 753.369324 3+ 3+ 2257.0813838548306 0 2.1055431031959886 Phosphorylation of Y (16: Very Confident) Phosphorylation of Y (16: 100.0) Phosphorylation of Y (16: 96.50959860383944) Y16 1 0 99.25925925925925 Confident
|
|
|
663 662 O75688 NVIEAVYSR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26525 (Experiment 1) 26525 51.679 565.766052 2+ 2+ 1129.5168892818003 0 0.5848574336722285 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.93053311793214) Y7 1 0 99.72972972972973 Confident
|
|
|
664 663 P46779 TVGVEPAADGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11311 (Experiment 1) 11311 31.032 522.272705 2+ 2+ 1042.5294889633003 0 1.3097610254976724 100.0 Confident
|
|
|
665 664 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29707 (Experiment 1) 29707 55.387 528.262451 2+ 2+ 1054.5100129962104 0 0.3180902521043452 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
666 665 P62424 QTATQLLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18493 (Experiment 1) 18493 41.658 451.768707 2+ 2+ 901.5232813840503 0 -0.4651910060870291 99.73890339425587 Confident
|
|
|
667 666 Q16836 DTPGFIVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29640 (Experiment 1) 29640 55.313 509.768646 2+ 2+ 1017.5243440132103 0 -1.5741889192098537 99.7289972899729 Confident
|
|
|
668 667 P62269 VLNTNIDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17761 (Experiment 1) 17761 40.631 501.2724 2+ 2+ 1000.53015766964 0 0.08916982474497913 100.0 Confident
|
|
|
669 668 P09874 VVDRDSEEAEIIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20279 (Experiment 1) 20279 43.874 510.929626 3+ 3+ 1529.7685500116904 0 -0.9795286730449637 100.0 Confident
|
|
|
670 669 ALDOA_RABIT, P04075 AAQEEYVKR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6419 (Experiment 1) 6419 20.913 391.847656 3+ 3+ 1172.5227029382304 0 -1.3307353514717322 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
671 670 P12956 TFNTSTGGLLLPSDTKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32967 (Experiment 1) 32967 59.158 603.323181 3+ 3+ 1806.94757700282 0 0.07546908999933137 99.24812030075188 Confident
|
|
|
672 671 P26038 ALTSELANAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22507 (Experiment 1) 22507 46.862 523.286255 2+ 2+ 1044.5563724174801 0 1.5141342619996345 92.5257731958763 Confident
|
|
|
673 672 Q92608, Q9H7D0 SVVYYQVK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24536 (Experiment 1) 24536 49.37 533.254578 2+ 2+ 1064.4943629320703 0 0.2251592106181488 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (4: 3.1413612565445024) 0 Y4-{Y4 Y5} 1 99.7289972899729 Confident
|
|
|
674 673 Q16531 TVPLYESPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21794 (Experiment 1) 21794 45.949 571.267822 2+ 2+ 1140.52164030907 0 -0.48072235912868205 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 99.73118279569893 Confident
|
|
|
675 674 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33269 (Experiment 1) 33269 59.504 932.895203 2+ 2+ 1863.7750310922602 0 0.4405502757594968 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 2.6178010471204187) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
676 675 P01911, P01912, Q5Y7A7, Q9GIY3 HNYGVVESFTVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29361 (Experiment 1) 29361 54.991 512.591431 3+ 3+ 1534.7528403779004 0 -0.24501530950090422 100.0 Confident
|
|
|
677 676 O43175, Q13363 TLGILGLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42559 (Experiment 1) 42559 71.618 450.287567 2+ 2+ 898.5600012459399 0 0.6438339097078826 99.45799457994579 Confident
|
|
|
678 677 Q9Y5Z4 VYYTAGYNSPVK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27612 (Experiment 1) 27612 52.953 721.323181 2+ 2+ 1440.6326473100305 0 -0.5810454936983314 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 1.0471204188481675) 0 Y2-{Y2 Y3 Y7} 1 100.0 Confident
|
|
|
679 678 P18669, Q8N0Y7 SYDVPPPPMEPDHPFYSNISK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38459 (Experiment 1) 38459 65.704 833.032471 3+ 3+ 2496.0708787407802 0 1.8826267502140783 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 10.854536476826103) Phosphorylation of Y (16: 99.35379644588045) 0 Y16-{Y2 Y16} 1 98.49624060150376 Confident
|
|
|
680 679 Q9UBT2 ELAEAVAGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16896 (Experiment 1) 16896 39.451 486.759094 2+ 2+ 971.5036085686302 0 0.027218542980355576 99.72972972972973 Confident
|
|
|
681 680 P68104, Q5VTE0 YYVTIIDAPGHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31355 (Experiment 1) 31355 57.301 702.867798 2+ 2+ 1403.71974934447 0 0.9203175192289378 100.0 Confident
|
|
|
682 681 P00519 GAVSTLLQAPELPTKTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37055 (Experiment 1) 37055 63.993 594.675415 3+ 3+ 1781.0046979561203 0 -0.1582692588349767 98.56115107913669 Confident
|
|
|
683 682 P40429, Q6NVV1 YQAVTATLEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23943 (Experiment 1) 23943 48.644 626.826172 2+ 2+ 1251.6346823078306 0 2.4797674324719545 99.7340425531915 Confident
|
|
|
684 683 P36873, P62136, P62140 AHQVVEDGYEFFAK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35921 (Experiment 1) 35921 62.609 573.91748 3+ 3+ 1718.7341522564507 0 -2.0570028068096673 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
685 684 P61160 GYAFNHSADFETVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28633 (Experiment 1) 28633 54.151 538.583313 3+ 3+ 1612.7270195528806 0 0.6746386878273144 100.0 Confident
|
|
|
686 685 Q9UN86 NSSYVHGGVDASGKPQEAVYGQNDIHHK Phosphorylation of Y(20) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15172 (Experiment 1) 15172 37.127 769.350891 4+ 4+ 3073.36794013083 0 2.1180243642530243 Phosphorylation of Y (20: Doubtfull) Phosphorylation of Y (20: 17.899796346635615) Phosphorylation of Y (20: 0.17452006980802792) 0 Y20-{Y4 Y20} 1 100.0 Doubtful
|
|
|
687 686 Q07666 SGSMDPSGAHPSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11129 (Experiment 1) 11129 30.753 462.213501 3+ 3+ 1383.6201119561902 0 -1.037294908819243 99.24812030075188 Confident
|
|
|
688 687 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34476 (Experiment 1) 34476 60.915 631.298889 4+ 2+ 1259.5798834611805 1 -0.010488794444036727 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 99.73684210526315 Confident
|
|
|
689 688 P13639 SDPVVSYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16721 (Experiment 1) 16721 39.232 501.718445 2+ 2+ 1001.4219262678002 0 0.40939170968993543 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.16055846422339) Y7 1 0 96.24664879356568 Confident
|
|
|
690 689 Q9UKY7 KTPQGPPEIYSDTQFPSLQSTAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37385 (Experiment 1) 37385 64.388 867.415039 3+ 3+ 2599.2207137786104 0 0.9890780397047476 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.83844911147011) Y10 1 0 100.0 Confident
|
|
|
691 690 P62269 VITIMQNPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26246 (Experiment 1) 26246 51.358 536.803711 2+ 2+ 1070.59064975122 1 -1.0586585273387108 99.7289972899729 Confident
|
|
|
692 691 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32798 (Experiment 1) 32798 58.97 932.895691 2+ 2+ 1863.7750310922602 0 0.9636532067614993 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 1.3961605584642234) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
693 692 P36578 SNYNLPMHK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16536 (Experiment 1) 16536 39.0 592.251831 2+ 2+ 1182.4892946349703 0 -0.15666356402466936 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
694 693 P08238, Q58FF8 SIYYITGESK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32154 (Experiment 1) 32154 58.232 620.778564 2+ 2+ 1239.5424353233002 0 0.11255470099276457 Phosphorylation of Y (4: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (4: 0.17452006980802792) 0 Y4-{Y3 Y4} 1 100.0 Confident
|
|
|
695 694 P08621 EFEVYGPIKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29412 (Experiment 1) 29412 55.049 659.31781 2+ 2+ 1316.6166033230702 0 3.3851341100944197 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
696 695 O60506 VTEGLTDVILYHQPDDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38955 (Experiment 1) 38955 66.301 648.331848 3+ 3+ 1941.9683720170503 0 2.7468428940582292 99.28057553956835 Confident
|
|
|
697 696 P60842, Q14240 VLITTDLLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42472 (Experiment 1) 42472 71.448 557.844971 2+ 2+ 1113.67575927417 0 -0.3318194934789946 100.0 Confident
|
|
|
698 697 P22626 LTDCVVMRDPASK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20414 (Experiment 1) 20414 44.024 497.915405 3+ 3+ 1490.7221344965803 0 1.5070206394708545 100.0 Confident
|
|
|
699 698 P22234 NFEWVAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36178 (Experiment 1) 36178 62.953 525.753967 2+ 2+ 1049.4930438849303 0 0.3206647736282533 99.72826086956522 Confident
|
|
|
700 699 Q00839 YNILGTNTIMDK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41438 (Experiment 1) 41438 69.809 731.834961 2+ 2+ 1461.6574821588804 0 -1.443692612705868 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 96.76898222940227) Y1 1 0 98.91891891891892 Confident
|
|
|
701 700 Q00839 SSGPTSLFAVTVAPPGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43834 (Experiment 1) 43834 73.845 857.96106 2+ 2+ 1713.9049839148504 0 1.5054036450673636 100.0 Confident
|
|
|
702 701 P60842 GFKDQIYDIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45548 (Experiment 1) 45548 77.771 527.916748 3+ 3+ 1580.7276103240304 0 0.5078300351199079 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
703 702 Q8TDN6 KKQDLYMWLSNSPHGPSAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30401 (Experiment 1) 30401 56.193 567.522156 4+ 4+ 2266.0605888406 0 -0.471658829452165 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Doubtful
|
|
|
704 703 O15067 GHLLYVALSPGQHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29883 (Experiment 1) 29883 55.593 543.610779 3+ 3+ 1626.8031753061302 1 2.4404188316894984 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.25479930191972) Y5 1 0 100.0 Confident
|
|
|
705 704 P25685, Q9UDY4 VSLEEIYSGCTK Phosphorylation of Y(7) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32775 (Experiment 1) 32775 58.944 489.213959 3+ 3+ 1464.6207622969903 0 -0.48696966850352114 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 99.37888198757764 Confident
|
|
|
706 705 P54578 AQLFALTGVQPAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41434 (Experiment 1) 41434 69.804 686.391113 2+ 2+ 1370.76703389006 0 0.46560670831158996 100.0 Confident
|
|
|
707 706 P07437, P68371, Q13885, Q9BVA1 EVDEQMLNVQNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25910 (Experiment 1) 25910 50.967 723.848267 2+ 2+ 1445.6820435064103 0 -0.04313060808423401 100.0 Confident
|
|
|
708 707 P22090, P62701, Q8TD47 LTGVFAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26886 (Experiment 1) 26886 52.094 430.752991 2+ 2+ 859.4915873329501 0 -0.18370916535445098 92.83819628647215 Confident
|
|
|
709 708 P84090 MYEEHLKR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8087 (Experiment 1) 8087 24.62 395.842407 3+ 3+ 1184.5049446991102 0 0.3763287392394609 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.42931937172776) Y2 1 0 97.76119402985076 Confident
|
|
|
710 709 P35579 NKHEAMITDLEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20412 (Experiment 1) 20412 44.022 529.259521 3+ 3+ 1584.7566054290003 0 0.08072320475379977 100.0 Confident
|
|
|
711 710 P25685 DYYQTLGLAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37387 (Experiment 1) 37387 64.391 640.292603 2+ 2+ 1278.5645677502102 0 4.752003267343455 Phosphorylation of Y (3: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (3: 2.9700447894165167) 0 Y3-{Y2 Y3} 1 99.45652173913044 Confident
|
|
|
712 711 P62805 KTVTAMDVVYALK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45581 (Experiment 1) 45581 77.839 506.926086 3+ 3+ 1517.7564679241605 0 -0.025858204624387683 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 95.15347334410339) Y10 1 0 97.74436090225565 Confident
|
|
|
713 712 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44491 (Experiment 1) 44491 75.388 625.278442 2+ 2+ 1248.5427696764702 0 -0.35073169888056444 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.60743134087238) Y4 1 0 99.7289972899729 Confident
|
|
|
714 713 P49588 TITVALADGGRPDNTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23460 (Experiment 1) 23460 48.01 571.968323 3+ 3+ 1712.8805600721603 0 1.5033066098836139 99.42196531791907 Confident
|
|
|
715 714 Q14807 STQQDIYAGSVQPILR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37269 (Experiment 1) 37269 64.246 619.304016 3+ 3+ 1854.8876927757303 0 1.35949776007529 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 95.31502423263328) Y7 1 0 98.52941176470588 Confident
|
|
|
716 715 Q15154 TEYMAFPKPFESSSSIGAEKPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37762 (Experiment 1) 37762 64.846 847.0578 3+ 3+ 2538.1501916906404 0 0.5426271468542857 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.86914378029078) Y3 1 0 100.0 Confident
|
|
|
717 716 P49327 GYAVLGGER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21417 (Experiment 1) 21417 45.319 501.22644 2+ 2+ 1000.43791068511 0 0.4153626045011465 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.19224555735056) Y2 1 0 99.73544973544973 Confident
|
|
|
718 717 P46776 TGAAPIIDVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34733 (Experiment 1) 34733 61.21 556.32782 2+ 2+ 1110.6397081186203 0 1.239331752686293 100.0 Confident
|
|
|
719 718 P12268 NLIDAGVDALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42768 (Experiment 1) 42768 72.034 578.820984 2+ 2+ 1155.6247863304702 0 2.270772784222229 100.0 Confident
|
|
|
720 719 Q96GX9 HGDEIYIAPSGVQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25192 (Experiment 1) 25192 50.132 531.915466 3+ 3+ 1592.7235875727504 0 0.6147765196831554 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
721 720 Q8N163 FAEFQYLQPGPPR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42937 (Experiment 1) 42937 72.333 815.378174 2+ 2+ 1628.73884371407 0 1.8098090807225362 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 84.46771378708551) Y6 1 0 93.08510638297872 Confident
|
|
|
722 721 P31146 KLQATVQELQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16793 (Experiment 1) 16793 39.32 643.378662 2+ 2+ 1284.7401504358804 0 2.036620102102712 100.0 Confident
|
|
|
723 722 P55884 GTYLATFHQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21761 (Experiment 1) 21761 45.898 637.291748 2+ 2+ 1272.5652364565503 0 2.9081034050123025 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.38219895287958) Y3 1 0 99.48849104859335 Confident
|
|
|
724 723 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38164 (Experiment 1) 38164 65.335 635.655518 3+ 3+ 1903.9444793758603 0 0.12859362148766218 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 100.0 Confident
|
|
|
725 724 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17108 (Experiment 1) 17108 39.739 514.763306 2+ 2+ 1027.5120650773501 0 -0.005838580856008839 100.0 Confident
|
|
|
726 725 P38606 TVISQSLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18458 (Experiment 1) 18458 41.613 481.779694 2+ 2+ 961.5444107514502 0 0.44036218010515193 97.5609756097561 Confident
|
|
|
727 726 Q14839, Q8TDI0 HLCEPGADGAETFADGVPR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29744 (Experiment 1) 29744 55.433 666.97052 3+ 3+ 1997.8901387796902 0 -0.20399704375775726 100.0 Confident
|
|
|
728 727 P07900, Q58FG0 HIYYITGETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19924 (Experiment 1) 19924 43.457 612.816467 2+ 2+ 1223.6186383208703 0 -0.2098951760896224 98.92761394101876 Confident
|
|
|
729 728 P52272 GGNRFEPYANPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17620 (Experiment 1) 17620 40.447 484.240051 3+ 3+ 1449.7000765290502 0 -1.206651788689601 100.0 Confident
|
|
|
730 729 P14625 DISTNYYASQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20530 (Experiment 1) 20530 44.164 685.285645 2+ 2+ 1368.5598762925904 0 -2.290445631774947 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (6: 0.0) 0 Y6-{Y6 Y7} 1 100.0 Confident
|
|
|
731 730 P55084 DQLLLGPTYATPK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39585 (Experiment 1) 39585 67.16 748.872559 2+ 2+ 1495.7323613513004 0 -1.1993247372667266 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.86914378029078) Y9 1 0 99.72972972972973 Confident
|
|
|
732 731 P12004 DLSHIGDAVVISCAK Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36193 (Experiment 1) 36193 62.971 528.93988 3+ 3+ 1583.7977419649903 0 0.04325291598807747 100.0 Confident
|
|
|
733 732 P20339, P51148, P61020 LVLLGESAVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35897 (Experiment 1) 35897 62.581 543.332458 2+ 2+ 1084.6492101731603 0 1.0609475116570872 99.72972972972973 Confident
|
|
|
734 733 Q13242 DAEDAIYGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19068 (Experiment 1) 19068 42.374 545.216431 2+ 2+ 1088.4175691633502 0 0.6785411127745912 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
735 734 Q9Y230 AVLIAGQPGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19893 (Experiment 1) 19893 43.413 556.32782 2+ 2+ 1110.63970811862 0 1.2393317528906458 99.73333333333333 Confident
|
|
|
736 735 Q13838 HFILDECDK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24530 (Experiment 1) 24530 49.363 588.772339 2+ 2+ 1175.5281090643102 0 1.712041636081027 96.50537634408603 Confident
|
|
|
737 736 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28511 (Experiment 1) 28511 54.008 609.260315 2+ 2+ 1216.5053215385904 0 0.6200373102765451 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 15.41625462903884) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
738 737 P54578 SSSSGHYVSWVK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23567 (Experiment 1) 23567 48.15 468.537415 3+ 3+ 1402.5918451272105 0 -1.0170131896220431 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
739 738 Q9Y2Z0 LFQQIYSDGSDEVKR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29742 (Experiment 1) 29742 55.43 622.286743 3+ 3+ 1863.8404082301404 0 -1.0759393680839922 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
740 739 P62258 YLAEFATGNDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29414 (Experiment 1) 29414 55.051 628.798218 2+ 2+ 1255.58331544131 0 -1.1389769100531506 98.91891891891892 Confident
|
|
|
741 740 P37802, Q9UI15 GASQAGMTGYGMPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23733 (Experiment 1) 23733 48.362 692.311707 2+ 2+ 1382.60710474434 0 1.2684490568798246 100.0 Confident
|
|
|
742 741 P10809 TVIIEQSWGSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33389 (Experiment 1) 33389 59.642 672.863708 2+ 2+ 1343.7085159544301 0 3.230316880318144 100.0 Confident
|
|
|
743 742 Q9UKV3 SHCFVTYSTVEEAVATR Phosphorylation of Y(7) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38166 (Experiment 1) 38166 65.338 679.631531 3+ 3+ 2035.8710567354206 0 0.8371524345638044 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Confident
|
|
|
744 743 Q96AP0 GLLLRPRPAKELPLPRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11602 (Experiment 1) 11602 31.457 489.569397 3+ 4+ 1953.2363696568002 1 4.474425294412242 88.23529411764706 Doubtful
|
|
|
745 744 P25705 TGAIVDVPVGEELLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45688 (Experiment 1) 45688 78.08 812.948486 2+ 2+ 1623.8831858411102 0 -0.47160083688899496 100.0 Confident
|
|
|
746 745 P61978 HESGASIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4038 (Experiment 1) 4038 16.601 414.713837 2+ 2+ 827.4137309350701 0 -0.7352880362158348 98.75621890547264 Confident
|
|
|
747 746 P49411 GITINAAHVEYSTAAR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27110 (Experiment 1) 27110 52.353 585.280701 3+ 3+ 1752.8196132159105 0 0.37610665605957466 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
748 747 O00507, Q93008 EIYTNLGPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25989 (Experiment 1) 25989 51.058 571.766357 2+ 2+ 1141.5168892818 0 1.1121553188153186 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 99.45652173913044 Confident
|
|
|
749 748 O15371 IFHTVTTTDDPVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26629 (Experiment 1) 26629 51.795 538.953796 3+ 3+ 1613.8413210291303 0 -1.0900301400989787 92.14285714285715 Doubtful
|
|
|
750 749 P78527 QGNLSSQVPLKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16791 (Experiment 1) 16791 39.318 442.921173 3+ 3+ 1325.7415474182103 0 0.10700276382912233 100.0 Confident
|
|
|
751 750 P61970 LSSLPFQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30350 (Experiment 1) 30350 56.133 460.265778 2+ 2+ 918.5174677276202 0 -0.5047746669099966 99.45799457994579 Confident
|
|
|
752 751 P08238, Q58FF8 SIYYITGESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28325 (Experiment 1) 28325 53.789 580.795288 2+ 2+ 1159.5761048025502 0 -0.07036572970662176 100.0 Confident
|
|
|
753 752 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21326 (Experiment 1) 21326 45.184 422.552094 3+ 3+ 1264.6339540318404 0 0.39329897765242516 100.0 Confident
|
|
|
754 753 P07195 GLTSVINQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22235 (Experiment 1) 22235 46.528 480.279999 2+ 2+ 958.5447451046202 0 0.7287022854590921 99.75247524752476 Confident
|
|
|
755 754 P40227, Q92526 TEVNSGFFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33390 (Experiment 1) 33390 59.643 596.289368 2+ 2+ 1190.5607890915803 0 2.8459206524497693 100.0 Confident
|
|
|
756 755 O43707 LSGSNPYTTVTPQIINSK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33709 (Experiment 1) 33709 60.011 1000.489685 2+ 2+ 1998.9663370192504 0 -0.7596038933662909 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
757 756 P22087 VSISEGDDKIEYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22646 (Experiment 1) 22646 47.027 504.251495 3+ 3+ 1509.7311018738103 0 1.0270849399527446 99.24812030075188 Confident
|
|
|
758 757 P08238, Q58FF7 IDIIPNPQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32920 (Experiment 1) 32920 59.104 597.826782 2+ 2+ 1193.6404363946103 0 -1.1920898982061912 100.0 Confident
|
|
|
759 758 Q16881 KVVYENAYGQFIGPHR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26127 (Experiment 1) 26127 51.22 653.649963 3+ 3+ 1956.9247469907903 1 -0.021546008942800742 Phosphorylation of Y (8: Random) Phosphorylation of Y (4: 0.0, 8: 0.0) Phosphorylation of Y (8: 0.17452006980802792) 0 Y8-{Y4 Y8} 1 100.0 Confident
|
|
|
760 759 P14625 FAFQAEVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30559 (Experiment 1) 30559 56.375 541.272949 2+ 2+ 1080.5352430500805 0 -3.600743096512179 100.0 Confident
|
|
|
761 760 P23396 GLCAIAQAESLR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35349 (Experiment 1) 35349 61.926 644.837646 2+ 2+ 1287.6605202161902 0 0.16969404937991173 100.0 Confident
|
|
|
762 761 P06493 SPEVLLGSAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26596 (Experiment 1) 26596 51.759 514.790344 2+ 2+ 1027.5662088251902 0 -0.07163965864883592 99.73190348525469 Confident
|
|
|
763 762 P13639 GHVFEESQVAGTPMFVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38376 (Experiment 1) 38376 65.603 654.66626 3+ 3+ 1960.9716835756806 0 2.681792912577746 100.0 Confident
|
|
|
764 763 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33448 (Experiment 1) 33448 59.71 652.024597 3+ 3+ 1953.0571274518006 0 -2.640922146173135 100.0 Confident
|
|
|
765 764 P33991 VNVTGIYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23941 (Experiment 1) 23941 48.642 461.261536 2+ 2+ 920.5079656730802 0 0.5998696884573392 96.75675675675676 Confident
|
|
|
766 765 P24752 NEQDAYAINSYTR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25962 (Experiment 1) 25962 51.028 812.834839 2+ 2+ 1623.6566302117403 0 -0.9258608875491785 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 5.977382875605816) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
767 766 Q13283, Q9UN86 VMEKPSPLLVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24425 (Experiment 1) 24425 49.24 442.592682 3+ 3+ 1324.75369232504 0 1.901130486927595 100.0 Confident
|
|
|
768 767 Q15691 LTVEDLEKER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29025 (Experiment 1) 29025 54.605 411.222321 3+ 3+ 1230.6455813447003 0 -0.36293828659549343 99.28057553956835 Confident
|
|
|
769 768 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31884 (Experiment 1) 31884 57.926 565.800293 2+ 2+ 1129.58800689893 0 -1.7442807432123055 100.0 Confident
|
|
|
770 769 P30740 EATTNAPFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15522 (Experiment 1) 15522 37.645 503.752136 2+ 2+ 1005.4879585044903 0 1.7474516101244593 99.74424552429667 Confident
|
|
|
771 770 P13804 TIYAGNALCTVK Phosphorylation of Y(3) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30497 (Experiment 1) 30497 56.303 695.825684 2+ 2+ 1389.6363527914805 0 0.332177339535664 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
772 771 P62841 EAPPMEKPEVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16062 (Experiment 1) 16062 38.424 451.907928 3+ 3+ 1352.7009880458406 0 0.7129434653013211 100.0 Confident
|
|
|
773 772 ALDOA_RABIT, P04075 ALSDHHIYLEGTLLKPNMVTPGHACTQK Phosphorylation of Y(8) Carbamidomethylation of C(25) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34634 (Experiment 1) 34634 61.097 803.641052 4+ 4+ 3210.5355401332404 0 -0.13625499472514274 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Doubtful
|
|
|
774 773 Q9P258 AVQDLCGWR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30347 (Experiment 1) 30347 56.13 552.767456 2+ 2+ 1103.51821308695 0 1.9411269316141697 99.1891891891892 Confident
|
|
|
775 774 P62805 VFLENVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39916 (Experiment 1) 39916 67.626 495.292419 2+ 2+ 988.5705659296402 0 -0.28353269073341003 99.1891891891892 Confident
|
|
|
776 775 P48643 VAIEHLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13269 (Experiment 1) 13269 34.108 462.76059 2+ 2+ 923.5076313199102 0 -1.0850669505344066 99.45799457994579 Confident
|
|
|
777 776 Q99436 DGIVLGADTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26497 (Experiment 1) 26497 51.646 508.772491 2+ 2+ 1015.5298233164701 0 0.5953056398290011 97.8319783197832 Confident
|
|
|
778 777 Q8WWM7 ISLAPTDVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24494 (Experiment 1) 24494 49.323 472.276123 2+ 2+ 942.5385970950204 0 -0.9570966379945898 99.46091644204851 Confident
|
|
|
779 778 P62318 VAQLEQVYIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32402 (Experiment 1) 32402 58.515 609.846985 2+ 2+ 1217.6768219033302 0 2.127721077041008 100.0 Confident
|
|
|
780 779 P07900 YYTSASGDEMVSLKDYCTR Carbamidomethylation of C(17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32552 (Experiment 1) 32552 58.69 749.330505 3+ 3+ 2244.96673441788 0 1.3128099186846096 100.0 Confident
|
|
|
781 780 P35232 VLPSITTEILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43383 (Experiment 1) 43383 73.102 607.375427 2+ 2+ 1212.7329397971203 0 2.767051815794577 99.73045822102425 Confident
|
|
|
782 781 P22626 NYYEQWGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28167 (Experiment 1) 28167 53.603 584.23053 2+ 2+ 1166.4433899883702 0 2.667685238159893 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 3.664921465968586) 0 Y2-{Y2 Y3} 1 100.0 Confident
|
|
|
783 782 P60842 GVAINMVTEEDKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23588 (Experiment 1) 23588 48.174 487.91684 3+ 3+ 1460.7293280520003 0 -0.4354923533708005 99.24812030075188 Confident
|
|
|
784 783 P07900, P08238 SLTNDWEDHLAVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35399 (Experiment 1) 35399 61.983 509.9198 3+ 3+ 1526.7365216074204 0 0.6857240837348273 100.0 Confident
|
|
|
785 784 O94788, P00352, P05091, P30837, P30838, P43353, P47895, P48448, P49189, P51648 VTLELGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24795 (Experiment 1) 24795 49.669 408.744812 2+ 2+ 815.4752685624701 0 -0.24158844399939042 100.0 Confident
|
|
|
786 785 P13639 IMGPNYTPGKKEDLYLKPIQR Phosphorylation of Y(15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28991 (Experiment 1) 28991 54.566 636.078552 4+ 4+ 2540.2862316709807 0 -0.4439458476369734 Phosphorylation of Y (15: Doubtfull) Phosphorylation of Y (15: 4.289952059198672) Phosphorylation of Y (15: 3.664921465968586) 0 Y15-{Y6 Y15} 1 100.0 Doubtful
|
|
|
787 786 B2RXH8, B7ZW38, O60812, P07910 SDVEAIFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33770 (Experiment 1) 33770 60.079 498.256104 2+ 2+ 994.4971262058602 0 0.5307118089023717 100.0 Confident
|
|
|
788 787 O00231 TYHALSNLPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18865 (Experiment 1) 18865 42.126 612.295105 2+ 2+ 1222.5747385110903 0 0.7500925346946685 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
789 788 Q14019 EVVQNFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17525 (Experiment 1) 17525 40.324 467.754242 2+ 2+ 933.4919812557703 0 2.08422980974138 99.72826086956522 Confident
|
|
|
790 789 P62899 EYTINIHKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13575 (Experiment 1) 13575 34.602 391.883911 3+ 3+ 1172.6302060640803 0 -0.2572738422590702 100.0 Confident
|
|
|
791 790 Q9UBQ0 VVTVGQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23036 (Experiment 1) 23036 47.49 439.260529 2+ 2+ 876.5069030439204 0 -0.45300833752574104 99.72972972972973 Confident
|
|
|
792 791 Q01469 FEETTADGRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6898 (Experiment 1) 6898 22.025 385.187836 3+ 3+ 1152.5411162761602 0 0.486622910382852 99.28057553956835 Confident
|
|
|
793 792 GSTP1_HUMAN, P09211 FQDGDLTLYQSNTILR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44354 (Experiment 1) 44354 75.028 655.311768 3+ 3+ 1962.9088221431302 0 2.3665414801485856 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
794 793 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33950 (Experiment 1) 33950 60.291 932.895447 2+ 2+ 1863.7750310922602 0 0.7021017411995658 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 70.58040127411856) 0 Y6-{Y6 Y11} 1 92.63959390862944 Doubtful
|
|
|
795 794 P00558, P07205 LGDVYVNDAFGTAHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33060 (Experiment 1) 33060 59.264 817.904907 2+ 2+ 1633.7848687821704 0 6.353030859069778 99.73190348525469 Doubtful
|
|
|
796 795 P68363, Q71U36, Q9BQE3 EIIDLVLDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46424 (Experiment 1) 46424 79.452 543.309998 2+ 2+ 1084.61282466444 0 -6.793127263737364 99.72972972972973 Doubtful
|
|
|
797 796 P11142 MKEIAEAYLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26028 (Experiment 1) 26028 51.105 418.225861 3+ 3+ 1251.6533095774303 0 1.9479322239251131 98.49624060150376 Confident
|
|
|
798 797 P31146 KGTVVAEKDRPHEGTRPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5520 (Experiment 1) 5520 19.138 427.23938 5+ 5+ 2131.1610324400604 0 -0.2409768482679639 100.0 Doubtful
|
|
|
799 798 P15311, P26038, P35241 APDFVFYAPR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44653 (Experiment 1) 44653 75.791 631.782776 2+ 2+ 1261.5532747905202 0 -1.801030458635621 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
800 799 O75083 IAVVGEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14632 (Experiment 1) 14632 36.241 400.734528 2+ 2+ 799.45520182423 0 -0.8718455684234289 99.73262032085562 Confident
|
|
|
801 800 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21931 (Experiment 1) 21931 46.141 673.305054 2+ 2+ 1344.6002845525904 0 -3.5121298851344958 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.33452891645359) Phosphorylation of Y (9: 37.95148962324529) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
802 801 P22626 GFGFVTFDDHDPVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42253 (Experiment 1) 42253 71.119 565.926636 3+ 3+ 1694.75765097482 0 0.25187296051294766 100.0 Confident
|
|
|
803 802 Q9NYK5 DAHALIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18300 (Experiment 1) 18300 41.404 505.741058 2+ 2+ 1009.4633971569604 0 4.118635918235883 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.33507853403141) Y7 1 0 99.49874686716792 Confident
|
|
|
804 803 A3KMH1 EVEYIALSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31101 (Experiment 1) 31101 57.005 580.271973 2+ 2+ 1158.5322049927702 0 -2.4229324455135135 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.38219895287958) Y4 1 0 99.19786096256684 Confident
|
|
|
805 804 P52272 DKFNECGHVLYADIK Phosphorylation of Y(11) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29188 (Experiment 1) 29188 54.792 630.281921 3+ 3+ 1887.8226499910204 0 0.6788546374496953 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
806 805 P00519 AGENRSDQVTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4564 (Experiment 1) 4564 17.259 411.53772 3+ 3+ 1231.59052608007 0 0.6516373258935197 100.0 Confident
|
|
|
807 806 Q96M27 QMIYSAAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16057 (Experiment 1) 16057 38.417 510.223083 2+ 2+ 1018.4307171296903 0 0.8779860243848991 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 84.29319371727748) Y4 1 0 92.74611398963731 Confident
|
|
|
808 807 P37837 LVPVLSAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26711 (Experiment 1) 26711 51.89 413.773071 2+ 2+ 825.5323895157703 0 -0.9672555756609114 99.7289972899729 Confident
|
|
|
809 808 Q63HK5 EKAVTDEKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34005 (Experiment 1) 34005 60.361 572.814209 2+ 2+ 1143.6135529404303 0 0.27244962303512454 99.1869918699187 Confident
|
|
|
810 809 Q13162 DYGVYLEDSGHTLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32678 (Experiment 1) 32678 58.832 852.866943 2+ 2+ 1703.7192304683003 0 0.060148937951888276 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 16.666495241286455) Phosphorylation of Y (2: 24.88207912892212) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
811 810 P31153 TAAYGHFGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11481 (Experiment 1) 11481 31.294 530.223938 2+ 2+ 1058.4334940110102 0 -0.1612003859235563 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
812 811 P07900, Q58FG0 HIYYITGETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19792 (Experiment 1) 19792 43.28 408.879303 3+ 3+ 1223.6186383208703 0 -2.08595865999466 100.0 Confident
|
|
|
813 812 P04406 VGVNGFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20130 (Experiment 1) 20130 43.705 403.219666 2+ 2+ 804.42423604912 0 0.6733521049360991 99.73190348525469 Confident
|
|
|
814 813 Q9NSI2 QARSRESNKPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26216 (Experiment 1) 26216 51.322 664.856323 2+ 2+ 1327.7068932449902 0 -6.618061729887234 96.24664879356568 Doubtful
|
|
|
815 814 P15259, P18669, Q8N0Y7 HYGGLTGLNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16894 (Experiment 1) 16894 39.448 570.266052 2+ 2+ 1138.5172236349702 0 0.2870866137368269 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
816 815 P18621 QWGWTQGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31298 (Experiment 1) 31298 57.235 509.746429 2+ 2+ 1017.4780625271301 0 0.23790191540558284 99.7289972899729 Confident
|
|
|
817 816 Q15365 QGANINEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16538 (Experiment 1) 16538 39.003 507.769684 2+ 2+ 1013.5254066423702 0 -0.5825236009115128 99.7289972899729 Confident
|
|
|
818 817 P31949 DGYNYTLSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20739 (Experiment 1) 20739 44.404 570.734253 2+ 2+ 1139.4536203189004 0 0.2915083251006231 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 11.207454373355382) Phosphorylation of Y (5: 87.68580895544247) 0 Y5-{Y3 Y5} 1 99.45945945945947 Confident
|
|
|
819 818 Q9UQ80 LVKPGNQNTQVTEAWNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20559 (Experiment 1) 20559 44.197 643.004822 3+ 3+ 1925.9959241775707 0 -1.7042756608312097 100.0 Confident
|
|
|
820 819 Q9Y277 GYGFGMVK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32528 (Experiment 1) 32528 58.664 469.696411 2+ 2+ 937.3768906516802 0 1.4673485747361112 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 99.72826086956522 Confident
|
|
|
821 820 P42167 RVEHNQSYSQAGITETEWTSGSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22091 (Experiment 1) 22091 46.344 671.315552 4+ 4+ 2681.2317503203208 0 0.5034194081831908 100.0 Doubtful
|
|
|
822 821 P05388, Q8NHW5 CFIVGADNVGSK Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28616 (Experiment 1) 28616 54.131 633.810547 2+ 2+ 1265.60742201417 0 -0.6949609674182584 99.45799457994579 Confident
|
|
|
823 822 Q00059 SAYNVYVAER Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24844 (Experiment 1) 24844 49.725 626.27478 2+ 2+ 1250.5332676219305 0 1.3887249786189775 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 10.504952121481434) Phosphorylation of Y (3: 96.68411867364746) 0 Y3-{Y3 Y6} 1 99.46524064171123 Confident
|
|
|
824 823 P62861 FVNVVPTFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40174 (Experiment 1) 40174 67.975 554.313416 2+ 2+ 1106.61243074162 0 -0.13681359603379703 100.0 Confident
|
|
|
825 824 P07900, Q58FG0 HIYYITGETK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21939 (Experiment 1) 21939 46.149 435.53537 3+ 3+ 1303.5849688416204 0 -0.5267399934995521 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 2.197994287921463) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
826 825 P68104, Q05639, Q5VTE0 THINIVVIGHVDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26551 (Experiment 1) 26551 51.707 397.975372 4+ 4+ 1587.8732898637504 0 -0.5702177476082708 100.0 Doubtful
|
|
|
827 826 Q15651 LSAKPAPPKPEPKPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6977 (Experiment 1) 6977 22.199 403.993988 4+ 4+ 1611.9460608811903 0 0.4859304634104072 100.0 Doubtful
|
|
|
828 827 P30153 VLELDNVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26828 (Experiment 1) 26828 52.027 465.268829 2+ 2+ 928.5229470308802 0 0.16983248479624394 98.91598915989161 Confident
|
|
|
829 828 P26641 ALIAAQYSGAQVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26544 (Experiment 1) 26544 51.699 714.355469 2+ 2+ 1426.6969789020902 0 -0.4156442369181032 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
830 829 Q14152 EDAPIGPHLQSMPSEQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30810 (Experiment 1) 30810 56.663 668.997498 3+ 3+ 2003.9734744808302 0 -1.4000437673652009 100.0 Confident
|
|
|
831 830 Q00610 LASTLVHLGEYQAAVDGAR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37967 (Experiment 1) 37967 65.095 684.33728 3+ 3+ 2049.9884694461603 0 0.7506798208896978 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
832 831 P18124 TTHFVEGGDAGNREDQINR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13740 (Experiment 1) 13740 34.85 529.75061 4+ 4+ 2114.97295688686 0 0.17802997853184085 100.0 Doubtful
|
|
|
833 832 Q06830 ADEGISFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23781 (Experiment 1) 23781 48.426 447.719757 2+ 2+ 893.4242956187702 0 0.7431524854957233 99.72826086956522 Confident
|
|
|
834 833 Q92598 FICEQDHQNFLR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26713 (Experiment 1) 26713 51.892 536.253174 3+ 3+ 1605.7358104147704 0 1.1699616815163647 99.37888198757764 Confident
|
|
|
835 834 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10246 (Experiment 1) 10246 29.097 607.758423 2+ 2+ 1213.5016331404804 0 0.5429182293041148 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
836 835 P25787 HIGLVYSGMGPDYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32251 (Experiment 1) 32251 58.343 522.257324 3+ 3+ 1563.75039784975 0 -0.16291467359547632 100.0 Confident
|
|
|
837 836 P16403 KPAAATVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4139 (Experiment 1) 4139 16.712 443.771332 2+ 2+ 885.5283667644901 0 -0.2880966186527557 100.0 Confident
|
|
|
838 837 Q13263 LIYFQLHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39048 (Experiment 1) 39048 66.418 390.534058 3+ 3+ 1168.5794299687102 0 0.7806673529912854 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.65095986038395) Y3 1 0 99.37888198757764 Confident
|
|
|
839 838 Q13151 AVPKEDIYSGGGGGGSR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12685 (Experiment 1) 12685 33.239 843.877686 2+ 2+ 1685.7410285420399 0 -0.12411492887355514 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
840 839 Q02790 MEKGEHSIVYLKPSYAFGSVGK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35221 (Experiment 1) 35221 61.778 836.408386 3+ 3+ 2506.1967479602404 0 2.622585127704876 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 5.144382828771395) Phosphorylation of Y (10: 56.980802792321114) 0 Y10-{Y10 Y15} 1 92.14285714285715 Doubtful
|
|
|
841 840 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26863 (Experiment 1) 26863 52.068 565.215698 2+ 2+ 1128.4165065341901 0 0.29770252934730684 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 38.749371984659035) Phosphorylation of Y (6: 90.04350797544515) 0 Y6-{Y2 Y6} 1 100.0 Confident
|
|
|
842 841 P14868 GEEILSGAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18347 (Experiment 1) 18347 41.468 530.275208 3+ 2+ 1058.5356369729002 0 0.21318507870256 99.45652173913044 Confident
|
|
|
843 842 P10809 VGGTSDVEVNEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12041 (Experiment 1) 12041 32.176 617.301147 2+ 2+ 1232.5884603914003 0 -0.5826366991302554 100.0 Confident
|
|
|
844 843 P62805 TVTAMDVVYALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46360 (Experiment 1) 46360 79.357 655.85498 2+ 2+ 1309.6951743894106 0 0.17738449319278496 100.0 Confident
|
|
|
845 844 P25205 SKDIFDQLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32253 (Experiment 1) 32253 58.345 582.817078 2+ 2+ 1163.6186383208703 0 0.8276578882933471 96.19565217391303 Confident
|
|
|
846 845 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38943 (Experiment 1) 38943 66.284 621.325012 3+ 3+ 1860.9498991094704 0 1.7744314696262862 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 100.0 Confident
|
|
|
847 846 O95758, P26599, Q9UKA9 VTNILMLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39168 (Experiment 1) 39168 66.57 466.28598 2+ 2+ 930.5572243646202 0 0.19591173604311704 100.0 Confident
|
|
|
848 847 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44567 (Experiment 1) 44567 75.594 918.969299 2+ 2+ 1835.9222873793005 0 0.956337038747137 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
849 848 P13010 ANPQVGVAFPHIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30632 (Experiment 1) 30632 56.458 459.925568 3+ 3+ 1376.7564692063604 0 -1.1556978378016312 100.0 Confident
|
|
|
850 849 Q9UKK9 TTYMDPTGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14598 (Experiment 1) 14598 36.188 547.216248 2+ 2+ 1092.41987766247 0 -1.7676674273321882 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.30191972076788) Y3 1 0 99.45652173913044 Confident
|
|
|
851 850 P33991 AGIICQLNAR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28404 (Experiment 1) 28404 53.883 558.303162 2+ 2+ 1114.5917123803802 0 0.052557465961887116 100.0 Confident
|
|
|
852 851 O00487 HYYSITINYR Phosphorylation of Y(2, 3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32882 (Experiment 1) 32882 59.062 745.299561 2+ 2+ 1488.5839964729803 0 0.3841365576757548 Phosphorylation of Y (2: Confident, 3: Doubtfull) Phosphorylation of Y (2: 100.0, 3: 75.39267015706807) Y2 1 Y3-{Y3} 1 100.0 Confident
|
|
|
853 852 Q8WXX5 VYSVLSDR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24682 (Experiment 1) 24682 49.539 509.732941 2+ 2+ 1017.4532263960803 0 -1.861098254085212 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.50959860383944) Y2 1 0 99.45652173913044 Confident
|
|
|
854 853 P27348 YDDMATCMK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19511 (Experiment 1) 19511 42.924 567.718262 2+ 2+ 1133.41915286229 0 2.4820507541605425 100.0 Confident
|
|
|
855 854 P18124 AGNFYVPAEPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28197 (Experiment 1) 28197 53.643 596.80249 2+ 2+ 1191.5924235730304 0 -1.6726667100197934 99.72826086956522 Confident
|
|
|
856 855 Q9UKY7 KTPQGPPEIYSDTQFPSLQSTAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37158 (Experiment 1) 37158 64.115 867.414856 3+ 3+ 2599.2207137786104 0 0.7781061603089627 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
857 856 O14745 LVEPGSPAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12790 (Experiment 1) 12790 33.422 513.777283 2+ 2+ 1025.5393253710104 0 0.6692548001943704 99.73118279569893 Confident
|
|
|
858 857 P06576 IMDPNIVGSEHYDVAR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30756 (Experiment 1) 30756 56.6 632.616943 3+ 3+ 1894.8284636474505 0 0.28239957354533973 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 100.0) Y12 1 0 100.0 Confident
|
|
|
859 858 Q8WUM4 HYQFASGAFLHIK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35189 (Experiment 1) 35189 61.739 533.589172 3+ 3+ 1597.7442634476804 0 0.8890442457348536 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
860 859 P40937 VTEETVYTCTGHPLK Phosphorylation of Y(7) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19768 (Experiment 1) 19768 43.249 907.907227 2+ 2+ 1813.7957665368406 0 2.276961140167526 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 95.28795811518324) Y7 1 0 94.90616621983914 Doubtful
|
|
|
861 860 P26038 KTANDMIHAENMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14472 (Experiment 1) 14472 36.012 510.910065 3+ 3+ 1529.7078814147703 0 0.31589704964483345 100.0 Confident
|
|
|
862 861 P48047 SFLSQGQVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32554 (Experiment 1) 32554 58.692 553.813538 2+ 2+ 1105.6131590176103 0 -0.5741561244899367 91.08108108108108 Confident
|
|
|
863 862 Q9UKY7 KTPQGPPEIYSDTQFPSLQSTAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36935 (Experiment 1) 36935 63.851 867.414978 3+ 3+ 2599.2207137786104 0 0.9187540799498407 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
864 863 P54577 NSVEVALNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18227 (Experiment 1) 18227 41.304 487.269287 2+ 2+ 972.5240096600401 0 0.01170434551779049 99.7289972899729 Confident
|
|
|
865 864 O95758 SQPVYIQYSNHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20613 (Experiment 1) 20613 44.26 524.572021 3+ 3+ 1570.6929561508102 0 0.8117409618025303 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 17.571249873983163) Phosphorylation of Y (5: 0.34904013961605584) 0 Y5-{Y5 Y8} 1 100.0 Confident
|
|
|
866 865 P45880 WCEYGLTFTEK Phosphorylation of Y(4) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42743 (Experiment 1) 42743 71.979 757.307678 2+ 2+ 1512.5996329295901 0 0.7725642587088363 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 90.40139616055846) Y4 1 0 91.30434782608697 Doubtful
|
|
|
867 866 O43665 AKEIYMTFLSSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39720 (Experiment 1) 39720 67.355 499.906616 3+ 3+ 1496.6986186948702 0 -0.40013811045446357 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.38219895287958) Y5 1 0 92.14285714285715 Doubtful
|
|
|
868 867 P00338 DYNVTANSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11758 (Experiment 1) 11758 31.721 506.241089 2+ 2+ 1010.4668887067403 0 0.7272821065967794 100.0 Confident
|
|
|
869 868 Q15366 IITLAGPTNAIFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44569 (Experiment 1) 44569 75.597 679.906189 2+ 2+ 1357.7969370360104 0 0.6530540241122424 99.73045822102425 Confident
|
|
|
870 869 P26599 HQNVQLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11632 (Experiment 1) 11632 31.516 496.274872 2+ 2+ 990.5359117564201 0 -0.7260991451975798 100.0 Confident
|
|
|
871 870 Q8NBX0 SAIYGFGDQSNLR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35187 (Experiment 1) 35187 61.737 754.333557 2+ 2+ 1506.65042263249 0 1.4174345666590238 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
872 871 P55084 AALTGLLHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27272 (Experiment 1) 27272 52.543 476.29126 2+ 2+ 950.5661492555403 0 1.9083011357275672 100.0 Confident
|
|
|
873 872 P26641 KLDPGSEETQTLVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20460 (Experiment 1) 20460 44.084 524.947021 3+ 3+ 1571.8155002041105 0 2.3706546594543347 100.0 Confident
|
|
|
874 873 O43684 LYDVPANSMR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25315 (Experiment 1) 25315 50.274 623.270569 2+ 2+ 1244.5260740665103 0 0.40993438522121023 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
875 874 Q92905 GYKPPDEGPSEYQTIPLNK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27879 (Experiment 1) 27879 53.262 738.344543 3+ 3+ 2212.0089301072203 0 1.2954638807175587 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 23.641702321696215) Phosphorylation of Y (12: 0.6980802792321117) 0 Y12-{Y2 Y12} 1 100.0 Confident
|
|
|
876 875 P10768 SGYHQSASEHGLVVIAPDTSPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23524 (Experiment 1) 23524 48.092 578.038757 4+ 4+ 2307.124372147821 1 -0.7809316370671323 100.0 Doubtful
|
|
|
877 876 P29692 IASLEVENQSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28873 (Experiment 1) 28873 54.433 679.868164 2+ 2+ 1357.7201432672905 0 1.2000863770527983 100.0 Confident
|
|
|
878 877 P00558, P07205 VSHVSTGGGASLELLEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31664 (Experiment 1) 31664 57.668 580.975891 3+ 3+ 1739.9053778376701 0 0.26722968806276587 100.0 Confident
|
|
|
879 878 P13639 GPLMMYISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38615 (Experiment 1) 38615 65.888 520.270142 2+ 2+ 1038.5242099841803 0 1.4618217501382385 100.0 Confident
|
|
|
880 879 P61204, P84077 QDLPNAMNAAEITDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33529 (Experiment 1) 33529 59.806 815.88916 2+ 2+ 1629.7668357595305 0 -1.8805785971312328 99.45799457994579 Confident
|
|
|
881 880 P78371 TVYGGGCSEMLMAHAVTQLANR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43588 (Experiment 1) 43588 73.405 789.373169 3+ 3+ 2365.0977061011204 0 -0.012035522815245161 94.77611940298507 Confident
|
|
|
882 881 P14625 SGTSEFLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19329 (Experiment 1) 19329 42.7 491.746307 2+ 2+ 981.4767251144501 0 1.358376994067537 99.72972972972973 Confident
|
|
|
883 882 Q7KZ85 VSDGIYQHVDVR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20462 (Experiment 1) 20462 44.087 489.893494 3+ 3+ 1466.6555080129303 0 2.1396442290342237 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
884 883 P00519, P42684 YSLTVAVK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26546 (Experiment 1) 26546 51.702 480.743286 2+ 2+ 959.4728992115004 0 -0.915399490958009 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 99.82547993019197) Y1 1 0 100.0 Confident
|
|
|
885 884 Q8NC51 RFEKPLEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9035 (Experiment 1) 9035 26.692 392.55188 3+ 3+ 1174.6346227381803 0 -0.6896226950509515 99.28057553956835 Confident
|
|
|
886 885 P19623 ESYYQLMK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34279 (Experiment 1) 34279 60.686 571.236023 2+ 2+ 1140.4562631711904 0 1.0765221905461897 Phosphorylation of Y (4: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (4: 1.2216404886561953) 0 Y4-{Y3 Y4} 1 99.72972972972973 Confident
|
|
|
887 886 P08238, Q58FF8 SIYYITGESK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30763 (Experiment 1) 30763 56.607 620.77887 2+ 2+ 1239.5424353233002 0 0.6054841483197677 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.16155088852988692) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
888 887 P62263 IEDVTPIPSDSTRR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20941 (Experiment 1) 20941 44.641 529.277222 3+ 3+ 1584.81074917684 0 -0.5747314221613763 100.0 Confident
|
|
|
889 888 Q9UI08 INIYHNTASNTFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23154 (Experiment 1) 23154 47.629 544.250488 3+ 3+ 1629.7300699355208 0 -0.26662713238037566 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
890 889 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44160 (Experiment 1) 44160 74.493 624.290527 3+ 3+ 1869.85097291384 0 -0.6521074332894065 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
891 890 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21589 (Experiment 1) 21589 45.626 673.307434 2+ 2+ 1344.6002845525904 0 0.022659623565177228 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.33452891645359) Phosphorylation of Y (9: 18.093699515347332) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
892 891 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27417 (Experiment 1) 27417 52.715 609.257202 2+ 2+ 1216.5053215385904 0 -4.4894402866041405 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.714203795409155) Phosphorylation of Y (6: 0.1745200698080279) 0 Y8-{Y3 Y6 Y8} 1 99.45652173913044 Doubtful
|
|
|
893 892 O15144 DNTINLIHTFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38085 (Experiment 1) 38085 65.241 672.356689 2+ 2+ 1342.6993482530604 0 -0.38906914264058706 100.0 Confident
|
|
|
894 893 P14866 NDQDTWDYTNPNLSGQGDPGSNPNKR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27657 (Experiment 1) 27657 53.003 990.750061 3+ 3+ 2969.22133546679 0 2.361224295665406 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
895 894 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15866 (Experiment 1) 15866 38.156 514.763 2+ 2+ 1027.5120650773501 0 -0.6002865427760832 100.0 Confident
|
|
|
896 895 O75874 HAYGDQYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7467 (Experiment 1) 7467 23.419 545.211121 2+ 2+ 1088.4076731859902 0 0.014563519834008897 Phosphorylation of Y (7: Random) Phosphorylation of Y (3: 0.0, 7: 0.0) Phosphorylation of Y (7: 28.272251308900525) 0 Y7-{Y3 Y7} 1 99.72826086956522 Confident
|
|
|
897 896 P07900 NPDDITNEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35266 (Experiment 1) 35266 61.83 957.372314 2+ 2+ 1912.7404194053506 0 -5.4024348411589 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 14: 0.0) Phosphorylation of Y (10: 51.976392724998696) 0 Y10-{Y10 Y14} 1 99.45652173913044 Doubtful
|
|
|
898 897 P06576 VVDLLAPYAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40999 (Experiment 1) 40999 69.174 544.820862 2+ 2+ 1087.6277464525904 0 -0.5280505490419202 100.0 Confident
|
|
|
899 898 P23528 MLPDKDCR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8190 (Experiment 1) 8190 24.843 517.73999 2+ 2+ 1033.46848601321 0 -2.954125484399953 95.13513513513514 Confident
|
|
|
900 899 P46782 QAVDVSPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22690 (Experiment 1) 22690 47.079 492.777771 2+ 2+ 983.53999407735 0 1.009572761896888 100.0 Confident
|
|
|
901 900 Q14566 VFEMSQDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18940 (Experiment 1) 18940 42.221 492.228271 2+ 2+ 982.4429824580202 0 -1.009075159048069 96.4769647696477 Confident
|
|
|
902 901 Q14240 GFKDQIYEIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46283 (Experiment 1) 46283 79.242 532.588623 3+ 3+ 1594.7432603881705 0 0.4876883331963756 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
903 902 P83881, Q969Q0 HFELGGDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14345 (Experiment 1) 14345 35.808 451.721771 2+ 2+ 901.42938099921 0 -0.4338208706070914 100.0 Confident
|
|
|
904 903 Q86UX7 TGSGGPGNHPHGPDASAEGLNPYGLVAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31539 (Experiment 1) 31539 57.518 696.337158 4+ 4+ 2781.3219027374003 0 -0.8532514002793928 100.0 Doubtful
|
|
|
905 904 P63220 TYAICGAIR Phosphorylation of Y(2) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27278 (Experiment 1) 27278 52.549 552.749451 2+ 2+ 1103.48348097854 0 0.7852459337492462 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
906 905 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45228 (Experiment 1) 45228 77.057 936.431946 2+ 2+ 1869.85097291384 1 -2.665087419617665 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 95.15347334410339) Y2 1 0 94.03794037940379 Confident
|
|
|
907 906 P38159, Q96E39 YDDYSSSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8003 (Experiment 1) 8003 24.458 536.68396 2+ 2+ 1071.3546345536201 0 -1.1808492913271886 Phosphorylation of Y (4: Random) Phosphorylation of Y (1: 0.0, 4: 0.0) Phosphorylation of Y (4: 97.38219895287958) 0 Y4-{Y1 Y4} 1 99.47506561679789 Confident
|
|
|
908 907 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGRPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29545 (Experiment 1) 29545 55.201 599.856689 2+ 2+ 1197.69822605425 0 0.499296278488474 100.0 Confident
|
|
|
909 908 P61978 RPAEDMEEEQAFKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15813 (Experiment 1) 15813 38.073 579.272034 3+ 3+ 1734.7995328701406 0 -3.0269340053195717 100.0 Confident
|
|
|
910 909 O60488 IGYSSPLTLSDQSSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33115 (Experiment 1) 33115 59.328 831.889465 2+ 2+ 1661.7549472706803 0 5.667729631020478 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 85.16579406631763) Y3 1 0 97.56756756756756 Doubtful
|
|
|
911 910 P00519, P42684, P53671, Q06418 VADFGLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27539 (Experiment 1) 27539 52.859 432.732361 2+ 2+ 863.4501164437902 0 0.06080269686589673 99.73190348525469 Confident
|
|
|
912 911 P63010, Q10567 RNVEGQDMLYQSLK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31486 (Experiment 1) 31486 57.455 587.606995 3+ 3+ 1759.7964352431802 0 1.543185952968179 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 91.7975567190227) Y10 1 0 92.56756756756756 Doubtful
|
|
|
913 912 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28689 (Experiment 1) 28689 54.215 899.928406 2+ 2+ 1797.84107693648 0 0.6567915093885646 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
914 913 P61158 DYEEIGPSICR Phosphorylation of Y(2) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31022 (Experiment 1) 31022 56.912 709.786377 2+ 2+ 1417.5584963936 0 -0.2080394695671783 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
915 914 P42765 ETPALTINR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22482 (Experiment 1) 22482 46.833 507.782471 2+ 2+ 1013.5505587610503 0 -0.16709383995887553 99.19354838709677 Confident
|
|
|
916 915 Q9Y230 GTSYQSPHGIPIDLLDR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43128 (Experiment 1) 43128 72.656 650.310669 3+ 3+ 1947.9091564963 0 0.5233928166121435 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 100.0 Confident
|
|
|
917 916 P12004 MPSGEFAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18221 (Experiment 1) 18221 41.295 447.711884 2+ 2+ 893.4065373796502 0 2.990421774545893 95.39295392953929 Confident
|
|
|
918 917 P04406 VVDLMAHMASKE ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29027 (Experiment 1) 29027 54.607 665.828369 2+ 2+ 1329.6420932707306 0 0.0689334187137909 99.45799457994579 Confident
|
|
|
919 918 P05141 AAYFGIYDTAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39437 (Experiment 1) 39437 66.951 650.285889 2+ 2+ 1298.5584197406101 0 -0.9185753197898886 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 18.111436865187635) Phosphorylation of Y (7: 98.60383944153578) 0 Y7-{Y3 Y7} 1 98.91304347826086 Confident
|
|
|
920 919 Q13733 QKRNMEELKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29859 (Experiment 1) 29859 55.564 435.241364 3+ 3+ 1302.7078047617804 0 -4.244494473729416 92.14285714285715 Doubtful
|
|
|
921 920 Q9Y2S6 GPLATGGIKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9964 (Experiment 1) 9964 28.494 471.293396 2+ 2+ 940.5705659296402 0 1.775051082729957 99.45652173913044 Confident
|
|
|
922 921 Q9H0A0 AGPNASIISLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31225 (Experiment 1) 31225 57.149 535.813538 2+ 2+ 1069.61315901761 0 -0.5934441850950779 99.45945945945947 Confident
|
|
|
923 922 Q7L1Q6 FLDASGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15471 (Experiment 1) 15471 37.574 404.713898 2+ 2+ 807.4126683059103 0 0.710082945869172 99.45799457994579 Confident
|
|
|
924 923 P05388, Q8NHW5 IIQLLDDYPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41925 (Experiment 1) 41925 70.561 609.344055 2+ 2+ 1216.6703395405602 0 2.6401622236729327 100.0 Confident
|
|
|
925 924 P40939 VIGMHYFSPVDK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36599 (Experiment 1) 36599 63.446 736.839172 2+ 2+ 1471.6570882360604 0 4.548387936706055 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.46236559139786 Confident
|
|
|
926 925 P53611 HADYIASYGSK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17650 (Experiment 1) 17650 40.495 646.271179 2+ 2+ 1290.5281822414904 0 -0.29180862216124315 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 9.112014798223164) Phosphorylation of Y (4: 9.07504363001745) 0 Y8-{Y4 Y8} 1 100.0 Confident
|
|
|
927 926 Q8NC51 SEEAHAEDSVMDHHFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17560 (Experiment 1) 17560 40.368 474.953522 4+ 4+ 1895.7856737111506 0 -0.364024117512513 100.0 Doubtful
|
|
|
928 927 P62424 TNYNDRYDEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17442 (Experiment 1) 17442 40.211 486.891663 3+ 3+ 1457.6535202594503 0 -0.24691310515783824 100.0 Confident
|
|
|
929 928 Q9NWQ8 AEFAEYASVDR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27792 (Experiment 1) 27792 53.165 669.27478 2+ 2+ 1336.5336615447502 0 1.0052096824207428 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
930 929 P62917 AVVGVVAGGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16853 (Experiment 1) 16853 39.397 471.280243 2+ 2+ 940.5454138109601 0 0.5508990772709221 100.0 Confident
|
|
|
931 930 Q9H910 GSGIFDESTPVQTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31144 (Experiment 1) 31144 57.055 747.368958 2+ 2+ 1492.7157861628402 0 5.069077235860755 99.73614775725594 Doubtful
|
|
|
932 931 O43684 LYDVPANSMR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25089 (Experiment 1) 25089 50.011 623.270386 2+ 2+ 1244.5260740665103 0 0.1163218129088005 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
933 932 Q15181 AAPFSLEYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35788 (Experiment 1) 35788 62.451 527.272705 2+ 2+ 1052.5290950404801 0 1.6708894876677653 99.73045822102425 Confident
|
|
|
934 933 P30049 IEANEALVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19366 (Experiment 1) 19366 42.744 493.780212 2+ 2+ 985.5444107514504 0 1.4787116307778048 93.78378378378378 Confident
|
|
|
935 934 P07737 SSFYVNGLTLGGQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43385 (Experiment 1) 43385 73.104 775.86499 2+ 2+ 1549.7177739163203 0 -1.5124064271781366 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
936 935 P19338 ALELTGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31931 (Experiment 1) 31931 57.979 422.760773 2+ 2+ 843.5065686907501 0 0.5019101416536907 99.45799457994579 Confident
|
|
|
937 936 P68363, Q71U36, Q9BQE3 EIIDLVLDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46287 (Experiment 1) 46287 79.252 543.313477 2+ 2+ 1084.61282466444 0 -0.38982826390156067 100.0 Confident
|
|
|
938 937 P13639 NMSVIAHVDHGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13654 (Experiment 1) 13654 34.728 436.556793 3+ 3+ 1306.6452045052204 0 2.554156329149634 100.0 Confident
|
|
|
939 938 P11586 IFHELTQTDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17401 (Experiment 1) 17401 40.155 411.216309 3+ 3+ 1230.6244519773002 0 2.1445549699231075 96.71052631578947 Confident
|
|
|
940 939 P30041 VVFVFGPDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32000 (Experiment 1) 32000 58.058 568.328918 2+ 2+ 1134.6437308699003 0 -0.39396495037013957 100.0 Confident
|
|
|
941 940 P17987 GANDFMCDEMER Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32991 (Experiment 1) 32991 59.187 737.774231 2+ 2+ 1473.53228512157 0 1.1005715059884682 100.0 Confident
|
|
|
942 941 GSTP1_HUMAN, P09211 FQDGDLTLYQSNTILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43605 (Experiment 1) 43605 73.432 942.478027 2+ 2+ 1882.9424916223802 0 -0.5255058767595501 99.47916666666666 Confident
|
|
|
943 942 O15173 EKYDYVGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11527 (Experiment 1) 11527 31.354 555.237 2+ 2+ 1108.45904005251 0 0.3665227775498875 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 5: 0.0) Phosphorylation of Y (3: 44.54167124324193) 0 Y3-{Y3 Y5} 1 99.73890339425587 Confident
|
|
|
944 943 Q04837 SGDSEVYQLGDVSQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29818 (Experiment 1) 29818 55.517 846.360413 2+ 2+ 1690.7087253542504 0 -1.4487234304806322 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
945 944 P62888 KSEIEYYAMLAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40131 (Experiment 1) 40131 67.902 509.238159 3+ 3+ 1524.6935333144304 0 -0.5797643252243202 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (7: 0.0) 0 Y6-{Y6 Y7} 1 100.0 Confident
|
|
|
946 945 P07741 IDYIAGLDSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36379 (Experiment 1) 36379 63.194 561.792358 2+ 2+ 1121.57168812845 0 -1.357316437597264 100.0 Confident
|
|
|
947 946 Q9Y5P4 QVDTLQKYFDACADAVSK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15817 (Experiment 1) 15817 38.079 687.328491 2+ 3+ 2057.9728057744906 1 -6.073287389089642 97.76119402985076 Doubtful
|
|
|
948 947 P61244 ATEYIQYMR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30553 (Experiment 1) 30553 56.367 627.764709 2+ 2+ 1253.5151750296402 0 -0.24687847477287492 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 7: 0.0) Phosphorylation of Y (4: 80.69951108910817) 0 Y4-{Y4 Y7} 1 100.0 Confident
|
|
|
949 948 Q16629 AFSYYGPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36004 (Experiment 1) 36004 62.717 537.274414 2+ 2+ 1072.53418042092 0 0.08807925870321101 100.0 Confident
|
|
|
950 949 Q8N5Y8 DLIYAFHGSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36049 (Experiment 1) 36049 62.778 629.784485 2+ 2+ 1257.5543374196802 0 0.06323329853346783 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 78.88307155322862) Y4 1 0 93.6842105263158 Confident
|
|
|
951 950 P35579, P35580 LDPHLVLDQLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41990 (Experiment 1) 41990 70.689 440.254639 3+ 3+ 1317.74048478905 0 1.2135495514727004 100.0 Confident
|
|
|
952 951 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43776 (Experiment 1) 43776 73.728 895.948669 2+ 2+ 1789.88464239309 0 -1.036512946130199 100.0 Confident
|
|
|
953 952 Q08211 ISAVSVAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17923 (Experiment 1) 17923 40.843 466.263885 2+ 2+ 930.5134449763402 0 -0.24440013020611198 97.8319783197832 Confident
|
|
|
954 953 P62851 LITPAVVSER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28471 (Experiment 1) 28471 53.96 542.821777 2+ 2+ 1083.6288090817504 0 0.17683949640737454 100.0 Confident
|
|
|
955 954 Q14444 LNQDQLDAVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20476 (Experiment 1) 20476 44.103 615.820007 2+ 2+ 1229.6251802532904 0 0.22799937184835323 100.0 Confident
|
|
|
956 955 P55263 IVIFTQGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30512 (Experiment 1) 30512 56.32 467.279327 2+ 2+ 932.5443511818 0 -0.26762938409600345 96.4769647696477 Confident
|
|
|
957 956 P11142 GTLDPVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15336 (Experiment 1) 15336 37.39 429.73233 2+ 2+ 857.4494477374503 0 0.7671396652104953 93.6 Confident
|
|
|
958 957 P22314 YDGQVAVFGSDLQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37408 (Experiment 1) 37408 64.416 828.397644 2+ 2+ 1654.7838657226605 0 -1.8895818883930597 99.72826086956522 Confident
|
|
|
959 958 Q13151 EDIYSGGGGGGSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9539 (Experiment 1) 9539 27.752 646.251404 2+ 2+ 1290.48777398149 0 0.37221200758174194 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 73.82875605815832) Y4 1 0 92.8388746803069 Confident
|
|
|
960 959 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32332 (Experiment 1) 32332 58.434 932.897278 2+ 2+ 1863.7750310922602 0 2.6648096646595225 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 23.821989528795815) 0 Y6-{Y6 Y11} 1 99.46666666666667 Confident
|
|
|
961 960 HBB_HUMAN, P02042, P68871 LHVDPENFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23607 (Experiment 1) 23607 48.2 563.784973 2+ 2+ 1125.5567067706502 0 -1.1650742806244956 95.26315789473684 Confident
|
|
|
962 961 P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3 DVNAAIATIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30510 (Experiment 1) 30510 56.317 508.292389 2+ 2+ 1014.5709598524604 0 -0.7227981070618928 100.0 Confident
|
|
|
963 962 Q9H324 YDICIYKNK Phosphorylation of Y(1) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19847 (Experiment 1) 19847 43.348 648.794189 2+ 2+ 1295.5621252220606 0 9.016688194370598 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 6: 0.0) Phosphorylation of Y (1: 76.06786756001415) 0 Y1-{Y1 Y6} 1 91.44385026737967 Doubtful
|
|
|
964 963 P60900 LYQVEYAFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37323 (Experiment 1) 37323 64.31 580.802429 2+ 2+ 1159.5913609438705 0 -0.9089808188384838 99.45799457994579 Confident
|
|
|
965 964 O60506 DYAFIHFDER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41464 (Experiment 1) 41464 69.846 464.858612 3+ 3+ 1391.5547313425004 0 -0.5196867327534157 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 100.0 Confident
|
|
|
966 965 P07320 RGDYADHQQWMGLSDSVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32595 (Experiment 1) 32595 58.739 734.314148 3+ 3+ 2199.91571551206 0 2.2238885142581246 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
967 966 P09651, Q32P51 IEVIEIMTDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43778 (Experiment 1) 43778 73.731 609.823914 2+ 2+ 1217.6325741328503 0 0.5747019034172164 100.0 Confident
|
|
|
968 967 P07203 FLVGPDGVPLRR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32216 (Experiment 1) 32216 58.302 442.59433 3+ 3+ 1324.7615545868 0 -0.2967255357768806 96.99248120300751 Confident
|
|
|
969 968 P23396 AELNEFLTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37239 (Experiment 1) 37239 64.211 546.787842 2+ 2+ 1091.5611234447504 0 0.006969454025691694 100.0 Confident
|
|
|
970 969 Q9NXR7 ELVQQYHQFQCSR Phosphorylation of Y(6) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20598 (Experiment 1) 20598 44.242 601.594421 3+ 3+ 1801.7607184408002 0 0.3962575794881585 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
971 970 P63173 KIEEIKDFLLTAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39910 (Experiment 1) 39910 67.612 525.974243 3+ 3+ 1574.9031930097003 0 -1.4534341642461586 100.0 Confident
|
|
|
972 971 P52597 GLPFGCTK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26671 (Experiment 1) 26671 51.844 440.22345 2+ 2+ 878.4320238515002 0 0.3671033365001981 97.8891820580475 Confident
|
|
|
973 972 P62241 LLACIASR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23864 (Experiment 1) 23864 48.543 452.257233 2+ 2+ 902.5007721176601 0 -0.9497365718611639 96.19565217391303 Confident
|
|
|
974 973 Q16531 TVPLYESPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21978 (Experiment 1) 21978 46.2 571.268433 2+ 2+ 1140.52164030907 0 0.5888280035625685 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
975 974 P11142, P54652 FEELNADLFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43862 (Experiment 1) 43862 73.894 627.311035 2+ 2+ 1252.60880191316 0 -1.0240896435873494 100.0 Confident
|
|
|
976 975 Q9Y285 VNLQMVYDSPLCR Phosphorylation of Y(7) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43517 (Experiment 1) 43517 73.288 837.875916 2+ 2+ 1673.73066418248 0 3.9474281819046624 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.72972972972973 Confident
|
|
|
977 976 Q07020 APGTPHSHTKPYVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5346 (Experiment 1) 5346 18.847 516.607422 3+ 3+ 1546.8004592766601 0 -0.014632062199596696 94.8905109489051 Confident
|
|
|
978 977 P33991 VNVTGIYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23917 (Experiment 1) 23917 48.612 501.24469 2+ 2+ 1000.4742961938302 0 0.529554564407947 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
979 978 P55084 DQLLLGPTYATPK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39767 (Experiment 1) 39767 67.419 748.873291 2+ 2+ 1495.7323613513004 0 -0.2218565241936938 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.83844911147011) Y9 1 0 100.0 Confident
|
|
|
980 979 P37802 NFSDNQLQEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18296 (Experiment 1) 18296 41.4 640.298645 2+ 2+ 1278.5840437173003 0 -1.0203438672969383 100.0 Confident
|
|
|
981 980 P09651 SSGPYGGGGQYFAKPR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20337 (Experiment 1) 20337 43.939 854.878723 2+ 2+ 1707.7406346192204 0 1.3209184402517706 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 6.326938772424313) Phosphorylation of Y (5: 2.6178010471204187) 0 Y11-{Y5 Y11} 1 100.0 Confident
|
|
|
982 981 P15880 GTGIVSAPVPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21110 (Experiment 1) 21110 44.867 513.303467 2+ 2+ 1024.5916952970401 0 0.6679964561040496 98.71794871794873 Confident
|
|
|
983 982 P26640 DPGVITYDLPTPPGEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41252 (Experiment 1) 41252 69.531 889.915161 2+ 2+ 1777.8175475272403 0 -0.9992295700155215 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.12277867528272) Y7 1 0 96.7479674796748 Confident
|
|
|
984 983 P35659 EPFTIAQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24502 (Experiment 1) 24502 49.331 495.766571 2+ 2+ 989.5181960036102 0 0.3964193479975704 100.0 Confident
|
|
|
985 984 P52272 MGANSLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12879 (Experiment 1) 12879 33.566 439.213745 2+ 2+ 876.41235103608 0 0.6671360968276497 97.9002624671916 Confident
|
|
|
986 985 P61978 DLAGSIIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34365 (Experiment 1) 34365 60.785 437.25589 2+ 2+ 872.4967322830403 0 0.5657826768127519 93.51351351351352 Confident
|
|
|
987 986 P18669, Q8N0Y7 SYDVPPPPMEPDHPFYSNISK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38860 (Experiment 1) 38860 66.189 833.366882 3+ 3+ 2496.0708787407802 1 1.8338739370665214 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 13.07044506515171) Phosphorylation of Y (2: 99.67689822294022) 0 Y2-{Y2 Y16} 1 99.28571428571429 Confident
|
|
|
988 987 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 LAVNMVPFPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42304 (Experiment 1) 42304 71.204 572.320313 2+ 2+ 1142.6270352599402 0 -0.840606853810192 100.0 Confident
|
|
|
989 988 P22061 VQLVVGDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22170 (Experiment 1) 22170 46.446 471.77243 2+ 2+ 941.5294293936499 0 0.9301874025569756 98.93048128342245 Confident
|
|
|
990 989 Q9NWT1 GEQYVVIIQNK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30673 (Experiment 1) 30673 56.505 685.840271 2+ 2+ 1369.66428179148 0 1.244660814606273 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
991 990 P13639 ETVSEESNVLCLSK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32850 (Experiment 1) 32850 59.027 797.885498 2+ 2+ 1593.7556023694901 0 0.5268283047499381 100.0 Confident
|
|
|
992 991 P15144 SEYMEGNVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15609 (Experiment 1) 15609 37.767 582.72345 2+ 2+ 1163.4318393285 0 0.43565957140681494 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
993 992 P62805, Q99525 DNIQGITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14706 (Experiment 1) 14706 36.352 444.742981 2+ 2+ 887.4712458111901 0 0.18353883354104572 96.52406417112299 Confident
|
|
|
994 993 Q8WXI9 TTSSAIYMNLASHIQPGTVNR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38534 (Experiment 1) 38534 65.792 781.037231 3+ 3+ 2340.0933455208606 0 -1.4860222552774192 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
995 994 Q13126 TTMRPQSFYDGSHSCAR Phosphorylation of Y(9) Carbamidomethylation of C(15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21581 (Experiment 1) 21581 45.612 694.28418 3+ 3+ 2079.8292090067803 0 0.7209314328814431 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 97.38219895287958) Y9 1 0 92.14285714285715 Doubtful
|
|
|
996 995 P00338 TLHPDLGTDKDKEQWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17440 (Experiment 1) 17440 40.209 478.49585 4+ 4+ 1909.9533906592505 0 0.47203853907034415 100.0 Doubtful
|
|
|
997 996 P61604 GGIMLPEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24973 (Experiment 1) 24973 49.877 422.733276 2+ 2+ 843.4524249429103 0 -0.5037175257778923 92.9539295392954 Confident
|
|
|
998 997 Q9NQ79 SSPYYALR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36520 (Experiment 1) 36520 63.355 518.727844 2+ 2+ 1035.4426617123802 0 -1.4715267123985332 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (4: 94.02261712439419) 0 Y4-{Y4 Y5} 1 95.09043927648578 Confident
|
|
|
999 998 Q92769 YYAVNFPMR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41130 (Experiment 1) 41130 69.368 620.765381 2+ 2+ 1239.51478110682 0 1.1501617535631974 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.17452006980802792) 0 Y2-{Y1 Y2} 1 100.0 Confident
|
|
|
1000 999 P63104 KGIVDQSQQAYQEAFEISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38862 (Experiment 1) 38862 66.191 723.699707 3+ 3+ 2168.0749623439106 0 1.072847448320851 100.0 Confident
|
|
|
1001 1000 P55209, Q99733 FYEEVHDLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25085 (Experiment 1) 25085 50.007 668.81134 2+ 2+ 1335.6095301891503 0 -1.0489664414647453 100.0 Confident
|
|
|
1002 1001 Q16181 DVTNNVHYENYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18290 (Experiment 1) 18290 41.391 535.222534 3+ 3+ 1602.6463998812103 0 -0.3906670349137978 Phosphorylation of Y (8: Random) Phosphorylation of Y (8: 0.0, 11: 0.0) Phosphorylation of Y (8: 0.3490401396160559) 0 Y8-{Y8 Y11} 1 99.28057553956835 Confident
|
|
|
1003 1002 P10599, THIO_HUMAN CMPTFQFFK Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46556 (Experiment 1) 46556 79.662 603.277771 2+ 2+ 1204.5409226774802 0 0.05502349209553988 91.30434782608697 Confident
|
|
|
1004 1003 P62805 DNIQGITKPAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20853 (Experiment 1) 20853 44.536 663.381531 2+ 2+ 1324.74629844548 0 1.666178869740383 100.0 Confident
|
|
|
1005 1004 Q14240 ETQALVLAPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27796 (Experiment 1) 27796 53.169 599.843201 2+ 2+ 1197.6717365228901 0 0.09381076267449003 100.0 Confident
|
|
|
1006 1005 P23528 HELQANCYEEVKDR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14194 (Experiment 1) 14194 35.592 597.606445 3+ 3+ 1789.8053465265702 0 -4.373498523168916 100.0 Doubtful
|
|
|
1007 1006 P10809 VGEVIVTKDDAMLLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35470 (Experiment 1) 35470 62.064 544.307983 3+ 3+ 1629.9011444043701 0 0.5972083249592082 100.0 Confident
|
|
|
1008 1007 P35579 IAQLEEQLDNETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29580 (Experiment 1) 29580 55.243 765.88562 2+ 2+ 1529.7573166216505 0 -0.41099806512467546 100.0 Confident
|
|
|
1009 1008 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21067 (Experiment 1) 21067 44.811 713.290955 2+ 2+ 1424.5666150733405 0 0.520119746517163 Phosphorylation of Y (4: Confident, 7: Doubtfull) Phosphorylation of Y (4: 97.09208400646203, 7: 39.25686591276252) Y4 1 Y9-{Y7} 1 99.45799457994579 Confident
|
|
|
1010 1009 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21114 (Experiment 1) 21114 44.875 636.766785 2+ 2+ 1271.5183458337801 0 0.5270634126746891 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 93.21486268174475) Y5 1 0 99.18478260869566 Confident
|
|
|
1011 1010 P49327 YSGTLNLDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23389 (Experiment 1) 23389 47.925 519.764771 2+ 2+ 1037.5141732523302 0 0.7847922092563662 99.45652173913044 Confident
|
|
|
1012 1011 P06733 YISPDQLADLYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42653 (Experiment 1) 42653 71.812 753.350403 2+ 2+ 1504.6850768057104 0 0.7806869015371493 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 53.46147739171065) Phosphorylation of Y (11: 100.0) 0 Y11-{Y1 Y11} 1 100.0 Confident
|
|
|
1013 1012 P49458 PQYQTWEEFSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39763 (Experiment 1) 39763 67.414 775.81958 2+ 2+ 1549.6238735314805 0 0.4727486009484723 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1014 1013 P14324 VLTEDEMGHPEIGDAIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32210 (Experiment 1) 32210 58.294 651.650818 3+ 3+ 1951.9309409625102 0 -0.16182638836428673 99.25373134328358 Confident
|
|
|
1015 1014 P57737 SLQSLLGPSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34677 (Experiment 1) 34677 61.145 558.817627 2+ 2+ 1115.61863832087 0 1.8456373002547133 97.289972899729 Confident
|
|
|
1016 1015 P11021 ITPSYVAFTPEGER Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36371 (Experiment 1) 36371 63.183 823.880127 2+ 2+ 1645.7389032837207 0 4.125485296093778 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1017 1016 Q07020 TNSTFNQVVLKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22651 (Experiment 1) 22651 47.033 469.596283 3+ 3+ 1405.7677621660503 0 -0.5270953807526495 100.0 Confident
|
|
|
1018 1017 P61604 VLLPEYGGTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29547 (Experiment 1) 29547 55.204 538.803467 2+ 2+ 1075.59136094387 0 0.9466563727441888 99.21052631578947 Confident
|
|
|
1019 1018 P53999 DDNMFQIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36214 (Experiment 1) 36214 62.996 534.246887 2+ 2+ 1066.4753452154603 0 3.627409975830023 99.45799457994579 Confident
|
|
|
1020 1019 Q01130 VDNLTYRTSPDTLR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25713 (Experiment 1) 25713 50.743 577.608704 3+ 3+ 1729.8036287986001 0 0.3773034155669368 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 89.87783595113437) Y6 1 0 94.81481481481482 Confident
|
|
|
1021 1020 Q9BVV7 QGTVYAQVK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12396 (Experiment 1) 12396 32.785 537.254944 2+ 2+ 1072.4954255612304 0 -0.0842196501539495 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.30191972076788) Y5 1 0 99.7340425531915 Confident
|
|
|
1022 1021 Q9NTK5 LQELSAEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16814 (Experiment 1) 16814 39.349 537.773987 2+ 2+ 1073.5353026197304 0 -1.7493873898417656 99.45799457994579 Confident
|
|
|
1023 1022 Q7Z388 NENIYQIYSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29068 (Experiment 1) 29068 54.655 676.302429 2+ 2+ 1350.5856971176104 0 3.4067336341409065 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 8: 0.0) Phosphorylation of Y (5: 61.03076678992909) 0 Y5-{Y5 Y8} 1 96.7479674796748 Confident
|
|
|
1024 1023 Q02790 LYANMFER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37924 (Experiment 1) 37924 65.04 562.236206 2+ 2+ 1122.4569318775302 0 0.8245552317083202 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1025 1024 P43487 FLNAENAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14557 (Experiment 1) 14557 36.132 517.766541 2+ 2+ 1033.5192586327703 0 -0.7045316979152224 100.0 Confident
|
|
|
1026 1025 P41252 FLIQNVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43186 (Experiment 1) 43186 72.77 501.807373 2+ 2+ 1001.60220041109 0 -2.0001108065527036 99.45945945945947 Confident
|
|
|
1027 1026 P50990 HFSGLEEAVYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29198 (Experiment 1) 29198 54.803 694.305786 2+ 2+ 1386.5969305076505 0 0.06377502015062869 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
1028 1027 P49207 AFLIEEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29609 (Experiment 1) 29609 55.276 489.269379 2+ 2+ 976.5229470308802 0 1.2856282931677416 99.45652173913044 Confident
|
|
|
1029 1028 Q13867 AQHVFQHAVPQEGKPITNQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13651 (Experiment 1) 13651 34.725 565.05127 4+ 4+ 2256.17634815103 0 -0.16547976983361706 100.0 Doubtful
|
|
|
1030 1029 P05204 LSAKPAPPKPEPKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6463 (Experiment 1) 6463 20.998 528.987122 3+ 3+ 1583.9399128715904 0 -0.23710214084295794 100.0 Confident
|
|
|
1031 1030 P19338 NSTWSGESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9573 (Experiment 1) 9573 27.823 498.224213 2+ 2+ 994.4355885784603 0 -1.7216236043255755 98.9247311827957 Confident
|
|
|
1032 1031 Q9GZR7 VQHVIHYQVPR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15478 (Experiment 1) 15478 37.584 485.912811 3+ 3+ 1454.7183830530103 0 -1.220693118823786 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 99.24812030075188 Confident
|
|
|
1033 1032 P14866 ASLNGADIYSGCCTLK Phosphorylation of Y(9) Carbamidomethylation of C(12, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29764 (Experiment 1) 29764 55.456 905.383362 2+ 2+ 1808.74743644543 0 2.614711913426997 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.83844911147011) Y9 1 0 100.0 Confident
|
|
|
1034 1033 P52565 AEEYEFLTPVEEAPK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42665 (Experiment 1) 42665 71.831 916.406128 2+ 2+ 1830.7964777294908 0 0.6685560401479995 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1035 1034 Q99961, Q99962 TIEYLQPNPASR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26649 (Experiment 1) 26649 51.818 734.845276 2+ 2+ 1467.6759091043402 0 0.06121155302333763 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
1036 1035 Q96JM2 CPLCLYHTK Phosphorylation of Y(6) Carbamidomethylation of C(1, 4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26042 (Experiment 1) 26042 51.122 636.773438 2+ 2+ 1270.5239658915302 1 3.9309906707352176 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 90.92495636998254) Y6 1 0 92.43243243243244 Confident
|
|
|
1037 1036 P21796 LTFDSSFSPNTGKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28320 (Experiment 1) 28320 53.784 510.259949 3+ 3+ 1527.7569226988303 0 0.7152573370177838 100.0 Confident
|
|
|
1038 1037 O75608 ALIDQEVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20616 (Experiment 1) 20616 44.263 458.260193 2+ 2+ 914.5072969667403 0 -1.5972345497140765 98.92761394101876 Confident
|
|
|
1039 1038 P11908, P60891 MVLVGDVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28007 (Experiment 1) 28007 53.409 430.748718 2+ 2+ 859.4837250711903 0 -0.977372602725422 98.66666666666667 Confident
|
|
|
1040 1039 Q06830 ATAVMPDGQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24799 (Experiment 1) 24799 49.673 582.787781 2+ 2+ 1163.5644945730303 0 -2.990364885074396 100.0 Confident
|
|
|
1041 1040 P30101 EATNPPVIQEEKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14410 (Experiment 1) 14410 35.918 527.282288 3+ 3+ 1578.8253366118206 0 -0.19092379030058954 100.0 Confident
|
|
|
1042 1041 P12004 SEGFDTYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18843 (Experiment 1) 18843 42.1 527.698181 2+ 2+ 1053.3804553786404 0 1.2826360981280076 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
1043 1042 P23526 YPQLLPGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41123 (Experiment 1) 41123 69.358 528.813477 2+ 2+ 1055.61276509479 0 -0.3441934675513256 96.49595687331536 Confident
|
|
|
1044 1043 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28081 (Experiment 1) 28081 53.493 609.260315 2+ 2+ 1216.5053215385904 0 0.6200373102765451 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 43.16022828057617) Phosphorylation of Y (3: 64.97821550177572) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1045 1044 P22314 NIILGGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27743 (Experiment 1) 27743 53.107 407.263428 2+ 2+ 812.5119884243602 0 0.38628822986263195 92.45283018867924 Confident
|
|
|
1046 1045 P18124 EVPAVPETLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27338 (Experiment 1) 27338 52.62 541.808716 2+ 2+ 1081.6019256275704 0 0.8798673925184933 100.0 Confident
|
|
|
1047 1046 Q01469 TTQFSCTLGEKFEETTADGR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35377 (Experiment 1) 35377 61.958 760.014465 3+ 3+ 2277.0219407948807 0 -0.16455619046016545 99.25373134328358 Confident
|
|
|
1048 1047 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27089 (Experiment 1) 27089 52.328 565.21521 2+ 2+ 1128.4165065341901 0 -0.565684929677775 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 49.39867221793312) Phosphorylation of Y (6: 99.82547993019197) 0 Y6-{Y2 Y6} 1 100.0 Confident
|
|
|
1049 1048 P62328 NPLPSKETIEQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17254 (Experiment 1) 17254 39.946 504.935333 3+ 3+ 1511.7831374466707 0 0.6813767553429919 100.0 Confident
|
|
|
1050 1049 Q9H6Z4 DTGQLYAALHHR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26211 (Experiment 1) 26211 51.317 487.892181 3+ 3+ 1460.6561767192704 0 -0.9996185639072703 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 90.40139616055846) Y6 1 0 96.26865671641791 Confident
|
|
|
1051 1050 P46776 NQSFCPTVNLDK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29528 (Experiment 1) 29528 55.183 711.837524 2+ 2+ 1421.6609141390102 0 -0.2943596654933257 100.0 Confident
|
|
|
1052 1051 P26599 GQPIYIQFSNHK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32125 (Experiment 1) 32125 58.199 504.573303 3+ 3+ 1510.6969789020904 0 0.7271479138720388 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1053 1052 P78527 INQVFHGSCITEGNELTK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27824 (Experiment 1) 27824 53.201 683.004089 3+ 3+ 2045.9840391645305 0 3.122702151144207 92.14285714285715 Doubtful
|
|
|
1054 1053 P55060 HKDAAIYLVTSLASK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43773 (Experiment 1) 43773 73.724 566.294312 3+ 3+ 1695.8596871227403 0 0.8355360922850832 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1055 1054 P51991 IFVGGIKEDTEEYNLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34411 (Experiment 1) 34411 60.839 628.323608 3+ 3+ 1881.9472426496504 0 0.9294316493285143 100.0 Confident
|
|
|
1056 1055 P36578 SNYNLPMHK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16315 (Experiment 1) 16315 38.738 592.252625 2+ 2+ 1182.4892946349703 0 1.1839821444005851 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1057 1056 Q08945 IPYTTVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30369 (Experiment 1) 30369 56.156 481.787292 2+ 2+ 961.5596668927701 0 0.37794037909854616 99.1869918699187 Confident
|
|
|
1058 1057 P19338 KVVVSPTKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4201 (Experiment 1) 4201 16.782 493.322662 2+ 2+ 984.6331661862002 0 -2.427532925669681 99.73333333333333 Confident
|
|
|
1059 1058 P61978 GGDLMAYDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24090 (Experiment 1) 24090 48.826 499.224335 2+ 2+ 996.43348040348 0 0.6376525115536369 100.0 Confident
|
|
|
1060 1059 Q15819 YPEAPPSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18762 (Experiment 1) 18762 42.002 508.264496 2+ 2+ 1014.5134449763402 0 0.9779268627309363 99.7340425531915 Confident
|
|
|
1061 1060 P62750 KLYDIDVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22992 (Experiment 1) 22992 47.438 532.802856 2+ 2+ 1063.5913609438703 0 -0.1894485492150067 99.73118279569893 Confident
|
|
|
1062 1061 P60842 GFKDQIYDIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45436 (Experiment 1) 45436 77.52 527.916809 3+ 3+ 1580.7276103240304 0 0.6233786157785173 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1063 1062 P38159, Q96E39 LFIGGLNTETNEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36308 (Experiment 1) 36308 63.107 718.375793 2+ 2+ 1434.7354589782606 0 1.0955894221858613 100.0 Confident
|
|
|
1064 1063 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19363 (Experiment 1) 19363 42.74 636.766785 2+ 2+ 1271.5183458337801 0 0.5270634126746891 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1065 1064 Q00839 NFILDQTNVSAAAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36552 (Experiment 1) 36552 63.392 824.427002 2+ 2+ 1646.8376326310206 0 1.1028492251820472 100.0 Confident
|
|
|
1066 1065 P18124 KTTHFVEGGDAGNREDQINR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10928 (Experiment 1) 10928 30.374 561.774414 4+ 4+ 2243.06791990086 0 0.28046492179213556 100.0 Doubtful
|
|
|
1067 1066 P13639 YEWDVAEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33050 (Experiment 1) 33050 59.253 569.762207 2+ 2+ 1137.5090878718904 0 0.6785243041311632 100.0 Confident
|
|
|
1068 1067 P13010 KKDQVTAQEIFQDNHEDGPTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20286 (Experiment 1) 20286 43.881 625.559204 4+ 4+ 2498.2037446673307 0 1.5847707459414153 100.0 Doubtful
|
|
|
1069 1068 O00629 IEQLQNHENEDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18776 (Experiment 1) 18776 42.019 618.274963 3+ 3+ 1851.8040227214206 0 -0.5192519047990041 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 98.60383944153578) Y13 1 0 96.71052631578947 Confident
|
|
|
1070 1069 P00338 FIIPNVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40514 (Experiment 1) 40514 68.501 465.294647 2+ 2+ 928.5745886809204 0 0.16375159436199274 99.73045822102425 Confident
|
|
|
1071 1070 P41252 SDTPLIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25204 (Experiment 1) 25204 50.146 508.739136 2+ 2+ 1015.4627284506203 0 0.9735998767660702 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 99.73890339425587 Confident
|
|
|
1072 1071 Q70E73, Q7Z5R6 ASGIYYVPK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28926 (Experiment 1) 28926 54.491 539.255188 2+ 2+ 1076.4943629320703 0 1.353845373004798 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (5: 5.410122164048866) 0 Y5-{Y5 Y6} 1 99.45652173913044 Confident
|
|
|
1073 1072 P14927 WYYNAAGFNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38660 (Experiment 1) 38660 65.94 657.271851 2+ 2+ 1312.5277883186702 0 1.0351493922054977 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 1.5706806282722512) 0 Y2-{Y2 Y3} 1 100.0 Confident
|
|
|
1074 1073 P17987 SSLGPVGLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25441 (Experiment 1) 25441 50.425 486.771667 2+ 2+ 971.5287606873101 0 0.020932880630368113 99.45799457994579 Confident
|
|
|
1075 1074 P60709, P63261 GYSFTTTAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22904 (Experiment 1) 22904 47.328 566.766907 2+ 2+ 1131.5196525555903 0 -0.34537044635423314 100.0 Confident
|
|
|
1076 1075 P23526 VPAINVNDSVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24353 (Experiment 1) 24353 49.157 628.846802 2+ 2+ 1255.6772158261504 0 1.4592130370350473 100.0 Confident
|
|
|
1077 1076 P20700 LYKEELEQTYHAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17255 (Experiment 1) 17255 39.948 577.938843 3+ 3+ 1730.7916671325704 0 1.7490156811036128 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 10.49857933847463) Phosphorylation of Y (10: 81.04824930741161) 0 Y10-{Y2 Y10} 1 100.0 Confident
|
|
|
1078 1077 P57735, P62491, Q15907 AITSAYYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19863 (Experiment 1) 19863 43.368 472.744995 2+ 2+ 943.4763311916302 0 -0.945673056237385 99.45652173913044 Confident
|
|
|
1079 1078 P55884 GTYLATFHQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21817 (Experiment 1) 21817 45.983 425.195801 3+ 3+ 1272.5652364565503 0 0.2643041958411624 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.30191972076788) Y3 1 0 100.0 Confident
|
|
|
1080 1079 P61353 YSVDIPLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34789 (Experiment 1) 34789 61.275 525.279541 2+ 2+ 1048.5440763982801 0 0.43088323018400504 100.0 Confident
|
|
|
1081 1080 P10412, P16402, P16403, P22492, Q02539 ALAAAGYDVEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19944 (Experiment 1) 19944 43.479 594.270508 2+ 2+ 1186.5271196123304 0 -0.5523962430293344 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.50959860383944) Y7 1 0 99.7289972899729 Confident
|
|
|
1082 1081 Q9NTK5 FDFLCQYHKPASK Phosphorylation of Y(7) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29002 (Experiment 1) 29002 54.579 574.257629 3+ 3+ 1719.7480284987805 0 1.7582736134768655 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 99.37888198757764 Confident
|
|
|
1083 1082 P12956 IMATPEQVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17699 (Experiment 1) 17699 40.556 537.287292 2+ 2+ 1072.5586809166002 0 1.2564520807502793 100.0 Confident
|
|
|
1084 1083 P39656 TADDPSLSLIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33506 (Experiment 1) 33506 59.78 580.314575 2+ 2+ 1158.6132185872602 0 1.1877013021969465 99.1891891891892 Confident
|
|
|
1085 1084 P48444 ENVNLAQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25885 (Experiment 1) 25885 50.939 528.793823 2+ 2+ 1055.57235683479 0 0.6961428691423248 99.45945945945947 Confident
|
|
|
1086 1085 P17980 VDILDPALLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45958 (Experiment 1) 45958 78.678 562.838684 2+ 2+ 1123.6601092100302 0 2.403764103898018 99.72972972972973 Confident
|
|
|
1087 1086 P09651, Q32P51 DYFEQYGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29500 (Experiment 1) 29500 55.15 525.232361 2+ 2+ 1048.4501760134401 0 -0.006613324683544875 99.73684210526315 Confident
|
|
|
1088 1087 P14866 AITHLNNNFMFGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33507 (Experiment 1) 33507 59.781 545.608948 3+ 3+ 1633.8034960517703 0 0.9277396740557601 100.0 Confident
|
|
|
1089 1088 P00519 GAVSTLLQAPELPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41704 (Experiment 1) 41704 70.225 762.92981 2+ 2+ 1523.8559084641104 0 -7.105057741687514 99.73262032085562 Doubtful
|
|
|
1090 1089 Q07955 EAGDVCYADVYR Phosphorylation of Y(7) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26722 (Experiment 1) 26722 51.902 749.289734 2+ 2+ 1496.5643100500301 0 0.4037267310790863 Phosphorylation of Y (11: Random) Phosphorylation of Y (7: 0.0, 11: 0.0) Phosphorylation of Y (11: 25.181614466621504) 0 Y11-{Y7 Y11} 1 100.0 Confident
|
|
|
1091 1090 Q96KP4 TGQEIPVNVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21648 (Experiment 1) 21648 45.727 556.806824 2+ 2+ 1111.5985715826303 0 0.47007684633517816 99.21259842519686 Confident
|
|
|
1092 1091 Q06830 DISLSDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27155 (Experiment 1) 27155 52.406 510.718048 2+ 2+ 1019.4212575614604 0 0.27951332114050303 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 100.0 Confident
|
|
|
1093 1092 P13639 SDPVVSYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17269 (Experiment 1) 17269 39.972 461.735535 2+ 2+ 921.4555957470502 0 0.9976709341843961 99.19354838709677 Confident
|
|
|
1094 1093 P61978 ENTQTTIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6489 (Experiment 1) 6489 21.049 467.745941 2+ 2+ 933.4767251144503 0 0.6455986709234778 94.08602150537635 Confident
|
|
|
1095 1094 P62424 AGVNTVTTLVENKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25021 (Experiment 1) 25021 49.933 491.947418 3+ 3+ 1472.8198573085606 0 0.38438472677306906 100.0 Confident
|
|
|
1096 1095 Q16881 KVVYENAYGQFIGPHR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28732 (Experiment 1) 28732 54.266 653.650269 3+ 3+ 1956.9247469907903 1 0.4468341046417104 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 9.440360040453784) Phosphorylation of Y (4: 2.094240837696335) 0 Y4-{Y4 Y8} 1 100.0 Confident
|
|
|
1097 1096 P62826 NLQYYDISAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30094 (Experiment 1) 30094 55.839 607.806946 2+ 2+ 1213.5979028762904 0 1.1814539071871302 100.0 Confident
|
|
|
1098 1097 Q96AE4 IAQITGPPDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18761 (Experiment 1) 18761 42.001 534.297424 2+ 2+ 1066.57710786206 0 2.982621362928432 100.0 Confident
|
|
|
1099 1098 P62241 IIDVVYNASNNELVR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41468 (Experiment 1) 41468 69.853 899.940796 2+ 2+ 1797.8662290551604 0 0.4500360376870072 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1100 1099 Q9NWQ8 AEFAEYASVDR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27575 (Experiment 1) 27575 52.902 669.274963 2+ 2+ 1336.5336615447502 0 1.2786402514705562 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 94.02261712439419) Y6 1 0 98.95287958115183 Confident
|
|
|
1101 1100 Q9BYD2 LLPQGLAVYASPENK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40172 (Experiment 1) 40172 67.972 840.423096 2+ 2+ 1678.8331380217307 0 -0.8917853550826702 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 99.72826086956522 Doubtful
|
|
|
1102 1101 P29401 VLDPFTIKPLDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42063 (Experiment 1) 42063 70.804 471.941376 3+ 3+ 1412.8027506924402 0 -0.31931418810200896 100.0 Confident
|
|
|
1103 1102 P55786 SPVYLTVLK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41648 (Experiment 1) 41648 70.144 550.293152 2+ 2+ 1098.5726132527702 0 -0.7833876506394485 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.47643979057592) Y4 1 0 99.7289972899729 Confident
|
|
|
1104 1103 P84098 LLADQAEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14171 (Experiment 1) 14171 35.559 493.766663 2+ 2+ 985.5192586327703 0 -0.4916959688173615 100.0 Confident
|
|
|
1105 1104 P08238 YHTSQSGDEMTSLSEYVSR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32281 (Experiment 1) 32281 58.375 752.97522 3+ 3+ 2255.9042073385003 0 -0.16677789807965598 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 46.102562025336766) Phosphorylation of Y (16: 100.0) 0 Y16-{Y1 Y16} 1 100.0 Confident
|
|
|
1106 1105 P16401 ALAAGGYDVEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17927 (Experiment 1) 17927 40.849 587.263123 2+ 2+ 1172.5114695481905 0 0.19030500901254424 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 95.15347334410339) Y7 1 0 95.2127659574468 Confident
|
|
|
1107 1106 P49411 ELAMPGEDLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31181 (Experiment 1) 31181 57.099 551.775574 2+ 2+ 1101.5376111188502 0 -0.9207108711911606 99.73614775725594 Confident
|
|
|
1108 1107 O15145 LIGNMALLPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46203 (Experiment 1) 46203 79.113 605.871216 2+ 2+ 1209.72674930121 0 0.9323484837553658 99.7289972899729 Confident
|
|
|
1109 1108 P49321 ATLVESSTSGFTPGGGGSSVSMIASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39369 (Experiment 1) 39369 66.857 815.064087 3+ 3+ 2442.1696676577303 0 0.3124261777407682 99.24812030075188 Confident
|
|
|
1110 1109 O95758 SQPVYIQYSNHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20615 (Experiment 1) 20615 44.262 786.357178 2+ 2+ 1570.6929561508102 0 4.353584837628715 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 8: 0.0) Phosphorylation of Y (5: 3.664921465968586) 0 Y5-{Y5 Y8} 1 100.0 Confident
|
|
|
1111 1110 O00571 SDYDGIGSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15047 (Experiment 1) 15047 36.916 525.2005 2+ 2+ 1048.3862690350702 0 0.16948892460765444 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 99.7340425531915 Confident
|
|
|
1112 1111 Q00325 IQTQPGYANTLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20878 (Experiment 1) 20878 44.565 681.36322 2+ 2+ 1360.7099129367602 0 1.4486638091274089 99.45799457994579 Confident
|
|
|
1113 1112 P17844 TTYLVLDEADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36121 (Experiment 1) 36121 62.871 648.328491 2+ 2+ 1294.6404959642603 0 1.4908376111404944 100.0 Confident
|
|
|
1114 1113 P49458 LYLADPMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34012 (Experiment 1) 34012 60.369 475.753998 2+ 2+ 949.4942897548901 0 -0.889837777660625 99.1869918699187 Confident
|
|
|
1115 1114 Q9UKM9 SNIDALLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34763 (Experiment 1) 34763 61.243 494.775482 2+ 2+ 987.5349086969102 0 1.5182358479073117 100.0 Confident
|
|
|
1116 1115 Q07020 APGTPHSHTKPYVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5367 (Experiment 1) 5367 18.878 387.707428 4+ 4+ 1546.8004592766601 0 0.09469518447470443 100.0 Doubtful
|
|
|
1117 1116 Q9Y490 ILADATAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10914 (Experiment 1) 10914 30.356 401.73999 2+ 2+ 801.4596184983302 0 7.229315206839984 99.45799457994579 Doubtful
|
|
|
1118 1117 P23526 KLDEAVAEAHLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18356 (Experiment 1) 18356 41.478 460.921265 3+ 3+ 1379.7408787118704 0 0.7860261830576205 100.0 Confident
|
|
|
1119 1118 P62826 LVLVGDGGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23766 (Experiment 1) 23766 48.404 508.292908 2+ 2+ 1014.57095985246 0 0.2982670049168065 99.73118279569893 Confident
|
|
|
1120 1119 O75264 EGESNLGLDLEEKEPGDHER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26212 (Experiment 1) 26212 51.318 564.012024 4+ 4+ 2252.01929794259 0 -0.13643760387070775 100.0 Doubtful
|
|
|
1121 1120 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32110 (Experiment 1) 32110 58.181 630.798157 2+ 2+ 1259.5798834611805 0 1.4882795461353349 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1122 1121 P42704 IIETPGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22407 (Experiment 1) 22407 46.738 449.771423 2+ 2+ 897.5283667644901 0 -0.08192840202669331 91.30434782608697 Confident
|
|
|
1123 1122 P78527 LAAVVSACK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14830 (Experiment 1) 14830 36.534 459.757324 2+ 2+ 917.5004377644902 0 -0.37269442876123676 99.45945945945947 Confident
|
|
|
1124 1123 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3, 8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27257 (Experiment 1) 27257 52.526 649.242981 2+ 2+ 1296.4716520593404 0 -0.18713557650769896 Phosphorylation of Y (3: Confident, 8: Doubtfull) Phosphorylation of Y (3: 96.50959860383944, 8: 67.4266832643796) Y3 1 Y8-{Y8} 1 98.6737400530504 Confident
|
|
|
1125 1124 P40925 VIVVGNPANTNCLTASK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29447 (Experiment 1) 29447 55.088 879.46637 2+ 2+ 1756.9141686995602 0 2.284553527524625 99.73333333333333 Confident
|
|
|
1126 1125 P13639 KEDLYLKPIQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23164 (Experiment 1) 23164 47.641 741.889343 2+ 2+ 1481.7643301859202 0 -0.13284967627224972 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
1127 1126 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38593 (Experiment 1) 38593 65.859 912.996216 2+ 2+ 1823.9781488551102 0 -0.14774907595269826 98.92183288409704 Confident
|
|
|
1128 1127 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16907 (Experiment 1) 16907 39.465 514.763367 2+ 2+ 1027.5120650773501 0 0.11266248362586792 99.73118279569893 Confident
|
|
|
1129 1128 GSTP1_HUMAN, P09211 ASCLYGQLPK Phosphorylation of Y(5) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27144 (Experiment 1) 27144 52.393 608.774963 2+ 2+ 1215.5359104742201 0 -0.44138445224876627 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1130 1129 P27348 KQTIDNSQGAYQEAFDISKK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23163 (Experiment 1) 23163 47.639 784.369446 3+ 3+ 2350.0842203058005 0 0.9724567082607419 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
1131 1130 Q15631 KVEEVVYDLSIR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39526 (Experiment 1) 39526 67.076 765.384583 2+ 2+ 1528.75382507187 0 0.5147705669397703 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73890339425587 Confident
|
|
|
1132 1131 Q07020 GCGTVLLSGPR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25294 (Experiment 1) 25294 50.249 558.795044 2+ 2+ 1115.57572796307 0 -0.17260054736803057 100.0 Confident
|
|
|
1133 1132 P17844 LLQLVEDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32611 (Experiment 1) 32611 58.756 493.286987 2+ 2+ 984.5603951687601 0 -0.987357712553163 99.73474801061008 Confident
|
|
|
1134 1133 P62857 TGSQGQCTQVR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5668 (Experiment 1) 5668 19.375 611.285828 2+ 2+ 1220.5567834236401 0 0.2614511941330349 100.0 Confident
|
|
|
1135 1134 P40926 TIIPLISQCTPK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40448 (Experiment 1) 40448 68.401 685.889282 2+ 2+ 1369.7639226555702 0 0.0644497687837967 100.0 Confident
|
|
|
1136 1135 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32718 (Experiment 1) 32718 58.878 576.284912 2+ 2+ 1150.5546410819804 0 0.5465913878461197 100.0 Confident
|
|
|
1137 1136 P00519 LGGGQYGEVYEGVWKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33849 (Experiment 1) 33849 60.172 617.289917 3+ 3+ 1848.8447653345906 0 1.704369516774589 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 5.4262273427701455) Phosphorylation of Y (6: 9.424083769633508) 0 Y6-{Y6 Y10} 1 100.0 Confident
|
|
|
1138 1137 P29401 MPSLPSYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29448 (Experiment 1) 29448 55.091 461.738708 2+ 2+ 921.4629896266101 0 -0.13704744107015057 98.93899204244032 Confident
|
|
|
1139 1138 P26599 DYGNSPLHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13077 (Experiment 1) 13077 33.841 569.737244 2+ 2+ 1137.4604370348402 0 -0.44052609201314447 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1140 1139 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28571 (Experiment 1) 28571 54.077 528.262024 2+ 2+ 1054.5100129962104 0 -0.4902203425158555 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
1141 1140 P43246 DIYQDLNR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24709 (Experiment 1) 24709 49.57 558.738159 2+ 2+ 1115.4648537089402 0 -2.7639368975820866 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 94.4153577661431) Y3 1 0 96.4769647696477 Confident
|
|
|
1142 1141 P49327 GNAGQSNYGFANSAMER Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26988 (Experiment 1) 26988 52.213 927.36615 2+ 2+ 1852.7199758276302 0 -1.20166051790122 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
1143 1142 P14317 SAVGHEYVAEVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18539 (Experiment 1) 18539 41.716 473.238098 3+ 3+ 1416.6885087858407 0 2.786352692392924 100.0 Confident
|
|
|
1144 1143 P14866 FSTPEQAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13078 (Experiment 1) 13078 33.844 489.747803 2+ 2+ 977.4818104948904 0 -0.7732836411057993 100.0 Confident
|
|
|
1145 1144 P38159 ALEAVFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30921 (Experiment 1) 30921 56.792 417.73999 2+ 2+ 833.4647038787703 0 0.8655961232897674 98.91598915989161 Confident
|
|
|
1146 1145 Q12931 AQLLQPTLEINPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39358 (Experiment 1) 39358 66.845 746.929443 2+ 2+ 1491.8409271063103 0 2.279979630560858 99.45799457994579 Confident
|
|
|
1147 1146 Q9Y2X3 YGLIYHASLVGQTSPK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34278 (Experiment 1) 34278 60.684 907.447327 2+ 2+ 1812.8811508433105 0 -0.5784227338759925 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.0) 0 Y1-{Y1 Y5} 1 100.0 Confident
|
|
|
1148 1147 P36871 IALYETPTGWK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40003 (Experiment 1) 40003 67.741 679.820679 2+ 2+ 1357.6319190340405 0 -3.7612480670473922 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
1149 1148 P10809 GYISPYFINTSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40004 (Experiment 1) 40004 67.742 695.355591 2+ 2+ 1388.6976169175603 0 -0.7103203709625455 100.0 Confident
|
|
|
1150 1149 P25398 DVIEEYFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43005 (Experiment 1) 43005 72.448 521.75885 2+ 2+ 1041.5018772331302 0 1.2168790150356477 100.0 Confident
|
|
|
1151 1150 Q9NTK5 IGIVGLPNVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39681 (Experiment 1) 39681 67.293 533.834412 2+ 2+ 1065.6546299067702 0 -0.3360969858670769 100.0 Confident
|
|
|
1152 1151 P35579, P35580 AGVLAHLEEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25953 (Experiment 1) 25953 51.016 408.55069 3+ 3+ 1222.6305999869003 0 -0.2932212491775925 100.0 Confident
|
|
|
1153 1152 Q14566 ESEDFIVEQYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34608 (Experiment 1) 34608 61.067 693.823547 2+ 2+ 1385.6350762306504 0 -1.8269484034895518 96.19565217391303 Confident
|
|
|
1154 1153 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13408 (Experiment 1) 13408 34.336 400.860107 3+ 3+ 1199.5587540937802 0 -0.21827578105573345 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 99.25373134328358 Confident
|
|
|
1155 1154 Q00325 IQTQPGYANTLR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20116 (Experiment 1) 20116 43.689 721.849976 2+ 2+ 1440.6762434575103 1 4.020799938513704 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 94.58987783595113) Y7 1 0 97.5609756097561 Confident
|
|
|
1156 1155 P05141 AAYFGIYDTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37654 (Experiment 1) 37654 64.719 610.302979 2+ 2+ 1218.59208921986 0 -0.5605028356532256 99.73821989528795 Confident
|
|
|
1157 1156 P37837 MESALDQLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28585 (Experiment 1) 28585 54.093 517.763184 2+ 2+ 1033.5113963710103 0 0.40433111879581773 100.0 Confident
|
|
|
1158 1157 P62917 GVAMNPVEHPFGGGNHQHIGKPSTIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19959 (Experiment 1) 19959 43.497 685.097168 4+ 4+ 2736.3666851851904 0 -2.597819067543182 100.0 Doubtful
|
|
|
1159 1158 P17844, Q92841 GDGPICLVLAPTR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43251 (Experiment 1) 43251 72.884 684.868591 2+ 2+ 1367.72312047275 0 -0.3587594789920713 99.7340425531915 Confident
|
|
|
1160 1159 P39019 VLQALEGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34750 (Experiment 1) 34750 61.228 485.799469 2+ 2+ 969.5858816406103 0 -1.5403186134783262 99.73333333333333 Confident
|
|
|
1161 1160 P26038 TANDMIHAENMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18357 (Experiment 1) 18357 41.479 468.212036 3+ 3+ 1401.6129184007705 0 0.9683647622319022 97.74436090225565 Confident
|
|
|
1162 1161 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29018 (Experiment 1) 29018 54.596 528.26239 2+ 2+ 1054.5100129962104 0 0.20261730989276847 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1163 1162 P48444 NYCNIQVTK Phosphorylation of Y(2) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17917 (Experiment 1) 17917 40.835 610.262451 2+ 2+ 1218.5104240023702 0 -0.06139652661825248 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1164 1163 P10412, P16402, P16403, P22492, Q02539 ALAAAGYDVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21148 (Experiment 1) 21148 44.918 554.289246 2+ 2+ 1106.5607890915803 0 2.841462078597769 100.0 Confident
|
|
|
1165 1164 O95433 LNWTGTSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20863 (Experiment 1) 20863 44.547 453.737488 2+ 2+ 905.46068112749 0 -0.2843726245035878 99.45945945945947 Confident
|
|
|
1166 1165 P25705 VLSIGDGIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31013 (Experiment 1) 31013 56.901 500.793121 2+ 2+ 999.5712942056302 0 0.39423554849740816 99.73045822102425 Confident
|
|
|
1167 1166 P00338 DQLIYNLLKEEQTPQNK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46717 (Experiment 1) 46717 79.903 718.688293 3+ 3+ 2153.0405645886703 0 1.1525691003223695 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1168 1167 Q06323 VDVFREDLCTK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28349 (Experiment 1) 28349 53.817 461.230591 3+ 3+ 1380.67075054672 0 -0.5831838427241272 100.0 Confident
|
|
|
1169 1168 Q02790 ALELDSNNEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16981 (Experiment 1) 16981 39.568 566.773865 2+ 2+ 1131.5407819229904 0 -6.7088534460441975 100.0 Doubtful
|
|
|
1170 1169 P10412, P16402, P16403 KASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23251 (Experiment 1) 23251 47.744 442.926941 3+ 3+ 1325.7554661468505 0 2.6546605855447387 100.0 Confident
|
|
|
1171 1170 P09651, Q32P51 SSGPYGGGGQYFAK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23929 (Experiment 1) 23929 48.626 728.301025 2+ 2+ 1454.5867597467704 0 0.5061917759918209 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 8.445702272403691) Phosphorylation of Y (5: 0.5235602094240843) 0 Y11-{Y5 Y11} 1 96.19565217391303 Confident
|
|
|
1172 1171 P08238 YHTSQSGDEMTSLSEYVSR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39011 (Experiment 1) 39011 66.372 752.974304 3+ 3+ 2255.9042073385003 0 -1.38328519204637 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 2.162047371369046) Phosphorylation of Y (1: 99.65095986038395) 0 Y16-{Y1 Y16} 1 99.37888198757764 Confident
|
|
|
1173 1172 P49327 GNAGQSNYGFANSAMER Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27212 (Experiment 1) 27212 52.471 927.367676 2+ 2+ 1852.7199758276302 0 0.443857993075941 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
1174 1173 O95573 IGYSSPQTLADQSSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22496 (Experiment 1) 22496 46.85 831.373474 2+ 2+ 1660.7345461792704 0 -1.2937086513702043 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
1175 1174 Q8TEM1 AVDPTSGQLYGLAR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34426 (Experiment 1) 34426 60.857 764.363464 2+ 2+ 1526.71302288905 0 -0.4237659373896826 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 96.16055846422339) Y10 1 0 99.72972972972973 Confident
|
|
|
1176 1175 Q5T0F9 AEEVYAQLQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20436 (Experiment 1) 20436 44.057 629.790161 2+ 2+ 1257.5642333970404 0 1.2191927588166012 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.73333333333333 Confident
|
|
|
1177 1176 Q14697 LSFQHDPETSVLVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39251 (Experiment 1) 39251 66.692 580.981079 3+ 3+ 1739.9206339789903 0 0.44385892818396405 100.0 Confident
|
|
|
1178 1177 TRYP_PIG VATVSLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22812 (Experiment 1) 22812 47.222 421.758331 2+ 2+ 841.5021520166501 0 -0.05091810726730755 100.0 Confident
|
|
|
1179 1178 P39019 DVNQQEFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21388 (Experiment 1) 21388 45.276 567.780579 2+ 2+ 1133.5465360097703 0 0.060812761372204094 100.0 Confident
|
|
|
1180 1179 P68104, Q5VTE0 YYVTIIDAPGHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31299 (Experiment 1) 31299 57.236 468.913971 3+ 3+ 1403.71974934447 0 0.23760945084280002 100.0 Confident
|
|
|
1181 1180 P10412, P16402, P16403 SGVSLAALKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20105 (Experiment 1) 20105 43.677 487.305725 2+ 2+ 972.5967806774802 0 0.11942083154184095 100.0 Confident
|
|
|
1182 1181 Q02790 VGEVCHITCKPEYAYGSAGSPPK Phosphorylation of Y(13) Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20930 (Experiment 1) 20930 44.626 863.050476 3+ 3+ 2586.1284107002402 0 0.45879891596952793 Phosphorylation of Y (13: Doubtfull) Phosphorylation of Y (13: 9.890060795627313) Phosphorylation of Y (13: 0.0) 0 Y13-{Y13 Y15} 1 100.0 Confident
|
|
|
1183 1182 P00491 FGDRFPAMSDAYDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32964 (Experiment 1) 32964 59.155 549.91156 3+ 3+ 1646.7147406170202 0 -1.1456480328506278 97.87234042553192 Confident
|
|
|
1184 1183 P55263 AGHYAASIIIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26557 (Experiment 1) 26557 51.715 626.315857 2+ 2+ 1250.61727202941 0 -0.08858391739063537 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1185 1184 Q08211 KVFDPVPVGVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27630 (Experiment 1) 27630 52.973 429.2547 2+ 3+ 1284.7441731871602 0 -1.4774326952682908 92.41379310344827 Doubtful
|
|
|
1186 1185 Q15717 NVALLSQLYHSPAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38251 (Experiment 1) 38251 65.441 523.623352 3+ 3+ 1567.8470751159102 0 0.7330233925522963 100.0 Confident
|
|
|
1187 1186 P15153 HHCPSTPIILVGTK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21125 (Experiment 1) 21125 44.889 520.617188 3+ 3+ 1558.8289825236204 0 0.48152866970992136 100.0 Confident
|
|
|
1188 1187 P61158 YSYVCPDLVK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33224 (Experiment 1) 33224 59.453 622.306519 2+ 2+ 1242.5954603481403 0 2.430253817088969 100.0 Confident
|
|
|
1189 1188 P05388, Q8NHW5 GNVGFVFTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34786 (Experiment 1) 34786 61.271 484.763336 2+ 2+ 967.5127167003502 0 -0.6164179109599268 100.0 Confident
|
|
|
1190 1189 O95831 ISGLGLTPEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27060 (Experiment 1) 27060 52.296 571.82373 2+ 2+ 1141.6342883850104 0 -1.2078171067724675 100.0 Confident
|
|
|
1191 1190 P42704 SGGLGGSHALLLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36725 (Experiment 1) 36725 63.598 450.93457 3+ 3+ 1349.7779329269301 0 2.9181500054749416 100.0 Confident
|
|
|
1192 1191 P62424 TCTTVAFTQVNSEDKGALAK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26317 (Experiment 1) 26317 51.438 714.355225 3+ 3+ 2140.0470333439107 0 -1.4874670629537123 100.0 Confident
|
|
|
1193 1192 P62805 DAVTYTEHAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10301 (Experiment 1) 10301 29.196 567.774597 2+ 2+ 1133.5353026197304 0 -0.5825841563364397 99.74358974358975 Confident
|
|
|
1194 1193 P13796, P13797 MINLSVPDTIDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41455 (Experiment 1) 41455 69.833 751.880005 2+ 2+ 1501.7446437629703 0 0.5408468372331202 100.0 Confident
|
|
|
1195 1194 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16054 (Experiment 1) 16054 38.413 514.76355 2+ 2+ 1027.5120650773501 0 0.4681656766297929 100.0 Confident
|
|
|
1196 1195 Q92619 LYDPGQQYASHVR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18858 (Experiment 1) 18858 42.119 538.573792 3+ 3+ 1612.7035208345103 0 -2.459721849159061 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 13.82214083567011) Phosphorylation of Y (8: 99.47643979057592) 0 Y8-{Y2 Y8} 1 100.0 Confident
|
|
|
1197 1196 Q9Y2W1 SGKWEGLVYAPPGK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32898 (Experiment 1) 32898 59.081 523.588867 3+ 3+ 1567.7435947413403 0 0.7492259543553872 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
1198 1197 P62158 VFDKDGNGYISAAELR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33223 (Experiment 1) 33223 59.451 612.612976 3+ 3+ 1833.8298435464403 1 -8.764880100704294 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Doubtful
|
|
|
1199 1198 Q9NVP2, Q9Y294 NILASNPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15467 (Experiment 1) 15467 37.57 442.752136 2+ 2+ 883.4875645816701 0 2.433065560652491 97.289972899729 Confident
|
|
|
1200 1199 Q06830 HGEVCPAGWKPGSDTIKPDVQK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20260 (Experiment 1) 20260 43.852 602.301941 4+ 4+ 2405.17977884896 0 -0.4651801738689951 100.0 Doubtful
|
|
|
1201 1200 Q96AE4 QQAAYYAQTSPQGMPQHPPAPQGQ Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28173 (Experiment 1) 28173 53.611 887.722473 3+ 3+ 2660.1479002748606 0 -0.867641018506953 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (6: 0.0) 0 Y5-{Y5 Y6} 1 100.0 Confident
|
|
|
1202 1201 P06733 IDKLMIEMDGTENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30937 (Experiment 1) 30937 56.811 546.269531 3+ 3+ 1635.7847943227905 0 1.2016529253497596 100.0 Confident
|
|
|
1203 1202 P62805 KTVTAMDVVYALK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45683 (Experiment 1) 45683 78.074 759.885803 2+ 2+ 1517.7564679241605 0 0.3850199848418357 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
1204 1203 P78527 APGLGAFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26974 (Experiment 1) 26974 52.196 394.724701 2+ 2+ 787.4340724568301 0 0.9837366498083218 94.10187667560321 Confident
|
|
|
1205 1204 P15259, P18669 AMEAVAAQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10300 (Experiment 1) 10300 29.195 488.250641 2+ 2+ 974.4855159763404 0 1.2422836150093908 100.0 Confident
|
|
|
1206 1205 Q15018 AIYQVYNALQEK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39942 (Experiment 1) 39942 67.662 760.364014 2+ 2+ 1518.7119602598905 0 0.9961071055397315 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 11.733172724467732) Phosphorylation of Y (3: 84.27078180681356) 0 Y3-{Y3 Y6} 1 99.73333333333333 Confident
|
|
|
1207 1206 P78371 LAVEAVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32703 (Experiment 1) 32703 58.86 435.774231 2+ 2+ 869.5334521449302 0 0.5242642324232014 99.73190348525469 Confident
|
|
|
1208 1207 P33993 TQRPADVIFATVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35548 (Experiment 1) 35548 62.153 491.94342 3+ 3+ 1472.8099613312004 0 -1.0371992567409227 99.4186046511628 Confident
|
|
|
1209 1208 P22626 NYYEQWGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27167 (Experiment 1) 27167 52.419 584.229614 2+ 2+ 1166.4433899883702 0 1.099806812370634 Phosphorylation of Y (3: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (3: 15.359275832291647) 0 Y3-{Y2 Y3} 1 99.7289972899729 Confident
|
|
|
1210 1209 P17844 LIDFLECGK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42668 (Experiment 1) 42668 71.839 547.781067 2+ 2+ 1093.54778187973 0 -0.18329705929018889 99.73333333333333 Confident
|
|
|
1211 1210 P28907 LGTQTVPCNK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11262 (Experiment 1) 11262 30.965 559.287109 2+ 2+ 1116.55974354576 0 -0.07016018915825718 93.76693766937669 Confident
|
|
|
1212 1211 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21704 (Experiment 1) 21704 45.82 506.90802 3+ 3+ 1517.7014551458406 0 0.5099242783637523 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.83844911147011) Y11 1 0 100.0 Confident
|
|
|
1213 1212 Q6P1J9 TNYVVWGTGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33143 (Experiment 1) 33143 59.361 602.773621 2+ 2+ 1203.53253934594 0 0.12419293855499101 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1214 1213 P07910 VPPPPPIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18939 (Experiment 1) 18939 42.219 472.289795 2+ 2+ 942.5650866263802 0 -0.05246778778259151 90.2439024390244 Doubtful
|
|
|
1215 1214 P52272 FEPYANPTKR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15111 (Experiment 1) 15111 37.027 434.866669 3+ 3+ 1301.5805521675202 0 -1.8201468812714647 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.30191972076788) Y4 1 0 98.7012987012987 Confident
|
|
|
1216 1215 Q13347 LFDSTTLEHQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22495 (Experiment 1) 22495 46.848 440.226349 3+ 3+ 1317.6564803815704 0 0.5582116312174535 99.28057553956835 Confident
|
|
|
1217 1216 P20701 TSLLASGAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20693 (Experiment 1) 20693 44.348 486.778046 2+ 2+ 971.53999407735 0 1.5869568180423717 99.20212765957447 Confident
|
|
|
1218 1217 O75367 QTAAQLILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30253 (Experiment 1) 30253 56.024 493.305725 2+ 2+ 984.5967806774802 0 0.11796833456589706 99.74025974025975 Confident
|
|
|
1219 1218 Q9ULZ3 VLTDEQYQAVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20341 (Experiment 1) 20341 43.943 701.324463 2+ 2+ 1400.6337099391903 0 0.47276797978653545 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1220 1219 P62241 ISSLLEEQFQQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36883 (Experiment 1) 36883 63.789 502.932159 3+ 3+ 1505.7725727629704 0 1.3751619112036861 92.14285714285715 Doubtful
|
|
|
1221 1220 O75367 SIAFPSIGSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36805 (Experiment 1) 36805 63.694 546.295593 2+ 2+ 1090.57710786206 0 -0.4345591323359849 99.73045822102425 Confident
|
|
|
1222 1221 P07900 RAPFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40018 (Experiment 1) 40018 67.76 422.21933 3+ 3+ 1263.6360197205104 0 0.11122107972192434 100.0 Confident
|
|
|
1223 1222 P61158 AEPEDHYFLLTEPPLNTPENR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44472 (Experiment 1) 44472 75.342 854.726807 3+ 3+ 2561.1475488383503 0 4.306564654856679 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1224 1223 P50395 TYDATTHFETTCDDIK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24364 (Experiment 1) 24364 49.169 639.943604 3+ 3+ 1916.8098227703204 0 -0.43762730724607407 93.98496240601504 Confident
|
|
|
1225 1224 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34400 (Experiment 1) 34400 60.827 954.459839 2+ 2+ 1906.8978635366104 0 3.8040141091587336 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 10.654616120755556) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y5} 1 100.0 Confident
|
|
|
1226 1225 Q14671, Q8TB72 DQYANYVVQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21383 (Experiment 1) 21383 45.27 654.287292 2+ 2+ 1306.5594823697704 0 0.41930879766006934 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 23.915653034399412) Phosphorylation of Y (3: 1.1308562197092082) 0 Y3-{Y3 Y6} 1 100.0 Confident
|
|
|
1227 1226 P07900, P08238, Q14568 HNDDEQYAWESSAGGSFTVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35877 (Experiment 1) 35877 62.558 752.658875 3+ 3+ 2254.9515527359404 0 1.4361832822544531 100.0 Confident
|
|
|
1228 1227 P35606 TYLPSQVSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21384 (Experiment 1) 21384 45.272 565.765564 2+ 2+ 1129.5168892818003 0 -0.277690404944314 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 97.09208400646203) Y2 1 0 99.46666666666667 Confident
|
|
|
1229 1228 P40926 EGVVECSFVK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27086 (Experiment 1) 27086 52.325 577.28186 2+ 2+ 1152.5485101557204 0 0.5689690555744901 100.0 Confident
|
|
|
1230 1229 O00148 HFVLDECDK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20432 (Experiment 1) 20432 44.048 581.762451 2+ 2+ 1161.51245900017 0 -1.8133947665196903 100.0 Confident
|
|
|
1231 1230 P16885 MYVDPSEINPSMPQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37970 (Experiment 1) 37970 65.099 922.392578 2+ 2+ 1842.7681718900103 0 1.3178659647816968 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.86914378029078) Y2 1 0 99.45652173913044 Confident
|
|
|
1232 1231 P63104 YLAEVAAGDDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14355 (Experiment 1) 14355 35.824 640.331177 2+ 2+ 1278.6455813447003 0 1.7332636631592373 96.19565217391303 Confident
|
|
|
1233 1232 P36957 GLVVPVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36964 (Experiment 1) 36964 63.885 426.787598 2+ 2+ 851.5592729699501 0 1.6051293799852149 99.7289972899729 Confident
|
|
|
1234 1233 Q12906 AYAALAALEK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36724 (Experiment 1) 36724 63.597 551.273865 2+ 2+ 1099.5314767167804 1 -1.5019691961006534 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1235 1234 Q92841 QLAEDFLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36806 (Experiment 1) 36806 63.695 496.263794 2+ 2+ 990.5134449763402 0 -0.41299587010991917 98.91598915989161 Confident
|
|
|
1236 1235 P07910 GFAFVQYVNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42749 (Experiment 1) 42749 71.991 665.333191 2+ 2+ 1328.6513354314802 0 0.37096832500430155 100.0 Confident
|
|
|
1237 1236 P22626 IDTIEIITDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40341 (Experiment 1) 40341 68.251 594.827148 2+ 2+ 1187.6397676882702 0 -0.020696679722128564 100.0 Confident
|
|
|
1238 1237 P52272 FEPYANPTKR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 15013 (Experiment 1) 15013 36.858 651.797852 2+ 2+ 1301.5805521675202 0 0.45942091482114633 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 99.45799457994579 Confident
|
|
|
1239 1238 Q9Y277 YKVCNYGLTFTQK Phosphorylation of Y(6) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31273 (Experiment 1) 31273 57.204 567.928772 3+ 3+ 1700.7633442097501 0 0.6705010887698464 Phosphorylation of Y (6: Random) Phosphorylation of Y (1: 0.0, 6: 0.0) Phosphorylation of Y (6: 0.17452006980802792) 0 Y6-{Y1 Y6} 1 100.0 Confident
|
|
|
1240 1239 Q9Y265 LDPSIFESLQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44392 (Experiment 1) 44392 75.126 638.843384 2+ 2+ 1275.6710678165505 0 0.8979124494915537 100.0 Confident
|
|
|
1241 1240 P07900, P08238, Q58FF6, Q58FF7 EDQTEYLEER Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20363 (Experiment 1) 20363 43.967 696.27301 2+ 2+ 1390.5289700871303 0 1.793106789287419 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.77835951134381) Y6 1 0 99.45652173913044 Confident
|
|
|
1242 1241 P50395 TDDYLDQPCYETINR Phosphorylation of Y(10) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34421 (Experiment 1) 34421 60.851 991.891235 2+ 2+ 1981.7764876442402 0 -4.320302738009747 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 13.327477663949075) Phosphorylation of Y (10: 76.10068631180204) 0 Y10-{Y4 Y10} 1 99.7289972899729 Doubtful
|
|
|
1243 1242 Q13162 QITLNDLPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38904 (Experiment 1) 38904 66.239 613.348816 2+ 2+ 1224.68263555976 0 0.3615453105509488 100.0 Confident
|
|
|
1244 1243 P11142, P54652 STAGDTHLGGEDFDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18853 (Experiment 1) 18853 42.113 846.368347 2+ 2+ 1690.7183053439803 0 2.2659939379814262 99.2248062015504 Confident
|
|
|
1245 1244 TRYP_PIG VATVSLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22169 (Experiment 1) 22169 46.445 421.758545 2+ 2+ 841.5021520166501 0 0.4564814469377312 99.73753280839895 Confident
|
|
|
1246 1245 Q96IX5 AGPESDAQYQFTGIK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34183 (Experiment 1) 34183 60.57 846.370789 2+ 2+ 1690.7239814955703 0 1.7980159035188317 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
1247 1246 Q99873 TGFSTSPESPYTHWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29433 (Experiment 1) 29433 55.073 575.602417 3+ 3+ 1723.7842000758303 0 0.7073890828980351 92.99363057324841 Doubtful
|
|
|
1248 1247 P24752 EAYMGNVLQGGEGQAPTR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32861 (Experiment 1) 32861 59.04 653.287537 3+ 3+ 1956.8400909603101 0 0.3523917919634398 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.76898222940227) Y3 1 0 99.25925925925925 Confident
|
|
|
1249 1248 P29401 SVPTSTVFYPSDGVATEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34922 (Experiment 1) 34922 61.431 943.467041 2+ 2+ 1883.9152738150308 1 0.4774374593358696 91.08108108108108 Doubtful
|
|
|
1250 1249 Q16630 GDYGPPGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10329 (Experiment 1) 10329 29.245 449.676483 2+ 2+ 897.3381966438401 0 0.24064254668612978 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
1251 1250 Q14739 FADGEVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17741 (Experiment 1) 17741 40.607 446.73056 2+ 2+ 891.4450310633501 0 1.7191634109720255 93.6 Confident
|
|
|
1252 1251 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17914 (Experiment 1) 17914 40.828 514.76416 2+ 2+ 1027.5120650773501 0 1.653176319902592 96.2059620596206 Confident
|
|
|
1253 1252 P26583 SEHPGLSIGDTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17075 (Experiment 1) 17075 39.697 437.889709 3+ 3+ 1310.6466439738604 0 0.4975575777167677 100.0 Confident
|
|
|
1254 1253 P13804 VLVAQHDVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14852 (Experiment 1) 14852 36.569 626.310974 2+ 2+ 1250.6060386393704 0 1.0828713934619494 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 94.24083769633508) Y9 1 0 93.65079365079364 Confident
|
|
|
1255 1254 P27797 AKIDDPTDSKPEDWDKPEHIPDPDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24840 (Experiment 1) 24840 49.72 740.604919 4+ 4+ 2958.3883105313703 0 0.7627559063428265 100.0 Doubtful
|
|
|
1256 1255 CYC_HUMAN, P99999 ADLIAYLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42213 (Experiment 1) 42213 71.057 453.768097 2+ 2+ 905.5222187548902 0 -0.6365455727356257 92.62086513994912 Confident
|
|
|
1257 1256 P13639, Q15029 GGGQIIPTAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19445 (Experiment 1) 19445 42.843 485.276855 2+ 2+ 968.54032843052 0 -1.2069015018464724 99.72826086956522 Confident
|
|
|
1258 1257 P15170 LESGSICK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 9990 (Experiment 1) 9990 28.554 447.224701 2+ 2+ 892.4324177743201 0 2.718207043613237 97.8891820580475 Confident
|
|
|
1259 1258 P13693, Q56UQ5 VKPFMTGAAEQIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24276 (Experiment 1) 24276 49.065 710.387268 2+ 2+ 1418.7591716283005 0 0.5711240722295887 91.32791327913279 Confident
|
|
|
1260 1259 P11940, Q13310 SLGYAYVNFQQPADAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39617 (Experiment 1) 39617 67.211 965.463013 2+ 2+ 1927.9064404668304 1 0.8693421913011666 92.63157894736842 Doubtful
|
|
|
1261 1260 P33992 AIACLLFGGSR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43855 (Experiment 1) 43855 73.884 582.813538 2+ 2+ 1163.61211347179 0 0.35139431654642533 100.0 Confident
|
|
|
1262 1261 Q92598 FVVQNVSAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19940 (Experiment 1) 19940 43.475 560.311646 2+ 2+ 1118.6084079903403 0 0.29543927536804654 100.0 Confident
|
|
|
1263 1262 O43175 GGIVDEGALLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36051 (Experiment 1) 36051 62.78 550.308716 2+ 2+ 1098.6033226099 0 -0.40299502127500103 99.50248756218906 Confident
|
|
|
1264 1263 Q15365 IANPVEGSSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14187 (Experiment 1) 14187 35.583 543.779175 2+ 2+ 1085.54653600977 0 -2.518427168874901 92.63157894736842 Confident
|
|
|
1265 1264 O00232 AIYDTPCIQAESEK Phosphorylation of Y(3) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28776 (Experiment 1) 28776 54.32 852.864624 2+ 2+ 1703.7113682065406 0 1.950407034427465 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1266 1265 P38646 VQQTVQDLFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37312 (Experiment 1) 37312 64.298 645.848694 2+ 2+ 1289.6727991520502 0 7.769615696493112 100.0 Doubtful
|
|
|
1267 1266 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19977 (Experiment 1) 19977 43.518 636.766785 2+ 2+ 1271.5183458337801 0 0.5270634126746891 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1268 1267 P49368 KGESQTDIEITREEDFTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24772 (Experiment 1) 24772 49.643 539.263367 4+ 4+ 2153.0236550470404 0 0.32780176924527793 100.0 Doubtful
|
|
|
1269 1268 Q13162 DYGVYLEDSGHTLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32637 (Experiment 1) 32637 58.785 568.91333 3+ 3+ 1703.7192304683003 0 -0.6268488885423751 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 20.693682721948154) Phosphorylation of Y (2: 3.926701570680628) 0 Y2-{Y2 Y5} 1 99.3975903614458 Confident
|
|
|
1270 1269 P00558, P07205 LGDVYVNDAFGTAHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32963 (Experiment 1) 32963 59.154 545.6026 3+ 3+ 1633.7848687821704 0 0.6731505894883062 100.0 Confident
|
|
|
1271 1270 P25786 NVSIGIVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26646 (Experiment 1) 26646 51.814 443.771179 2+ 2+ 885.5283667644903 0 -0.6328686779476467 98.93048128342245 Confident
|
|
|
1272 1271 P37802 GPAYGLSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13814 (Experiment 1) 13814 34.959 450.702362 2+ 2+ 899.3902322167003 0 -0.06783891677438303 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 85.51483420593368) Y4 1 0 95.23809523809523 Confident
|
|
|
1273 1272 P27824 GTLSGWILSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43082 (Experiment 1) 43082 72.566 531.302612 2+ 2+ 1060.5916952970401 0 -0.9638854148240176 96.7479674796748 Confident
|
|
|
1274 1273 Q9NQ29, Q9Y383 ADYEIASK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11910 (Experiment 1) 11910 31.958 488.705048 2+ 2+ 975.3950428136204 0 0.5118148602090739 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 89.82229402261711) Y3 1 0 97.58713136729223 Confident
|
|
|
1275 1274 P07900 HLEINPDHSIIETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34524 (Experiment 1) 34524 60.971 596.318909 3+ 3+ 1785.93734667229 0 -1.3689930763936684 100.0 Confident
|
|
|
1276 1275 P10809 IPAMTIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24512 (Experiment 1) 24512 49.342 422.751587 2+ 2+ 843.4888104516303 0 -0.22399113063010676 99.73474801061008 Confident
|
|
|
1277 1276 P62249 ALVAYYQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23859 (Experiment 1) 23859 48.536 518.247437 2+ 2+ 1034.4837982483702 0 -3.3547395328196328 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (5: 15.270506108202442) 0 Y5-{Y5 Y6} 1 99.19354838709677 Confident
|
|
|
1278 1277 P26599 GQPIYIQFSNHK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31872 (Experiment 1) 31872 57.911 504.573181 3+ 3+ 1510.6969789020904 0 0.4853592817353012 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1279 1278 P62937, PPIA_HUMAN EGMNIVEAMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41450 (Experiment 1) 41450 69.828 639.793884 2+ 2+ 1277.5744076337305 0 -0.931992531442264 99.7289972899729 Confident
|
|
|
1280 1279 P60842, Q14240 GYDVIAQAQSGTGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24019 (Experiment 1) 24019 48.737 737.832825 2+ 2+ 1473.6500882793205 0 0.6836153873475997 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1281 1280 P57721, Q15365, Q15366 INISEGNCPER Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16980 (Experiment 1) 16980 39.567 644.80127 2+ 2+ 1287.58774919875 0 0.18445037315965754 100.0 Confident
|
|
|
1282 1281 P06733 SGKYDLDFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23583 (Experiment 1) 23583 48.168 536.768799 2+ 2+ 1071.5236753068702 0 -0.5870685159807745 100.0 Confident
|
|
|
1283 1282 P62753 LNISFPATGCQK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35292 (Experiment 1) 35292 61.859 668.339722 2+ 2+ 1334.6652712434604 0 -0.28441895927791866 100.0 Confident
|
|
|
1284 1283 P27348 YLAEVACGDDR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21121 (Experiment 1) 21121 44.883 634.780762 2+ 2+ 1267.55030106087 0 -2.622941619464739 100.0 Confident
|
|
|
1285 1284 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31873 (Experiment 1) 31873 57.914 630.79718 2+ 2+ 1259.5798834611805 0 -0.060554170526668956 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1286 1285 P12956 SDSFENPVLQQHFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33768 (Experiment 1) 33768 60.077 568.609314 3+ 3+ 1702.8063325027404 0 -0.1289128536084125 100.0 Confident
|
|
|
1287 1286 P43243 DSFDDRGPSLNPVLDYDHGSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36050 (Experiment 1) 36050 62.779 591.272888 4+ 4+ 2361.06216581408 0 0.11852340543516413 100.0 Doubtful
|
|
|
1288 1287 Q99543 NQDHYAVLGLGHVR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26748 (Experiment 1) 26748 51.933 553.598999 3+ 3+ 1657.7726034538402 0 1.5439272153039167 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1289 1288 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28775 (Experiment 1) 28775 54.317 609.260498 2+ 2+ 1216.5053215385904 0 0.9204017176637955 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.714203795409155) Phosphorylation of Y (6: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1290 1289 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16702 (Experiment 1) 16702 39.209 514.764465 2+ 2+ 1027.5120650773501 0 2.245681641649418 100.0 Confident
|
|
|
1291 1290 P50995 SETDLLDIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38337 (Experiment 1) 38337 65.555 531.276978 2+ 2+ 1060.5400536470001 0 -0.6122797080684704 100.0 Confident
|
|
|
1292 1291 P18669, Q8N0Y7 SYDVPPPPMEPDHPFYSNISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37742 (Experiment 1) 37742 64.824 806.374268 3+ 3+ 2416.10454822003 0 -1.477235955674185 94.77611940298507 Doubtful
|
|
|
1293 1292 P34932 VLATAFDTTLGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38515 (Experiment 1) 38515 65.771 661.35907 2+ 2+ 1320.7037649271601 0 -0.13446610811371631 100.0 Confident
|
|
|
1294 1293 Q15814 LYGNPNTLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19292 (Experiment 1) 19292 42.657 564.266174 2+ 2+ 1126.5172236349702 0 0.5063494156964685 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
1295 1294 P06733 LMIEMDGTENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31034 (Experiment 1) 31034 56.926 640.795532 2+ 2+ 1279.5788243078302 0 -1.804973008997426 98.6522911051213 Confident
|
|
|
1296 1295 P06733 SGKYDLDFKSPDDPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23904 (Experiment 1) 23904 48.594 457.469391 4+ 4+ 1825.8482568843701 0 0.10997916352008937 100.0 Doubtful
|
|
|
1297 1296 B0I1T2 VGELVGVLAAHCQGEGR Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32714 (Experiment 1) 32714 58.872 584.63446 3+ 3+ 1750.8784518971802 0 1.7667494650851008 100.0 Confident
|
|
|
1298 1297 Q15459 ASKPLPPAPAPDEYLVSPITGEK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38598 (Experiment 1) 38598 65.867 819.749084 3+ 3+ 2456.2240082539 0 0.5751135742478403 Phosphorylation of Y (14: Very Confident) Phosphorylation of Y (14: 100.0) Phosphorylation of Y (14: 99.82547993019197) Y14 1 0 100.0 Confident
|
|
|
1299 1298 P49354 NYQVWHHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10980 (Experiment 1) 10980 30.456 610.261414 2+ 2+ 1218.5083902867702 0 -0.09440248143732202 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
1300 1299 P61604 GGEIQPVSVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17776 (Experiment 1) 17776 40.652 507.285156 2+ 2+ 1012.5553097883203 0 0.4428261396611478 99.73045822102425 Confident
|
|
|
1301 1300 P22314 AENYDIPSADR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19105 (Experiment 1) 19105 42.426 665.76947 2+ 2+ 1329.5238251370401 0 0.4220151254159228 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1302 1301 P23193, Q15560 NCTYTQVQTR Phosphorylation of Y(4) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10485 (Experiment 1) 10485 29.568 675.779114 2+ 2+ 1349.5435150358003 0 0.11840451362291328 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.72826086956522 Confident
|
|
|
1303 1302 P33991 YQQLFEDIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38406 (Experiment 1) 38406 65.639 606.305115 2+ 2+ 1210.5982372294602 0 -2.111278311693876 98.91598915989161 Confident
|
|
|
1304 1303 P62995 GYDDRDYYSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15541 (Experiment 1) 15541 37.669 437.186005 3+ 3+ 1308.5370935248802 0 -0.6922489720656212 100.0 Confident
|
|
|
1305 1304 P09651 NQGGYGGSSSSSSYGSGR Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9111 (Experiment 1) 9111 26.875 887.837402 2+ 2+ 1773.6591493928802 0 0.6204256413917388 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 44.290626167326955) Phosphorylation of Y (14: 0.9693053311793215) 0 Y14-{Y5 Y14} 1 100.0 Confident
|
|
|
1306 1305 Q99832 TFSYAGFEMQPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39934 (Experiment 1) 39934 67.65 703.328125 2+ 2+ 1404.6383877892804 0 2.352589611597751 100.0 Confident
|
|
|
1307 1306 P50990 HFSGLEEAVYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28740 (Experiment 1) 28740 54.277 694.304626 2+ 2+ 1386.5969305076505 0 -1.6069586787417534 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 96.33507853403141) Y10 1 0 99.01477832512316 Confident
|
|
|
1308 1307 P07900, Q58FG0 EGLELPEDEEEKKKQEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15785 (Experiment 1) 15785 38.033 547.520752 4+ 4+ 2186.0590374962508 0 -2.3448204651283495 100.0 Doubtful
|
|
|
1309 1308 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45150 (Experiment 1) 45150 76.908 625.279358 2+ 2+ 1248.5427696764702 0 1.1142151426592288 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 99.73753280839895 Confident
|
|
|
1310 1309 P28907 YTEIHPEMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16480 (Experiment 1) 16480 38.935 392.52182 3+ 3+ 1174.5440934816202 0 -0.3930837732213748 99.37888198757764 Confident
|
|
|
1311 1310 P68104, Q05639, Q5VTE0 THINIVVIGHVDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26451 (Experiment 1) 26451 51.594 530.299072 3+ 3+ 1587.8732898637504 0 1.3179598002888122 100.0 Confident
|
|
|
1312 1311 P08621 EFEVYGPIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38244 (Experiment 1) 38244 65.433 581.262451 2+ 2+ 1160.5154922994702 0 -4.42417218836495 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.72826086956522 Doubtful
|
|
|
1313 1312 P00441, SODC_HUMAN GDGPVQGIINFEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41208 (Experiment 1) 41208 69.477 751.385803 2+ 2+ 1500.757257052 0 -0.13573958659832613 100.0 Confident
|
|
|
1314 1313 P54577 LASAAYPDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17157 (Experiment 1) 17157 39.802 560.286926 2+ 2+ 1118.56078909158 0 -1.3296965838594184 98.95287958115183 Confident
|
|
|
1315 1314 Q86UX7 AGDALWLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36953 (Experiment 1) 36953 63.873 451.248047 2+ 2+ 900.48175092524 0 -0.23253154951547766 92.40837696335078 Confident
|
|
|
1316 1315 P06733 YISPDQLADLYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44021 (Experiment 1) 44021 74.179 713.367126 2+ 2+ 1424.7187462849604 0 0.6678062507948368 100.0 Confident
|
|
|
1317 1316 Q13200 FGGSGSQVDSAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11283 (Experiment 1) 11283 30.994 584.274292 2+ 2+ 1166.5316142216202 0 2.0682492685998004 100.0 Confident
|
|
|
1318 1317 P11142, P54652 STAGDTHLGGEDFDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19010 (Experiment 1) 19010 42.304 564.579468 3+ 3+ 1690.7183053439803 0 -1.0218476734609847 100.0 Confident
|
|
|
1319 1318 P50395 TDDYLDQPCYETINR Phosphorylation of Y(10) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34253 (Experiment 1) 34253 60.656 661.600037 3+ 3+ 1981.7764876442402 0 0.9038476648437785 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 9.625675058248767) Phosphorylation of Y (10: 99.82547993019197) 0 Y10-{Y4 Y10} 1 100.0 Confident
|
|
|
1320 1319 P34897 AMADALLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32499 (Experiment 1) 32499 58.628 495.257599 2+ 2+ 988.5011660404803 0 -0.5259624800901388 99.46091644204851 Confident
|
|
|
1321 1320 Q9Y2X3 YGLIYHASLVGQTSPK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34172 (Experiment 1) 34172 60.558 605.301941 3+ 3+ 1812.8811508433105 0 1.5654780483942712 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 4.524769842115505) Phosphorylation of Y (5: 0.0) 0 Y5-{Y1 Y5} 1 100.0 Confident
|
|
|
1322 1321 P35579 KVIQYLAYVASSHK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33584 (Experiment 1) 33584 59.867 562.959412 3+ 3+ 1685.8542078194807 0 1.3019191669173429 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 12.279802919763496) Phosphorylation of Y (5: 19.87075928917609) 0 Y5-{Y5 Y8} 1 100.0 Confident
|
|
|
1323 1322 P37235, P84074 IYANFFPYGDASK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45690 (Experiment 1) 45690 78.082 786.843567 2+ 2+ 1571.6697610947404 0 1.7919551020362248 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 15.4045583914898) Phosphorylation of Y (2: 87.33631115830069) 0 Y2-{Y2 Y8} 1 100.0 Confident
|
|
|
1324 1323 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33135 (Experiment 1) 33135 59.351 622.26532 3+ 3+ 1863.7750310922602 0 -0.4823731575672334 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 13.489623952122926) Phosphorylation of Y (6: 82.27263574122212) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
1325 1324 P63010, Q10567 YNDPIYVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24439 (Experiment 1) 24439 49.256 506.2612 2+ 2+ 1010.5072969667403 0 0.5432965577412189 99.19354838709677 Confident
|
|
|
1326 1325 P37802 IQASTMAFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23855 (Experiment 1) 23855 48.531 498.763275 2+ 2+ 995.5110024481903 0 0.9970854184616174 100.0 Confident
|
|
|
1327 1326 P61204, P84077, P84085 DAVLLVFANK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45345 (Experiment 1) 45345 77.309 545.318298 2+ 2+ 1088.6229954253204 0 -0.8732130540460171 99.1891891891892 Confident
|
|
|
1328 1327 O43809 YIQQTKPLTLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20793 (Experiment 1) 20793 44.465 497.283539 3+ 3+ 1488.8300280694402 0 -0.831496686415371 92.14285714285715 Doubtful
|
|
|
1329 1328 P45880 YQLDPTASISAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29768 (Experiment 1) 29768 55.46 647.338928 2+ 2+ 1292.6612314088402 0 1.6001361582059765 100.0 Confident
|
|
|
1330 1329 P17844 NFYQEHPDLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21659 (Experiment 1) 21659 45.74 463.889313 3+ 3+ 1388.6473126802002 0 -0.8644875421452931 96.71052631578947 Confident
|
|
|
1331 1330 P11142 LSKEDIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10643 (Experiment 1) 10643 29.849 495.265808 2+ 2+ 988.5189242796002 0 -1.8790008283319828 99.46091644204851 Confident
|
|
|
1332 1331 Q02878 YYPTEDVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22664 (Experiment 1) 22664 47.048 570.777649 2+ 2+ 1138.5294889633 1 6.927628382097525 100.0 Doubtful
|
|
|
1333 1332 Q07666 KDDEENYLDLFSHK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36489 (Experiment 1) 36489 63.321 611.595947 3+ 3+ 1831.7665745835404 0 -0.3068386387309492 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1334 1333 P62805 DNIQGITKPAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21052 (Experiment 1) 21052 44.792 663.381348 2+ 2+ 1324.74629844548 0 1.3903190570205592 100.0 Confident
|
|
|
1335 1334 P08238, Q58FF7 IDIIPNPQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33372 (Experiment 1) 33372 59.622 597.829102 2+ 2+ 1193.6404363946103 0 2.6886282366426335 99.45799457994579 Confident
|
|
|
1336 1335 P38919 EQIYDVYR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29969 (Experiment 1) 29969 55.693 583.249023 2+ 2+ 1164.4852548003503 0 -1.5102736946974018 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 12.680432057035638) Phosphorylation of Y (4: 82.72251308900525) 0 Y7-{Y4 Y7} 1 100.0 Confident
|
|
|
1337 1336 Q5EBM0 AVLDLVDQCPK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35555 (Experiment 1) 35555 62.162 629.329895 2+ 2+ 1256.6434731697202 0 1.4014105650570519 100.0 Confident
|
|
|
1338 1337 P61978 NLPLPPPPPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30830 (Experiment 1) 30830 56.686 597.853271 2+ 2+ 1193.6920780446499 0 -0.07441480359954439 97.8319783197832 Confident
|
|
|
1339 1338 Q9NTK5 LKPEYDIMCK Phosphorylation of Y(5) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24619 (Experiment 1) 24619 49.465 688.803101 2+ 2+ 1375.5917110981802 0 -0.045028689283752116 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.72826086956522 Confident
|
|
|
1340 1339 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19772 (Experiment 1) 19772 43.254 636.765869 2+ 2+ 1271.5183458337801 0 -0.9114545886447922 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1341 1340 Q9BZW8 NHSPSFNSTIYEVIGK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43026 (Experiment 1) 43026 72.485 624.9552 3+ 3+ 1871.8454936105804 0 -0.9190042384284923 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.30191972076788) Y11 1 0 99.27536231884058 Confident
|
|
|
1342 1341 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 LAVNMVPFPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42485 (Experiment 1) 42485 71.463 572.320923 2+ 2+ 1142.6270352599402 0 0.22522896105043858 100.0 Confident
|
|
|
1343 1342 Q8NBJ5 SLYHSVEWRPAEEPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26613 (Experiment 1) 26613 51.778 645.963501 3+ 3+ 1934.8676260374905 0 0.5405685398246814 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1344 1343 Q9Y277 VCNYGLTFTQK Phosphorylation of Y(4) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32054 (Experiment 1) 32054 58.118 705.810364 2+ 2+ 1409.6050526632 0 0.7951173046130933 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1345 1344 P23528 AVLFCLSEDKK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31528 (Experiment 1) 31528 57.504 437.235413 3+ 3+ 1308.6747732980004 0 7.3464408947329805 100.0 Doubtful
|
|
|
1346 1345 Q86XP3 KSEYTQPTPIQCQGVPVALSGR Phosphorylation of Y(4) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33216 (Experiment 1) 33216 59.442 832.738159 3+ 3+ 2495.1879741816906 0 1.8707067223003355 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1347 1346 Q15717 FGGPVHHQAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5356 (Experiment 1) 5356 18.863 411.879578 3+ 3+ 1232.6162873354403 0 0.4995508921160568 100.0 Confident
|
|
|
1348 1347 P13010 TWTVVDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26328 (Experiment 1) 26328 51.452 460.24826 2+ 2+ 918.4810822189004 0 0.9612728642486813 99.45799457994579 Confident
|
|
|
1349 1348 P11310 NTYYASIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20922 (Experiment 1) 20922 44.616 515.764893 2+ 2+ 1029.5131106231704 0 2.0575727442824396 95.13513513513514 Confident
|
|
|
1350 1349 P63244 YTVQDESHSEWVSCVR Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28411 (Experiment 1) 28411 53.891 661.295471 3+ 3+ 1980.8635896786805 0 0.500997121190031 100.0 Confident
|
|
|
1351 1350 P07900 NPDDITNEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35422 (Experiment 1) 35422 62.011 957.382263 2+ 2+ 1912.7404194053506 0 4.989495347018389 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 14: 0.0) Phosphorylation of Y (10: 12.416287163502725) 0 Y10-{Y10 Y14} 1 100.0 Doubtful
|
|
|
1352 1351 P52272 GCAVVEFK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22890 (Experiment 1) 22890 47.312 455.227325 2+ 2+ 908.4425885352002 0 -2.7365031374381705 100.0 Confident
|
|
|
1353 1352 P55263 AGHYAASIIIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26329 (Experiment 1) 26329 51.453 626.317688 2+ 2+ 1250.61727202941 0 2.8348608864784928 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.70759289176091) Y4 1 0 99.72826086956522 Confident
|
|
|
1354 1353 P07737 DSPSVWAAVPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35648 (Experiment 1) 35648 62.272 607.313782 2+ 2+ 1212.6138872936003 0 -0.7213952806970688 97.289972899729 Confident
|
|
|
1355 1354 Q15046 RGDIIGVQGNPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14933 (Experiment 1) 14933 36.715 437.577301 3+ 3+ 1309.71024728993 0 -0.13231212153085925 99.24812030075188 Confident
|
|
|
1356 1355 P08238 HLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30415 (Experiment 1) 30415 56.208 594.988525 3+ 3+ 1781.94243205273 0 0.7358953130764845 100.0 Confident
|
|
|
1357 1356 Q13242 GSPHYFSPFRPY Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40024 (Experiment 1) 40024 67.768 767.830627 2+ 2+ 1533.6442150532403 0 1.6188577746041202 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 18.007917952031534) Phosphorylation of Y (5: 96.68411867364746) 0 Y12-{Y5 Y12} 1 99.23076923076923 Confident
|
|
|
1358 1357 P62854, Q5JNZ5 LHYCVSCAIHSK Phosphorylation of Y(3) Carbamidomethylation of C(4, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15103 (Experiment 1) 15103 37.01 518.891357 3+ 3+ 1553.6520199389604 0 0.1423937350375415 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1359 1358 P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0 FDSDVGEYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22121 (Experiment 1) 22121 46.381 544.238159 2+ 2+ 1086.4618033263002 0 -0.03514998205964023 100.0 Confident
|
|
|
1360 1359 Q9BUR5 VDELSLYSVPEGQSK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36587 (Experiment 1) 36587 63.432 865.897217 2+ 2+ 1729.7811620185205 0 -0.7396670020982415 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1361 1360 P26640 DPGVITYDLPTPPGEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41475 (Experiment 1) 41475 69.864 889.921082 2+ 2+ 1777.8175475272403 0 5.654207007974865 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.86914378029078) Y7 1 0 98.91598915989161 Doubtful
|
|
|
1362 1361 O00148, Q13838 ELAFQISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32865 (Experiment 1) 32865 59.044 468.263153 2+ 2+ 934.5123823471802 0 -0.6719302781362197 99.73753280839895 Confident
|
|
|
1363 1362 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20264 (Experiment 1) 20264 43.858 713.291809 2+ 2+ 1424.5666150733405 0 1.717387759080821 Phosphorylation of Y (4: Doubtfull, 9: Doubtfull) Phosphorylation of Y (4: 64.45862165757454, 9: 67.34064364954418) 0 Y4-{Y4}, Y9-{Y9} 2 98.6449864498645 Confident
|
|
|
1364 1363 P62269 KADIDLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11508 (Experiment 1) 11508 31.329 452.261017 2+ 2+ 902.5072969667401 0 0.20353254700354476 99.73118279569893 Confident
|
|
|
1365 1364 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27159 (Experiment 1) 27159 52.411 528.261597 2+ 2+ 1054.5100129962104 0 -1.298530936920847 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.60383944153578) Y7 1 0 98.91304347826086 Confident
|
|
|
1366 1365 O43390, O60506 GFCFLEYEDHK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39018 (Experiment 1) 39018 66.38 482.212372 3+ 3+ 1443.6129013174304 0 1.6488489339501977 100.0 Confident
|
|
|
1367 1366 Q16658 LSCFAQTVSPAEK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25298 (Experiment 1) 25298 50.254 719.354614 2+ 2+ 1436.6969652945604 0 -1.5918606027707864 99.72972972972973 Confident
|
|
|
1368 1367 P09651 SSGPYGGGGQYFAKPR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20538 (Experiment 1) 20538 44.172 570.253723 3+ 3+ 1707.7406346192204 0 -0.7569839082731123 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 15.816076247225412) Phosphorylation of Y (11: 0.0) 0 Y11-{Y5 Y11} 1 100.0 Confident
|
|
|
1369 1368 P23588 GLNISAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24442 (Experiment 1) 24442 49.26 415.247833 2+ 2+ 828.48175092524 0 -0.7680453976099542 98.94736842105263 Confident
|
|
|
1370 1369 P28066 GVNTFSPEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18934 (Experiment 1) 18934 42.214 532.262695 2+ 2+ 1062.50942222506 0 1.3290835611783793 99.72972972972973 Confident
|
|
|
1371 1370 O15460 RLFCRYHHGNR Phosphorylation of Y(6) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27151 (Experiment 1) 27151 52.402 798.870789 2+ 2+ 1594.7088980818103 1 9.251537425586527 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 91.44851657940663) Y6 1 0 92.11956521739131 Doubtful
|
|
|
1372 1371 P00338 RVHPVSTMIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10689 (Experiment 1) 10689 29.926 389.89386 3+ 3+ 1166.6593980173802 0 0.30143442120390224 99.37888198757764 Confident
|
|
|
1373 1372 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14284 (Experiment 1) 14284 35.715 600.78595 2+ 2+ 1199.5587540937802 0 -1.1709875678683621 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 99.72826086956522 Confident
|
|
|
1374 1373 P08238 NPDDITQEEYGEFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37657 (Experiment 1) 37657 64.723 924.403076 2+ 2+ 1846.7897389487405 0 1.0061192759315183 100.0 Confident
|
|
|
1375 1374 P37837 LLGELLQDNAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38597 (Experiment 1) 38597 65.865 607.340027 2+ 2+ 1212.6714021697203 0 -4.858130877137739 100.0 Doubtful
|
|
|
1376 1375 P16401 KATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24389 (Experiment 1) 24389 49.198 670.893127 2+ 2+ 1339.7711162109902 0 0.4358783964123977 100.0 Confident
|
|
|
1377 1376 P26639 VNTPTTTVYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17156 (Experiment 1) 17156 39.801 576.306396 2+ 2+ 1150.5982372294602 0 0.001593696998501894 91.08108108108108 Confident
|
|
|
1378 1377 P54819 NLETPLCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22347 (Experiment 1) 22347 46.666 487.752655 2+ 2+ 973.4902670036101 0 0.5023683696197705 92.40837696335078 Confident
|
|
|
1379 1378 P62249 GGGHVAQIYAIR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22223 (Experiment 1) 22223 46.51 661.324158 2+ 2+ 1320.6339847227102 0 -0.1675852110747807 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
1380 1379 Q13263 DHQYQFLEDAVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37337 (Experiment 1) 37337 64.327 534.23053 3+ 3+ 1599.6718863530605 0 -1.3263629072237368 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1381 1380 P16070 YGFIEGHVVIPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36069 (Experiment 1) 36069 62.802 462.922302 3+ 3+ 1385.7455701694903 0 -0.3554014346631157 100.0 Confident
|
|
|
1382 1381 P31939 HVSPAGAAVGIPLSEDEAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28233 (Experiment 1) 28233 53.685 616.654297 3+ 3+ 1846.9424916223804 0 -0.7730002141970149 100.0 Confident
|
|
|
1383 1382 P49354 NYHAWQHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7922 (Experiment 1) 7922 24.279 596.247253 2+ 2+ 1190.4770901584902 0 2.4007781540547266 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1384 1383 P22626 GGNFGFGDSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25639 (Experiment 1) 25639 50.659 507.225037 2+ 2+ 1012.4362572847999 0 -0.7257310225902115 100.0 Confident
|
|
|
1385 1384 P07900 NPDDITNEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35852 (Experiment 1) 35852 62.527 957.377869 2+ 2+ 1912.7404194053506 0 0.399874154322035 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 5.979331440136033) Phosphorylation of Y (10: 0.16155088852988692) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
1386 1385 B0I1T2 LLYNSTDPTLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29955 (Experiment 1) 29955 55.677 646.849609 2+ 2+ 1291.6772158261504 0 5.758126012203421 99.45799457994579 Doubtful
|
|
|
1387 1386 P49327 FDASFFGVHPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39019 (Experiment 1) 39019 66.381 417.877014 3+ 3+ 1250.6084079903403 0 0.6418234018477539 96.99248120300751 Confident
|
|
|
1388 1387 P11142 MVNHFIAEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32549 (Experiment 1) 32549 58.687 618.316589 2+ 2+ 1234.6168644990605 0 1.4236799183395221 96.24664879356568 Confident
|
|
|
1389 1388 P40939 FGELVMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30877 (Experiment 1) 30877 56.74 462.746429 2+ 2+ 923.4786396907502 0 -0.36156330146040067 99.45652173913044 Confident
|
|
|
1390 1389 P61247 LIPDSIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23326 (Experiment 1) 23326 47.844 421.752838 2+ 2+ 841.4909186266102 0 0.2423692231519605 99.21875 Confident
|
|
|
1391 1390 A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65 EDAANNYAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8455 (Experiment 1) 8455 25.473 512.229736 2+ 2+ 1022.4417365880602 0 3.106504736680156 100.0 Confident
|
|
|
1392 1391 P31153 FVIGGPQGDAGLTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34616 (Experiment 1) 34616 61.076 722.880798 2+ 2+ 1443.7470267214699 0 0.011305395214362248 100.0 Confident
|
|
|
1393 1392 Q9Y277 SCSGVEFSTSGHAYTDTGK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20437 (Experiment 1) 20437 44.059 664.291077 3+ 3+ 1989.8374345004906 0 7.008572720699928 100.0 Doubtful
|
|
|
1394 1393 Q07020 TNSTFNQVVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28856 (Experiment 1) 28856 54.412 625.840637 2+ 2+ 1249.6666511424503 0 0.05586400544002634 99.45652173913044 Confident
|
|
|
1395 1394 P20700 IESLSSQLSNLQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36471 (Experiment 1) 36471 63.298 723.892395 2+ 2+ 1445.7725727629702 0 -1.6132873078813668 97.86096256684492 Confident
|
|
|
1396 1395 P18754 VPELFANR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32114 (Experiment 1) 32114 58.187 473.262207 2+ 2+ 944.5079656730802 0 2.002480932671219 99.72826086956522 Confident
|
|
|
1397 1396 P08238, Q58FF7 RAPFDLFENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39185 (Experiment 1) 39185 66.597 412.884064 3+ 3+ 1235.6298717109105 0 0.3963088680593794 100.0 Confident
|
|
|
1398 1397 O75964 TPALVNAAVTYSKPR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28754 (Experiment 1) 28754 54.294 834.430115 2+ 2+ 1666.8443714117707 0 0.7823636774377868 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
1399 1398 Q02790 LYANMFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35366 (Experiment 1) 35366 61.946 522.253784 2+ 2+ 1042.4906013567802 0 2.3108642267039308 99.73890339425587 Confident
|
|
|
1400 1399 P33991 THIDVIHYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17938 (Experiment 1) 17938 40.863 385.208832 3+ 3+ 1152.6039913162401 0 0.5843442675289472 100.0 Confident
|
|
|
1401 1400 P54819 AVLLGPPGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25459 (Experiment 1) 25459 50.447 490.301239 2+ 2+ 978.5862159937801 0 1.742883189715914 99.45652173913044 Confident
|
|
|
1402 1401 P78527 LYSLALHPNAFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35193 (Experiment 1) 35193 61.743 458.591675 3+ 3+ 1372.7503211967605 0 2.0893014895009387 99.37888198757764 Confident
|
|
|
1403 1402 P04080 SQVVAGTNYFIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34340 (Experiment 1) 34340 60.757 663.85614 2+ 2+ 1325.6979512707303 0 -0.16886513742331105 100.0 Confident
|
|
|
1404 1403 P40939 DATLTALDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26995 (Experiment 1) 26995 52.22 488.258942 2+ 2+ 974.5032742154601 0 0.05821800110428726 91.37466307277629 Confident
|
|
|
1405 1404 P10809 VTDALNATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13394 (Experiment 1) 13394 34.312 480.759308 2+ 2+ 959.5036085686302 0 0.4726876350972865 100.0 Confident
|
|
|
1406 1405 P11940, Q13310 SLGYAYVNFQQPADAER Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40760 (Experiment 1) 40760 68.835 670.298706 3+ 3+ 2007.8727709875805 0 0.7546949418760559 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 6: 0.0) Phosphorylation of Y (4: 0.0) 0 Y4-{Y4 Y6} 1 99.43502824858757 Confident
|
|
|
1407 1406 Q9UKK9 TTYMDPTGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14767 (Experiment 1) 14767 36.442 547.217163 2+ 2+ 1092.41987766247 0 -0.09557090972006006 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1408 1407 P31146 HVFGQPAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7887 (Experiment 1) 7887 24.211 442.242554 2+ 2+ 882.4711862415402 0 -0.7136069426276906 96.48648648648648 Confident
|
|
|
1409 1408 Q9BQ04, Q9BWF3 NYGFVHIEDK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28250 (Experiment 1) 28250 53.705 651.279846 2+ 2+ 1300.5489176860704 0 -2.9009102279371857 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1410 1409 P22314 DNPGVVTCLDEAR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30313 (Experiment 1) 30313 56.092 723.337158 2+ 2+ 1444.6616424150002 0 -1.2990803541839593 100.0 Confident
|
|
|
1411 1410 P55060 LLQAFLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40281 (Experiment 1) 40281 68.147 495.294128 2+ 2+ 988.5705659296402 0 3.166953224028635 97.289972899729 Confident
|
|
|
1412 1411 Q8TEQ6 DGHYAVAAK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6601 (Experiment 1) 6601 21.285 506.217896 3+ 2+ 1010.4222606209705 0 -1.0090057777118406 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.38449111470113) Y4 1 0 98.91304347826086 Confident
|
|
|
1413 1412 P46777 DIICQIAYAR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39842 (Experiment 1) 39842 67.512 611.81604 2+ 2+ 1221.6175927750503 0 -0.053699696094360934 100.0 Confident
|
|
|
1414 1413 Q15397 EAVVYLAHTHDGAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18011 (Experiment 1) 18011 40.986 540.250854 3+ 3+ 1617.7300699355203 0 0.40886211153068275 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1415 1414 P61353 VYNYNHLMPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25897 (Experiment 1) 25897 50.953 469.899475 3+ 3+ 1406.6765046335 0 0.06452874482610198 100.0 Confident
|
|
|
1416 1415 Q96L92 NSTTDQVYQAIAAK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31207 (Experiment 1) 31207 57.13 795.364075 2+ 2+ 1588.7134168118705 0 0.11331573260497184 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
1417 1416 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23368 (Experiment 1) 23368 47.898 420.23468 3+ 3+ 1257.68296991293 0 -0.6022927543636957 92.3076923076923 Doubtful
|
|
|
1418 1417 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33300 (Experiment 1) 33300 59.539 616.269226 2+ 2+ 1230.5209716027305 0 2.375155593582758 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 22.587430602603124) Phosphorylation of Y (8: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1419 1418 P26640 LHEEGIIYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20623 (Experiment 1) 20623 44.27 605.285156 2+ 2+ 1208.55908844695 0 -2.750250344365587 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 96.50959860383944) Y8 1 0 99.48849104859335 Confident
|
|
|
1420 1419 Q12931 NIYYLCAPNR Phosphorylation of Y(3) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35125 (Experiment 1) 35125 61.665 682.296997 2+ 2+ 1362.5791722685303 0 0.19698012721888802 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.9693053311793215) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
1421 1420 P49327 VVEVLAGHGHLYSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20831 (Experiment 1) 20831 44.511 512.947083 3+ 3+ 1535.8208603680703 0 -0.9362675703584109 100.0 Confident
|
|
|
1422 1421 P47756 SGSGTMNLGGSLTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26709 (Experiment 1) 26709 51.887 669.327209 2+ 2+ 1336.6405130476 0 -0.48405391395176955 100.0 Confident
|
|
|
1423 1422 P09651, P22626, P51991, Q32P51 LTDCVVMR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21647 (Experiment 1) 21647 45.725 497.246796 2+ 2+ 992.4783224209202 0 0.7206139668321604 100.0 Confident
|
|
|
1424 1423 Q969H8 GAEIEYAMAYSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37259 (Experiment 1) 37259 64.234 706.793335 2+ 2+ 1411.5730838285804 0 -0.6839068052494266 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 5.038813678679345) Phosphorylation of Y (6: 29.37503257074366) 0 Y6-{Y6 Y10} 1 96.2059620596206 Confident
|
|
|
1425 1424 P17096 KQPPVSPGTALVGSQKEPSEVPTPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22858 (Experiment 1) 22858 47.275 640.350464 4+ 4+ 2557.375167096881 0 -0.9436090018026219 70.0 Doubtful
|
|
|
1426 1425 P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3 DVNAAIATIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30746 (Experiment 1) 30746 56.588 508.29248 2+ 2+ 1014.5709598524604 0 -0.5437674227700746 100.0 Confident
|
|
|
1427 1426 Q15029 IAVEPVNPSELPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34101 (Experiment 1) 34101 60.475 696.890564 2+ 2+ 1391.7660308305503 0 0.3904745351887932 96.19565217391303 Confident
|
|
|
1428 1427 O14745 SVDPDSPAEASGLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21305 (Experiment 1) 21305 45.159 700.836731 2+ 2+ 1399.6579369335502 0 0.6935520477406762 99.7289972899729 Confident
|
|
|
1429 1428 Q69YN4 SEYIEPAKR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10097 (Experiment 1) 10097 28.811 586.770386 2+ 2+ 1171.5274539655004 0 -1.0522836994531548 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 99.1869918699187 Confident
|
|
|
1430 1429 A4D263 AYEDVPWDKMLPPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10913 (Experiment 1) 10913 30.354 590.602844 3+ 3+ 1767.79430998486 1 -6.1904919727934065 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.60383944153578) Y2 1 0 96.71052631578947 Doubtful
|
|
|
1431 1430 P22234 SWLPQNCTLVDMK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42880 (Experiment 1) 42880 72.221 796.383789 2+ 2+ 1590.7534346248603 0 -0.257136310959076 95.28795811518324 Confident
|
|
|
1432 1431 P27797 HEQNIDCGGGYVK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12941 (Experiment 1) 12941 33.648 492.889801 3+ 3+ 1475.6463267040301 0 0.8432558235737236 100.0 Confident
|
|
|
1433 1432 Q02790 GEHSIVYLKPSYAFGSVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39184 (Experiment 1) 39184 66.595 707.014038 3+ 3+ 2118.0187069452804 0 0.7438114719652961 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 11.768653196251055) Phosphorylation of Y (7: 89.87783595113437) 0 Y7-{Y7 Y12} 1 96.71052631578947 Confident
|
|
|
1434 1433 P14324 LKEVLEYNAIGGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28666 (Experiment 1) 28666 54.188 505.260193 3+ 3+ 1512.7589104523101 0 -0.10611874251051674 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.28057553956835 Confident
|
|
|
1435 1434 Q7KZ85 DHYQDPVPGITPSSSSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25941 (Experiment 1) 25941 51.002 641.614929 3+ 3+ 1921.82073541472 0 1.154476155271719 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.30191972076788) Y3 1 0 98.7012987012987 Confident
|
|
|
1436 1435 P51991 SSGSPYGGGYGSGGGSGGYGSR Phosphorylation of Y(19) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20359 (Experiment 1) 20359 43.962 995.887085 2+ 2+ 1989.7490270264398 0 5.316916145347736 Phosphorylation of Y (19: Doubtfull) Phosphorylation of Y (19: 9.135067184765218) Phosphorylation of Y (6: 23.93014925737439) 0 Y19-{Y6 Y10 Y19} 1 100.0 Doubtful
|
|
|
1437 1436 P52565 IDKTDYMVGSYGPR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26391 (Experiment 1) 26391 51.524 561.247803 3+ 3+ 1680.7218733205902 0 -0.1744452115538039 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 7.797340754347356) Phosphorylation of Y (6: 100.0) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
1438 1437 P78527 ELLNPVVEFVSHPSTTCR Carbamidomethylation of C(17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45038 (Experiment 1) 45038 76.653 695.688049 3+ 3+ 2084.036074737391 0 2.991226146730922 99.37888198757764 Confident
|
|
|
1439 1438 P08238 KHLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24787 (Experiment 1) 24787 49.661 478.516937 4+ 4+ 1910.0373950667304 0 0.6515270085429654 100.0 Doubtful
|
|
|
1440 1439 Q8WX92 ELYSQLGEK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21566 (Experiment 1) 21566 45.581 573.75769 2+ 2+ 1145.5005705113203 0 0.22357444387061898 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 95.81151832460732) Y3 1 0 99.22077922077922 Confident
|
|
|
1441 1440 P14649, P60660 ILYSQCGDVMR Phosphorylation of Y(3) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26610 (Experiment 1) 26610 51.775 711.300598 2+ 2+ 1420.58802270007 0 -0.9697955829297841 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
1442 1441 O00116 EYVDPNNIFGNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41971 (Experiment 1) 41971 70.651 759.325012 2+ 2+ 1516.6347725683504 0 0.4599468842187935 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1443 1442 Q13625 KPQTVAASSIYSMYTQQQAPGK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32626 (Experiment 1) 32626 58.773 822.058044 3+ 3+ 2463.1505260438107 0 0.72036966476339 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 3.117461394557014) Phosphorylation of Y (11: 0.17452006980802792) 0 Y14-{Y11 Y14} 1 100.0 Confident
|
|
|
1444 1443 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13150 (Experiment 1) 13150 33.938 600.786926 2+ 2+ 1199.5587540937802 0 0.45354918628356355 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
1445 1444 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29926 (Experiment 1) 29926 55.642 528.261963 2+ 2+ 1054.5100129962104 0 -0.6056932845122232 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 99.46091644204851 Confident
|
|
|
1446 1445 Q16881 KVVYENAYGQFIGPHR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26130 (Experiment 1) 26130 51.225 653.31665 3+ 3+ 1956.9247469907903 0 1.7212758828343941 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 9.440360040453784) Phosphorylation of Y (8: 0.0) 0 Y8-{Y4 Y8} 1 100.0 Confident
|
|
|
1447 1446 Q9H4A4 KKPFVYTQGQAVLNR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23015 (Experiment 1) 23015 47.466 610.654663 3+ 3+ 1827.9396687789404 1 -0.47189259698452185 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
1448 1447 P19623 YQDILVFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42482 (Experiment 1) 42482 71.46 527.289673 2+ 2+ 1052.5654805492002 0 -0.6519019917930354 99.01477832512316 Confident
|
|
|
1449 1448 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44455 (Experiment 1) 44455 75.298 612.981079 3+ 3+ 1835.9222873793005 0 -0.47841569976887044 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
1450 1449 P61158, Q9P1U1 LSEELSGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14260 (Experiment 1) 14260 35.684 474.243042 2+ 2+ 946.4719740871801 0 -0.4670818102383712 100.0 Confident
|
|
|
1451 1450 Q92499 HYYEVSCHDQGLCR Phosphorylation of Y(2, 3) Carbamidomethylation of C(7, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16473 (Experiment 1) 16473 38.926 661.903198 3+ 3+ 1982.6841981734 0 1.7960494223813037 Phosphorylation of Y (2: Very Confident, 3: Very Confident) Phosphorylation of Y (2: 97.4151857835218, 3: 97.4151857835218) Y2, Y3 2 0 98.54014598540147 Confident
|
|
|
1452 1451 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44553 (Experiment 1) 44553 75.549 612.981995 3+ 3+ 1835.9222873793005 0 1.015920084994036 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
1453 1452 P40939 DGPGFYTTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23241 (Experiment 1) 23241 47.733 507.237793 2+ 2+ 1012.4614094034803 0 -0.3709669998532144 99.73474801061008 Confident
|
|
|
1454 1453 P32942 IALETSLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26204 (Experiment 1) 26204 51.309 481.281647 2+ 2+ 960.5491617787202 0 -0.4370748010091097 95.23809523809523 Confident
|
|
|
1455 1454 P30086 LYTLVLTDPDAPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42393 (Experiment 1) 42393 71.329 780.920654 2+ 2+ 1559.8195229553903 0 4.6305245206362295 100.0 Confident
|
|
|
1456 1455 O94903 ILSLCPEIK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36545 (Experiment 1) 36545 63.385 536.80481 2+ 2+ 1071.5998174525903 0 -4.424667129570309 99.73333333333333 Doubtful
|
|
|
1457 1456 P11021 VLEDSDLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17060 (Experiment 1) 17060 39.667 459.742401 2+ 2+ 917.4705771048502 0 -0.35676321834007646 99.72972972972973 Confident
|
|
|
1458 1457 Q13813 EELYQNLTR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25974 (Experiment 1) 25974 51.04 623.278809 2+ 2+ 1244.5438323056303 0 -0.6154860161272447 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
1459 1458 P00519 TNLFSALIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46533 (Experiment 1) 46533 79.619 503.800049 2+ 2+ 1005.5858816406103 0 -0.33403541985708374 99.50372208436724 Confident
|
|
|
1460 1459 A6NHR9 EAIYSGYIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30698 (Experiment 1) 30698 56.534 576.259705 2+ 2+ 1150.5059902449302 0 -0.9832176623333749 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 7: 0.0) Phosphorylation of Y (4: 98.42931937172776) 0 Y4-{Y4 Y7} 1 99.73544973544973 Confident
|
|
|
1461 1460 P0C0S8, P20671, Q16777, Q6FI13, Q96KK5, Q99878, Q9BTM1 NDEELNKLLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32577 (Experiment 1) 32577 58.718 424.89801 3+ 3+ 1271.67213044571 0 0.05503584086530519 98.7012987012987 Confident
|
|
|
1462 1461 P13639 QFAEMYVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29010 (Experiment 1) 29010 54.587 543.767822 2+ 2+ 1085.5215671318904 0 -0.43774685336221536 100.0 Confident
|
|
|
1463 1462 P37802 GPAYGLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16562 (Experiment 1) 16562 39.035 410.719391 2+ 2+ 819.4239016959502 0 0.3985331146217005 100.0 Confident
|
|
|
1464 1463 Q9Y277 LSQNNFALGYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30929 (Experiment 1) 30929 56.802 627.827576 2+ 2+ 1253.6404363946103 0 0.1295513233714144 100.0 Confident
|
|
|
1465 1464 P22626 NYYEQWGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26705 (Experiment 1) 26705 51.882 584.231873 2+ 2+ 1166.4433899883702 0 4.966441488723251 Phosphorylation of Y (3: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (3: 5.597456644577062) 0 Y3-{Y2 Y3} 1 92.43243243243244 Doubtful
|
|
|
1466 1465 Q13422 SGLIYLTNHIAPHAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35552 (Experiment 1) 35552 62.159 581.630249 3+ 3+ 1741.8665038386803 0 1.383332582321765 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1467 1466 Q9NWQ8 ENDYESISDLQQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30697 (Experiment 1) 30697 56.533 867.353638 2+ 2+ 1732.6941379192701 0 -0.8156141152958293 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
1468 1467 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17907 (Experiment 1) 17907 40.82 532.894531 3+ 3+ 1595.6617155921804 0 0.03002932255685624 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1469 1468 P12004 AEDNADTLALVFEAPNQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46040 (Experiment 1) 46040 78.811 1038.000366 2+ 2+ 2073.9854786331707 0 0.3373955657324388 98.91598915989161 Doubtful
|
|
|
1470 1469 P38159, Q96E39 DSYESYGNSR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12113 (Experiment 1) 12113 32.296 629.224731 2+ 2+ 1256.4346757794704 0 0.18537649371788345 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 8.577578916590632) Phosphorylation of Y (3: 77.46707916864986) 0 Y3-{Y3 Y6} 1 100.0 Confident
|
|
|
1471 1470 P23193 EMLAAALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29831 (Experiment 1) 29831 55.532 437.744171 2+ 2+ 873.4742230166501 0 -0.4956662905423541 98.6737400530504 Confident
|
|
|
1472 1471 P78527 MYAALGDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21615 (Experiment 1) 21615 45.671 523.224915 2+ 2+ 1044.4351338037902 0 0.13690346269680348 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.12277867528272) Y2 1 0 95.67567567567568 Confident
|
|
|
1473 1472 P50990 AVDDGVNTFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20782 (Experiment 1) 20782 44.451 533.264343 2+ 2+ 1064.5138388991604 0 0.2758175195293865 100.0 Confident
|
|
|
1474 1473 P04843 ALTSEIALLQSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41976 (Experiment 1) 41976 70.661 651.375244 2+ 2+ 1300.7350650554401 0 0.6678266672279474 100.0 Confident
|
|
|
1475 1474 P63000 HHCPNTPIILVGTK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20830 (Experiment 1) 20830 44.51 529.620422 3+ 3+ 1585.8398815604903 0 -0.28005012848655425 100.0 Confident
|
|
|
1476 1475 P63244 TNHIGHTGYLNTVTVSPDGSLCASGGK Carbamidomethylation of C(22) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28092 (Experiment 1) 28092 53.507 686.582764 4+ 4+ 2742.3031414387706 0 -0.43378073430493697 100.0 Doubtful
|
|
|
1477 1476 E9PAV3, Q13765 SPASDTYIVFGEAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40183 (Experiment 1) 40183 67.99 522.570313 3+ 3+ 1563.6858050817007 1 -0.032118268498523325 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.33507853403141) Y7 1 0 92.90780141843972 Doubtful
|
|
|
1478 1477 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34175 (Experiment 1) 34175 60.562 932.89563 2+ 2+ 1863.7750310922602 0 0.8982653403100836 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 47.636544895360416) 0 Y6-{Y6 Y11} 1 91.05691056910568 Confident
|
|
|
1479 1478 O75526, P38159, Q8N7X1, Q96E39 GFAFVTFESPADAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45514 (Experiment 1) 45514 77.692 743.865479 2+ 2+ 1485.7139952576904 0 1.6197905783954076 92.73182957393485 Confident
|
|
|
1480 1479 P35579 VIQYLAYVASSHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35883 (Experiment 1) 35883 62.565 493.604736 3+ 3+ 1477.7929142847306 0 -0.3617502924144102 100.0 Confident
|
|
|
1481 1480 P34932 EDIYAVEIVGGATR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42720 (Experiment 1) 42720 71.932 786.870544 2+ 2+ 1571.7232532195803 0 2.0853834626612477 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.68411867364746) Y4 1 0 96.53333333333333 Confident
|
|
|
1482 1481 P62277 DSHGVAQVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.36 min, Period: 1, Cycle(s): 6826 (Experiment 1) 6826 21.843 484.750244 2+ 2+ 967.4835418303903 0 2.4685308807756425 91.30434782608697 Confident
|
|
|
1483 1482 Q12765 VECTYISIDQVPR Phosphorylation of Y(5) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38449 (Experiment 1) 38449 65.691 830.376587 2+ 2+ 1658.7375233847301 0 0.6609545526469471 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1484 1483 P49915 ELGLPEELVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42088 (Experiment 1) 42088 70.854 621.341431 2+ 2+ 1240.6663167892802 0 1.6032089525451227 99.45652173913044 Confident
|
|
|
1485 1484 P78527 LQETLSAADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17587 (Experiment 1) 17587 40.406 552.289307 2+ 2+ 1102.5618517207402 0 2.0001745704599405 99.72972972972973 Confident
|
|
|
1486 1485 P31153 YLDEDTIYHLQPSGR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34916 (Experiment 1) 34916 61.424 629.615173 3+ 3+ 1885.8247581660003 0 -0.565724311913292 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 11.523774852758244) Phosphorylation of Y (8: 0.6980802792321117) 0 Y8-{Y1 Y8} 1 100.0 Confident
|
|
|
1487 1486 Q99798 SQFTITPGSEQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30823 (Experiment 1) 30823 56.678 732.379456 2+ 2+ 1462.7416069878602 0 1.8788646130620865 99.45799457994579 Confident
|
|
|
1488 1487 O00571, O15523 SPILVATAVAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34100 (Experiment 1) 34100 60.474 584.857544 2+ 2+ 1167.6975573479103 0 2.5456849076549486 99.73190348525469 Confident
|
|
|
1489 1488 P62917 ASGNYATVISHNPETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19053 (Experiment 1) 19053 42.355 563.613953 3+ 3+ 1687.8165628332702 0 2.0503238569563944 99.24812030075188 Confident
|
|
|
1490 1489 P22090, P62701, Q8TD47 GIPHLVTHDAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14365 (Experiment 1) 14365 35.84 405.890808 3+ 3+ 1214.65200413782 0 -1.157566350918755 100.0 Confident
|
|
|
1491 1490 Q9Y490 VLVQNAAGSQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11379 (Experiment 1) 11379 31.143 622.336853 2+ 2+ 1242.6568147347405 0 1.8786739184085082 99.72826086956522 Confident
|
|
|
1492 1491 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 QVHPDTGISSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7949 (Experiment 1) 7949 24.341 584.802063 2+ 2+ 1167.5884008217504 0 1.0022586055025593 99.73474801061008 Confident
|
|
|
1493 1492 P13796 IGNFSTDIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26569 (Experiment 1) 26569 51.727 497.764923 2+ 2+ 993.5131106231702 0 2.1922476750946145 99.75247524752476 Confident
|
|
|
1494 1493 P52272 MGPAMGPALGAGIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35122 (Experiment 1) 35122 61.662 714.361511 2+ 2+ 1426.70609050962 0 1.6648158383134755 99.7289972899729 Confident
|
|
|
1495 1494 Q07955 TKDIEDVFYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32974 (Experiment 1) 32974 59.167 669.30365 2+ 2+ 1336.5951991721504 0 -1.8318302035223684 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
1496 1495 P10809 GANPVEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16044 (Experiment 1) 16044 38.4 428.237976 2+ 2+ 854.4610154806601 0 0.4478653334135036 100.0 Confident
|
|
|
1497 1496 P00558, P07205 VDFNVPMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32452 (Experiment 1) 32452 58.575 475.244659 2+ 2+ 948.4738886634802 0 0.922055290221956 100.0 Confident
|
|
|
1498 1497 P16949 SKESVPEFPLSPPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32355 (Experiment 1) 32355 58.461 514.611389 3+ 3+ 1540.8137092989602 0 -0.8885009844941986 100.0 Confident
|
|
|
1499 1498 P50991 TDMDNQIVVSDYAQMDR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36393 (Experiment 1) 36393 63.21 1040.9198 2+ 2+ 2079.8278715941 0 -1.3567442430629986 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 89.87783595113437) Y12 1 0 91.08108108108108 Doubtful
|
|
|
1500 1499 Q9Y2W1 SPLQSVVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25850 (Experiment 1) 25850 50.9 492.795471 2+ 2+ 983.5763795860703 0 0.00961890528999626 94.03794037940379 Confident
|
|
|
1501 1500 P62805 KTVTAMDVVYALK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45694 (Experiment 1) 45694 78.092 506.925934 3+ 3+ 1517.7564679241605 0 -0.32570467195275027 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.83844911147011) Y10 1 0 100.0 Confident
|
|
|
1502 1501 P22626 GGSDGYGSGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4409 (Experiment 1) 4409 17.032 496.677704 2+ 2+ 991.3396531958201 0 1.2099113775910937 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 99.7289972899729 Confident
|
|
|
1503 1502 P15531, P22392 TFIAIKPDGVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25977 (Experiment 1) 25977 51.044 448.925995 3+ 3+ 1343.7561348531901 0 0.015404450049045705 100.0 Confident
|
|
|
1504 1503 P09429 KHPDASVNFSEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23577 (Experiment 1) 23577 48.162 531.594055 3+ 3+ 1591.7630707084304 0 -1.715033084552714 100.0 Confident
|
|
|
1505 1504 O14602, P47813 ELVFKEDGQEYAQVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35729 (Experiment 1) 35729 62.379 632.664673 3+ 3+ 1894.9676437410606 0 2.395091525874514 96.71052631578947 Confident
|
|
|
1506 1505 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23573 (Experiment 1) 23573 48.156 420.235016 3+ 3+ 1257.68296991293 0 0.19726000405482413 99.28057553956835 Confident
|
|
|
1507 1506 P52209 VDDFLANEAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29080 (Experiment 1) 29080 54.67 561.277405 2+ 2+ 1120.5400536470004 0 0.1812111182598556 100.0 Confident
|
|
|
1508 1507 P07237 KSNFAEALAAHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17689 (Experiment 1) 17689 40.543 429.565979 3+ 3+ 1285.6778845324905 0 -1.378857236556458 99.27007299270073 Confident
|
|
|
1509 1508 Q02790 RGEAHLAVNDFELAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29401 (Experiment 1) 29401 55.037 566.625977 3+ 3+ 1696.8645160852006 0 -4.950028370423403 100.0 Doubtful
|
|
|
1510 1509 P54886 GPVGLEGLLTTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43968 (Experiment 1) 43968 74.08 592.848816 2+ 2+ 1183.6812385774301 0 1.5522438040365178 99.45799457994579 Confident
|
|
|
1511 1510 P26599 DYGNSPLHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12895 (Experiment 1) 12895 33.59 569.737976 2+ 2+ 1137.4604370348402 0 0.8442761307914571 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1512 1511 P07900, P08238 SLTNDWEDHLAVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35454 (Experiment 1) 35454 62.047 764.375549 2+ 2+ 1526.7365216074204 0 0.015345176727452548 100.0 Confident
|
|
|
1513 1512 P02786 VEYHFLSPYVSPK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36541 (Experiment 1) 36541 63.379 823.387207 2+ 2+ 1644.7589104523104 0 0.5772585523116317 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 30.274027793080897) Phosphorylation of Y (3: 99.19224555735056) 0 Y3-{Y3 Y9} 1 99.73190348525469 Confident
|
|
|
1514 1513 P14618 GDYPLEAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28667 (Experiment 1) 28667 54.189 510.262726 2+ 2+ 1018.5083595959002 0 2.4884012349967906 99.45799457994579 Confident
|
|
|
1515 1514 P27797 EQFLDGDGWTSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38326 (Experiment 1) 38326 65.542 705.817505 2+ 2+ 1409.6211575020102 0 -0.49618724518893886 100.0 Confident
|
|
|
1516 1515 Q14203 ASEQIYGTPSSSPYECLR Phosphorylation of Y(6) Carbamidomethylation of C(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33803 (Experiment 1) 33803 60.116 1062.95166 2+ 2+ 2123.88710072238 0 0.7838292955371375 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 14: 0.0) Phosphorylation of Y (6: 86.03839441535777) 0 Y6-{Y6 Y14} 1 95.67567567567568 Confident
|
|
|
1517 1516 P00505 IGASFLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29687 (Experiment 1) 29687 55.366 446.256226 2+ 2+ 890.4974009893801 0 0.5580619887570237 99.72972972972973 Confident
|
|
|
1518 1517 O14979 DLTEYLSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39093 (Experiment 1) 39093 66.478 538.736511 2+ 2+ 1075.4587056993403 0 -0.21961841059129308 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 90.92495636998254) Y5 1 0 98.68421052631578 Confident
|
|
|
1519 1518 P49327 HGLYLPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20352 (Experiment 1) 20352 43.955 478.770081 2+ 2+ 955.5239500903901 0 1.732542326713627 99.1891891891892 Confident
|
|
|
1520 1519 O15371 GAVIATELK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22587 (Experiment 1) 22587 46.957 451.273956 2+ 2+ 900.5280324113203 0 5.90183238141681 99.46524064171123 Doubtful
|
|
|
1521 1520 Q9BV40 NKTEDLEATSEHFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17583 (Experiment 1) 17583 40.398 550.265442 3+ 3+ 1647.7740293149507 0 0.28306626225834164 100.0 Confident
|
|
|
1522 1521 O14979 KDLTEYLSR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30017 (Experiment 1) 30017 55.75 602.78418 2+ 2+ 1203.5536687133401 0 0.11476168102693672 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
1523 1522 P26038 ESEAVEWQQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19969 (Experiment 1) 19969 43.509 617.290283 2+ 2+ 1232.5673310240004 0 -1.0675335849139351 96.52406417112299 Confident
|
|
|
1524 1523 P00505 DAGMQLQGYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25378 (Experiment 1) 25378 50.347 569.768982 2+ 2+ 1137.52369239021 0 -0.24687528939214906 100.0 Confident
|
|
|
1525 1524 Q4VC31 QLYESLMAAHASR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28335 (Experiment 1) 28335 53.8 519.569031 3+ 3+ 1555.6854282422205 0 -0.10562769608790554 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1526 1525 P60660 EAFQLFDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41395 (Experiment 1) 41395 69.754 513.255005 2+ 2+ 1024.4977949122 0 -2.277464883098618 99.45799457994579 Confident
|
|
|
1527 1526 P31948 TVDLKPDWGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26138 (Experiment 1) 26138 51.233 386.876892 3+ 3+ 1157.60807363717 0 0.6659852480854509 99.3006993006993 Confident
|
|
|
1528 1527 P22626 IDTIEIITDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40188 (Experiment 1) 40188 67.996 594.827332 2+ 2+ 1187.6397676882702 0 0.28863687507722796 100.0 Confident
|
|
|
1529 1528 P38159, Q96E39 DRDYSDHPSGGSYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8984 (Experiment 1) 8984 26.6 537.898132 3+ 3+ 1610.6709612287402 0 0.994842905170027 100.0 Confident
|
|
|
1530 1529 P00505 EFSIYMTK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39266 (Experiment 1) 39266 66.712 549.732422 2+ 2+ 1097.4504495147603 0 -0.1441140773026592 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.74358974358975 Confident
|
|
|
1531 1530 P29401 MPSLPSYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29688 (Experiment 1) 29688 55.367 461.738647 2+ 2+ 921.4629896266101 0 -0.2691567716133953 99.46666666666667 Confident
|
|
|
1532 1531 O60234, P60983 LVQTAELTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17903 (Experiment 1) 17903 40.815 501.795227 2+ 2+ 1001.5757108797302 0 0.18950626841142582 100.0 Confident
|
|
|
1533 1532 P62888 SLESINSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14179 (Experiment 1) 14179 35.571 453.238953 2+ 2+ 904.4614094034803 0 2.1441968419746975 92.56410256410257 Confident
|
|
|
1534 1533 P42677, Q71UM5 LTEGCSFR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15882 (Experiment 1) 15882 38.183 485.22702 2+ 2+ 968.43856578392 0 0.9493322637275873 99.45799457994579 Confident
|
|
|
1535 1534 Q9Y490, Q9Y4G6 SIAAATSALVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28331 (Experiment 1) 28331 53.796 516.307739 2+ 2+ 1030.6022599807404 0 -1.2927490119652327 99.7289972899729 Confident
|
|
|
1536 1535 P62249 GPLQSVQVFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37894 (Experiment 1) 37894 65.005 594.330505 2+ 2+ 1186.6458561282202 0 0.505559158110906 100.0 Confident
|
|
|
1537 1536 P18669 HGESAWNLENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20789 (Experiment 1) 20789 44.461 656.805664 2+ 2+ 1311.59561146051 0 0.8858075989765657 99.73045822102425 Confident
|
|
|
1538 1537 Q9HCS7 RAAEIYGVTHTR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13327 (Experiment 1) 13327 34.202 485.237549 3+ 3+ 1452.68747684755 0 2.294930725269324 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 90.30694668820678) Y6 1 0 92.51700680272108 Doubtful
|
|
|
1539 1538 Q9Y285 VNLQMVYDSPLCR Phosphorylation of Y(7) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43670 (Experiment 1) 43670 73.547 837.87384 2+ 2+ 1673.73066418248 0 1.4697245563369068 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 100.0 Confident
|
|
|
1540 1539 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25374 (Experiment 1) 25374 50.341 757.295837 3+ 3+ 2268.8644082151895 0 0.5604965395222332 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 11.01847218721501) Phosphorylation of Y (22: 0.0) 0 Y6-{Y6 Y11 Y22} 1 100.0 Confident
|
|
|
1541 1540 P62851 AALQELLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37131 (Experiment 1) 37131 64.084 486.789703 2+ 2+ 971.5651461960301 0 -0.30108439438342266 100.0 Confident
|
|
|
1542 1541 P25788 AVENSSTAIGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20400 (Experiment 1) 20400 44.009 609.32605 2+ 2+ 1216.6411646706001 0 -2.968520290010915 100.0 Confident
|
|
|
1543 1542 Q9Y5B9 INFYCPGSALGR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38720 (Experiment 1) 38720 66.017 717.815491 2+ 2+ 1433.61628605324 0 0.09961692931653893 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 94.18416801292408) Y4 1 0 99.1869918699187 Confident
|
|
|
1544 1543 O75083 LYSILGTTLKDEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36710 (Experiment 1) 36710 63.58 513.286682 3+ 3+ 1536.8399240468004 0 -1.108831511895883 99.28057553956835 Confident
|
|
|
1545 1544 P07900, P08238, Q14568, Q58FF7, Q58FF8 YESLTDPSKLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22305 (Experiment 1) 22305 46.615 513.92334 3+ 3+ 1538.7464175847801 0 1.1499878709880171 100.0 Confident
|
|
|
1546 1545 P62805 TVTAMDVVYALKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46572 (Experiment 1) 46572 79.684 773.888977 2+ 2+ 1545.7626159337606 0 0.5072646314887383 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
1547 1546 P10599, THIO_HUMAN MIKPFFHSLSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28813 (Experiment 1) 28813 54.363 488.595184 3+ 3+ 1462.7642570087405 0 -0.3645887905526029 100.0 Confident
|
|
|
1548 1547 Q9UBQ7 GDVVNQDDLYQALASGK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41399 (Experiment 1) 41399 69.758 624.951477 3+ 3+ 1871.8302374692603 0 1.260968982822776 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 98.60383944153578) Y10 1 0 96.71052631578947 Confident
|
|
|
1549 1548 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38519 (Experiment 1) 38519 65.775 621.324463 3+ 3+ 1860.9498991094704 0 0.8908343770614258 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
1550 1549 Q9Y399 DCGEYAHTR Phosphorylation of Y(5) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5633 (Experiment 1) 5633 19.32 594.710754 2+ 2+ 1187.4066872098203 0 0.22519906856406363 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1551 1550 P30101 GFPTIYFSPANK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45742 (Experiment 1) 45742 78.189 711.329041 2+ 2+ 1420.6428180709106 0 0.4997657761176783 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1552 1551 P23921 HPDYAILAAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22157 (Experiment 1) 22157 46.43 603.787781 2+ 2+ 1205.5594228001203 0 1.3135975827965778 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.90575916230367) Y4 1 0 97.8891820580475 Confident
|
|
|
1553 1552 P22626 GGNFGFGDSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25420 (Experiment 1) 25420 50.399 507.226379 2+ 2+ 1012.4362572847999 0 1.9200355074467286 100.0 Confident
|
|
|
1554 1553 Q9NY33 VILGSEAAQQHPEEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19389 (Experiment 1) 19389 42.77 588.64209 3+ 3+ 1761.9009611635706 1 0.0705969656188442 100.0 Confident
|
|
|
1555 1554 P49327 GYAVLGGER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21563 (Experiment 1) 21563 45.576 501.226074 2+ 2+ 1000.43791068511 0 -0.3148465841142629 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 99.73190348525469 Confident
|
|
|
1556 1555 P78527 TYSVVPMTSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26800 (Experiment 1) 26800 51.993 610.771301 2+ 2+ 1219.5308250937803 0 -2.272553647546269 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
1557 1556 O43707, P12814, Q08043 ALDFIASK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32023 (Experiment 1) 32023 58.084 432.74588 2+ 2+ 863.4752685624703 0 2.239776664746361 96.53333333333333 Confident
|
|
|
1558 1557 P49588 AVFDETYPDPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35457 (Experiment 1) 35457 62.05 704.843994 2+ 2+ 1407.6670450652703 0 4.5329392925126015 100.0 Confident
|
|
|
1559 1558 P27824 TPYTIMFGPDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41443 (Experiment 1) 41443 69.816 635.313232 2+ 2+ 1268.6111104122801 0 0.6301258653531615 100.0 Confident
|
|
|
1560 1559 P22695 VTSEELHYFVQNHFTSAR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41472 (Experiment 1) 41472 69.858 749.00769 3+ 3+ 2244.000096759021 0 0.5090473438732034 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
1561 1560 P30101 GFPTIYFSPANK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45845 (Experiment 1) 45845 78.441 711.328552 2+ 2+ 1420.6428180709106 0 -0.1876801402109557 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 95.6369982547993) Y6 1 0 95.25065963060686 Confident
|
|
|
1562 1561 P46778 VYNVTQHAVGIVVNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30418 (Experiment 1) 30418 56.213 574.298218 3+ 3+ 1719.8709205127805 0 1.10516849269539 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1563 1562 Q5JS13 YLKSVRYIEELQKFVEDDNYK Phosphorylation of Y(1, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17303 (Experiment 1) 17303 40.018 947.430054 3+ 3+ 2838.2918437210706 1 -9.455471094548855 Phosphorylation of Y (1: Confident, 7: Confident) Phosphorylation of Y (1: 98.25479930191972, 7: 98.25479930191972) Y1, Y7 2 0 94.02985074626866 Doubtful
|
|
|
1564 1563 O75083 LYSILGTTLKDEGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39163 (Experiment 1) 39163 66.565 539.943176 3+ 3+ 1616.8062545675505 0 0.891472390003619 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 97.74436090225565 Confident
|
|
|
1565 1564 P05388, Q8NHW5 AGAIAPCEVTVPAQNTGLGPEK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32774 (Experiment 1) 32774 58.943 727.372253 3+ 3+ 2179.0943178895004 0 0.28032882851509827 100.0 Confident
|
|
|
1566 1565 P05198 AGLNCSTENMPIK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24716 (Experiment 1) 24716 49.579 717.840637 2+ 2+ 1433.6642852672903 0 1.6966183666905172 91.44385026737967 Confident
|
|
|
1567 1566 Q9UBB6 LQAGEETASHYR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10920 (Experiment 1) 10920 30.363 481.207916 3+ 3+ 1440.6034724400704 0 -1.0763461296423626 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.82547993019197) Y11 1 0 100.0 Confident
|
|
|
1568 1567 P06733 LMIEMDGTENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30802 (Experiment 1) 30802 56.654 640.796204 2+ 2+ 1279.5788243078302 0 -0.7562784512039056 99.46091644204851 Confident
|
|
|
1569 1568 A8MUU1, Q01469 TQTVCNFTDGALVQHQEWDGK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36179 (Experiment 1) 36179 62.954 812.041626 3+ 3+ 2433.1019224510806 0 0.462270638801307 100.0 Confident
|
|
|
1570 1569 P47756 KLEVEANNAFDQYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28878 (Experiment 1) 28878 54.438 566.281982 3+ 3+ 1695.8216482137104 0 1.452980151573615 100.0 Confident
|
|
|
1571 1570 Q9UGN4 EELHYASVVFDSNTNR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35830 (Experiment 1) 35830 62.5 654.287109 3+ 3+ 1959.8363854788604 0 1.5855045871877995 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.60383944153578) Y5 1 0 99.28057553956835 Confident
|
|
|
1572 1571 P50914 VAYVSFGPHAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24129 (Experiment 1) 24129 48.874 438.207611 3+ 3+ 1311.6012876121004 0 -0.21604103309227293 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1573 1572 P62158 VFDKDGNGYISAAELR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32538 (Experiment 1) 32538 58.675 612.612976 3+ 3+ 1833.8298435464403 1 -8.764880100704294 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 99.28057553956835 Doubtful
|
|
|
1574 1573 Q10471 NFYYAAVPSAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35132 (Experiment 1) 35132 61.673 669.796875 2+ 2+ 1337.5805521675204 0 -1.0115751687909962 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.34904013961605584) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
1575 1574 O00148, Q13838 GSYVSIHSSGFR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22489 (Experiment 1) 22489 46.841 688.800903 2+ 2+ 1375.5921794803803 0 -3.5760670216276553 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.70759289176091) Y3 1 0 99.72826086956522 Confident
|
|
|
1576 1575 P62158 VFDKDGNGYISAAELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32026 (Experiment 1) 32026 58.087 585.629883 3+ 3+ 1753.8635130256903 0 2.4512549393978302 100.0 Confident
|
|
|
1577 1576 P37802 TLMNLGGLAVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42714 (Experiment 1) 42714 71.924 608.346985 2+ 2+ 1214.6805273847801 0 -0.9125691573877822 100.0 Confident
|
|
|
1578 1577 P14174 PMFIVNTNVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38561 (Experiment 1) 38561 65.823 644.348389 2+ 2+ 1286.6805273847801 0 1.317364845759778 100.0 Confident
|
|
|
1579 1578 Q04917 AVTELNEPLSNEDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26243 (Experiment 1) 26243 51.355 794.390015 2+ 2+ 1585.7583792508103 1 2.3573759757901653 97.84366576819407 Confident
|
|
|
1580 1579 P15880 ATFDAISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20486 (Experiment 1) 20486 44.113 426.726013 2+ 2+ 851.4388830537503 0 -1.652096429256651 100.0 Confident
|
|
|
1581 1580 P78527 QITQSALLAEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31030 (Experiment 1) 31030 56.921 650.864624 2+ 2+ 1299.7146639640303 0 0.023893099500146578 100.0 Confident
|
|
|
1582 1581 Q9H4A4 KKPFVYTQGQAVLNR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22910 (Experiment 1) 22910 47.335 610.319702 3+ 3+ 1827.9396687789404 0 -1.3065153903135893 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82578397212544) Y6 1 0 99.24812030075188 Confident
|
|
|
1583 1582 P31146 VSQTTWDSGFCAVNPK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36509 (Experiment 1) 36509 63.344 898.914185 2+ 2+ 1795.8199339615503 0 -3.4023683598728125 100.0 Confident
|
|
|
1584 1583 Q99832 TATQLAVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11417 (Experiment 1) 11417 31.197 473.271332 2+ 2+ 944.5290950404803 0 -1.0395443532067166 100.0 Confident
|
|
|
1585 1584 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39325 (Experiment 1) 39325 66.8 621.323303 3+ 3+ 1860.9498991094704 0 -0.9761467293866825 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
1586 1585 P22234 TKEVYELLDSPGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32012 (Experiment 1) 32012 58.072 520.250793 3+ 3+ 1557.73275527412 0 -1.4132103647242442 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.51534733441034) Y5 1 0 100.0 Confident
|
|
|
1587 1586 P50402 DSAYQSITHYRPVSASR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24614 (Experiment 1) 24614 49.459 505.232635 4+ 4+ 2016.9054680981903 0 -1.9960890819060084 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 4.888743976284718) Phosphorylation of Y (4: 99.82547993019197) 0 Y4-{Y4 Y10} 1 100.0 Doubtful
|
|
|
1588 1587 Q15717 SLFSSIGEVESAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42633 (Experiment 1) 42633 71.766 677.350708 2+ 2+ 1352.6823607762406 0 3.3234667399339655 99.73118279569893 Confident
|
|
|
1589 1588 Q08211 VFDPVPVGVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35213 (Experiment 1) 35213 61.768 579.331299 2+ 2+ 1156.6492101731603 0 -1.0055607344266968 99.19354838709677 Confident
|
|
|
1590 1589 P15104 DIVEAHYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14823 (Experiment 1) 14823 36.521 541.736633 2+ 2+ 1081.4593744056801 0 -0.610387834564132 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1591 1590 P63244 YWLCAATGPSIK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39032 (Experiment 1) 39032 66.396 683.844116 2+ 2+ 1365.6751076511703 0 -1.0445240873053547 98.91598915989161 Confident
|
|
|
1592 1591 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 HQGVMVGMGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13133 (Experiment 1) 13133 33.915 391.195282 3+ 3+ 1170.56378338038 0 0.19872362225391138 100.0 Confident
|
|
|
1593 1592 Q00839 GYFEYIEENKYSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35344 (Experiment 1) 35344 61.921 566.597656 3+ 3+ 1696.7733010389602 0 -1.2721764860821525 100.0 Confident
|
|
|
1594 1593 P60709, P62736, P63261, P63267, P68032, P68133 EITALAPSTMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27674 (Experiment 1) 27674 53.024 581.312378 2+ 2+ 1160.6111104122804 0 -0.7804282437462948 100.0 Confident
|
|
|
1595 1594 Q07666 GDSKKDDEENYLDLFSHK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31792 (Experiment 1) 31792 57.821 555.742859 4+ 4+ 2218.9419727462105 0 0.16076976641430374 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.82547993019197) Y11 1 0 100.0 Doubtful
|
|
|
1596 1595 P16885 HYCAIADAK Phosphorylation of Y(2) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9622 (Experiment 1) 9622 27.895 564.730347 2+ 2+ 1127.4470954698202 0 -0.8450073940629989 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.54604200323102) Y2 1 0 98.93899204244032 Confident
|
|
|
1597 1596 P62249 GGGHVAQIYAIR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22425 (Experiment 1) 22425 46.759 441.218811 3+ 3+ 1320.6339847227102 0 0.4675511920551823 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.67689822294022) Y9 1 0 100.0 Confident
|
|
|
1598 1597 P11940, Q4VXU2, Q5JQF8, Q9H361 FSPAGPILSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41193 (Experiment 1) 41193 69.459 579.337158 2+ 2+ 1156.6604435632 0 -0.5873060402148889 99.73262032085562 Confident
|
|
|
1599 1598 P33316 ARPAEVGGMQLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18596 (Experiment 1) 18596 41.79 428.900269 3+ 3+ 1283.67683898667 0 1.6620930343134859 100.0 Confident
|
|
|
1600 1599 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28828 (Experiment 1) 28828 54.381 523.25293 2+ 2+ 1044.4892775516303 0 1.939328539898035 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 84.32956381260097) Y7 1 0 92.97297297297298 Confident
|
|
|
1601 1600 P23284 HYGPGWVSMANAGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29708 (Experiment 1) 29708 55.39 518.889893 3+ 3+ 1553.6486488106805 0 -0.5134105950317518 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1602 1601 P29401 HQPTAIIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9695 (Experiment 1) 9695 28.027 489.790314 2+ 2+ 977.5658149023702 0 0.2655871988156202 99.46091644204851 Confident
|
|
|
1603 1602 P61978 TDYNASVSVPDSSGPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23446 (Experiment 1) 23446 47.993 890.901123 2+ 2+ 1779.7911359310704 0 -1.9322335291947799 100.0 Confident
|
|
|
1604 1603 P62244 IVVNLTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27205 (Experiment 1) 27205 52.463 436.271454 2+ 2+ 870.5287011176601 0 -0.39660072145191183 100.0 Confident
|
|
|
1605 1604 Q07020 ILTFDQLALDSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45859 (Experiment 1) 45859 78.476 730.904663 2+ 2+ 1459.7922455783903 0 1.7290164392378824 100.0 Confident
|
|
|
1606 1605 P00558, P07205 VDFNVPMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32224 (Experiment 1) 32224 58.311 475.243835 2+ 2+ 948.4738886634802 0 -0.8117900969733699 99.45652173913044 Confident
|
|
|
1607 1606 Q96ST3 RLDDQESPVYAAQQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20965 (Experiment 1) 20965 44.676 619.282471 3+ 3+ 1854.8261551483306 0 -0.30764022211869285 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.83844911147011) Y10 1 0 100.0 Confident
|
|
|
1608 1607 Q00610 ENPYYDSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13845 (Experiment 1) 13845 35.011 562.208435 2+ 2+ 1122.40191909921 0 0.35393217342518984 Phosphorylation of Y (5: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.5235602094240838) 0 Y5-{Y4 Y5} 1 99.73190348525469 Confident
|
|
|
1609 1608 P06733 IGAEVYHNLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18204 (Experiment 1) 18204 41.272 612.294678 2+ 2+ 1222.5747385110903 0 0.05271586638321874 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1610 1609 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31410 (Experiment 1) 31410 57.365 630.798218 2+ 2+ 1259.5798834611805 0 1.5849825725812665 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1611 1610 P59044 KYFYKYFR Phosphorylation of Y(6, 4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36812 (Experiment 1) 36812 63.702 687.782898 2+ 2+ 1373.5610762004303 0 -7.148377629044672 Phosphorylation of Y (4: Doubtfull, 6: Confident) Phosphorylation of Y (4: 82.98429319371728, 6: 99.65095986038395) Y6 1 Y4-{Y4} 1 99.7289972899729 Doubtful
|
|
|
1612 1611 Q9GZT3 SINQPVAFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30104 (Experiment 1) 30104 55.851 565.818909 2+ 2+ 1129.6243924076505 0 -0.9962022598612122 100.0 Confident
|
|
|
1613 1612 P08238 YHTSQSGDEMTSLSEYVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34443 (Experiment 1) 34443 60.878 726.32074 3+ 3+ 2175.9378768177503 0 1.1536614496895656 100.0 Confident
|
|
|
1614 1613 P31150, P50395 LYSESLAR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18677 (Experiment 1) 18677 41.895 509.733948 2+ 2+ 1017.4532263960803 0 0.11444235726715772 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
1615 1614 P24752 NEQDAYAINSYTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26522 (Experiment 1) 26522 51.675 772.853638 2+ 2+ 1543.6902996909903 0 1.5678124976742596 99.46091644204851 Confident
|
|
|
1616 1615 Q14019 YDGSTIVPGEQGAEYQHFIQQCTDDVR Phosphorylation of Y(15) Carbamidomethylation of C(22) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38315 (Experiment 1) 38315 65.524 1065.123901 3+ 3+ 3192.3495727550207 0 0.09415010181039658 Phosphorylation of Y (15: Doubtfull) Phosphorylation of Y (15: 5.152885441528807) Phosphorylation of Y (15: 71.9022687609075) 0 Y15-{Y1 Y15} 1 100.0 Confident
|
|
|
1617 1616 P16401 NGLSLAALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34969 (Experiment 1) 34969 61.488 443.771545 2+ 2+ 885.5283667644903 0 0.19188016937553065 100.0 Confident
|
|
|
1618 1617 P50914 VAYVSFGPHAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24072 (Experiment 1) 24072 48.801 656.808411 2+ 2+ 1311.6012876121004 0 0.747139494795841 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1619 1618 B0I1T2 LISVEPRPEQPEPDFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29884 (Experiment 1) 29884 55.594 636.998535 3+ 3+ 1907.9741261038303 0 -0.18341444694538525 91.72932330827068 Doubtful
|
|
|
1620 1619 P55769 NVPYVFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36650 (Experiment 1) 36650 63.508 497.280182 2+ 2+ 992.5443511818003 0 1.4678714049259736 91.30434782608697 Confident
|
|
|
1621 1620 O00567 YPASTVQILGAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32855 (Experiment 1) 32855 59.032 689.380005 2+ 2+ 1375.7347307022703 1 5.350412003809549 99.21259842519686 Doubtful
|
|
|
1622 1621 P23193 DTYVSSFPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28497 (Experiment 1) 28497 53.99 576.242737 2+ 2+ 1150.4696047362102 0 1.1421676879494784 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
1623 1622 Q9BZK7 HQEPVYSVAFSPDGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29398 (Experiment 1) 29398 55.032 590.261108 3+ 3+ 1767.7617639866203 0 -0.15212872836862212 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1624 1623 P78527 MYAALGDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21968 (Experiment 1) 21968 46.188 523.225647 2+ 2+ 1044.4351338037902 0 1.535919601261615 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.70759289176091) Y2 1 0 99.21465968586386 Confident
|
|
|
1625 1624 P62314 NREPVQLETLSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32143 (Experiment 1) 32143 58.22 518.958862 3+ 3+ 1553.8525544191702 0 1.414488167132205 100.0 Confident
|
|
|
1626 1625 O43707, P12814 TINEVENQILTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35996 (Experiment 1) 35996 62.708 715.387024 2+ 2+ 1428.757257052 0 1.5642007761929917 99.73045822102425 Confident
|
|
|
1627 1626 O94868 EYAQGMQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7984 (Experiment 1) 7984 24.42 517.703918 2+ 2+ 1033.3939972678002 0 -0.6897774062976018 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 94.9389179755672) Y2 1 0 94.02173913043478 Confident
|
|
|
1628 1627 P31146 ADQCYEDVR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14280 (Experiment 1) 14280 35.71 578.239197 2+ 2+ 1154.4662370837402 0 -2.071817694744428 100.0 Confident
|
|
|
1629 1628 Q15365 IANPVEGSSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14362 (Experiment 1) 14362 35.835 543.780396 2+ 2+ 1085.54653600977 0 -0.273036059538574 99.73890339425587 Confident
|
|
|
1630 1629 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36432 (Experiment 1) 36432 63.255 643.259033 3+ 3+ 1926.7560694694905 0 -0.4144880749419135 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 14: 0.0) Phosphorylation of Y (10: 81.50087260034904) 0 Y10-{Y10 Y14} 1 98.7012987012987 Confident
|
|
|
1631 1630 P62937, PPIA_HUMAN VSFELFADK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44011 (Experiment 1) 44011 74.156 528.274658 2+ 2+ 1054.5335117145803 0 1.1843775380551278 99.72826086956522 Confident
|
|
|
1632 1631 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18941 (Experiment 1) 18941 42.222 636.765137 2+ 2+ 1271.5183458337801 0 -2.061012641961416 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.73333333333333 Confident
|
|
|
1633 1632 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33033 (Experiment 1) 33033 59.234 932.896912 2+ 2+ 1863.7750310922602 0 2.2724824664384866 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 7.2728660645085945) Phosphorylation of Y (6: 2.10016155088853) 0 Y11-{Y6 Y11} 1 100.0 Confident
|
|
|
1634 1633 O00116 EYVDPNNIFGNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41817 (Experiment 1) 41817 70.395 759.325867 2+ 2+ 1516.6347725683504 0 1.5859474501740323 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1635 1634 P07195 SADTLWDIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37713 (Experiment 1) 37713 64.79 588.798584 2+ 2+ 1175.5822528121503 0 0.30762161023622564 100.0 Confident
|
|
|
1636 1635 Q5JQS6 SETEYALLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31474 (Experiment 1) 31474 57.442 581.263977 2+ 2+ 1160.5114695481902 0 1.6614838276097794 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
1637 1636 P49411 DKPHVNVGTIGHVDHGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11952 (Experiment 1) 11952 32.03 453.239563 4+ 4+ 1808.9281789709205 0 0.5334719352898726 100.0 Doubtful
|
|
|
1638 1637 P26641 VLSAPPHFHFGQTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26075 (Experiment 1) 26075 51.16 569.96344 3+ 3+ 1706.8641221623802 0 2.5548120211632295 100.0 Confident
|
|
|
1639 1638 Q8NBQ5 EDIYSSAK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10110 (Experiment 1) 10110 28.834 496.702118 2+ 2+ 991.3899574331804 0 -0.27618840206207956 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.47643979057592) Y4 1 0 99.45652173913044 Confident
|
|
|
1640 1639 GSTP1_HUMAN, P09211 ASCLYGQLPK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27624 (Experiment 1) 27624 52.965 568.791931 2+ 2+ 1135.56957995347 0 -0.23812488805989512 100.0 Confident
|
|
|
1641 1640 P08708 IAGYVTHLMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25670 (Experiment 1) 25670 50.694 566.811279 2+ 2+ 1131.6110508426302 0 -2.6867567600743487 100.0 Confident
|
|
|
1642 1641 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33563 (Experiment 1) 33563 59.843 977.537354 2+ 2+ 1953.0571274518006 0 1.5485951772027358 99.7289972899729 Confident
|
|
|
1643 1642 Q9Y295 GQLPDYTSPVVLPYSR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43129 (Experiment 1) 43129 72.658 936.449524 2+ 2+ 1870.8866301465703 0 -1.1399855014825195 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 14: 0.0) Phosphorylation of Y (6: 99.82547993019197) 0 Y6-{Y6 Y14} 1 100.0 Confident
|
|
|
1644 1643 Q02543 SSGEIVYCGQVFEK Phosphorylation of Y(7) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35789 (Experiment 1) 35789 62.452 561.575806 3+ 3+ 1681.7058889032805 0 -0.17825059410873484 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1645 1644 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10382 (Experiment 1) 10382 29.352 607.758667 2+ 2+ 1213.5016331404804 0 0.9443937550895326 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1646 1645 Q15056 TVATPLNQVANPNSAIFGGARPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38273 (Experiment 1) 38273 65.466 784.425659 3+ 3+ 2350.250575720451 0 1.9427751342813293 100.0 Confident
|
|
|
1647 1646 Q96AE4 LLDQIVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28630 (Experiment 1) 28630 54.146 479.284637 2+ 2+ 956.5542471591605 0 0.49439040319121963 95.39295392953929 Confident
|
|
|
1648 1647 P46778 VYNVTQHAVGIVVNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30443 (Experiment 1) 30443 56.241 860.944031 2+ 2+ 1719.8709205127805 0 1.5033250673789005 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 99.73753280839895 Confident
|
|
|
1649 1648 P60866 TPVEPEVAIHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19370 (Experiment 1) 19370 42.748 624.342163 2+ 2+ 1246.6669854956203 0 2.2324112832474525 98.93899204244032 Confident
|
|
|
1650 1649 P08238 KHLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24600 (Experiment 1) 24600 49.443 637.687622 3+ 3+ 1910.0373950667304 0 1.9035128589675827 100.0 Confident
|
|
|
1651 1650 P30101 GFPTIYFSPANKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40585 (Experiment 1) 40585 68.592 517.253845 3+ 3+ 1548.7377810849107 0 1.2402144250083782 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1652 1651 P23246 FAQHGTFEYEYSQR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24216 (Experiment 1) 24216 48.986 614.920959 3+ 3+ 1841.7410285420403 0 0.010330609063517517 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 8.110867614846923) Phosphorylation of Y (11: 99.30191972076788) 0 Y11-{Y9 Y11} 1 98.7012987012987 Confident
|
|
|
1653 1652 P62241 QWYESHYALPLGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39519 (Experiment 1) 39519 67.067 567.260071 3+ 3+ 1698.7555564073702 0 1.661317289406227 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 4.763690703687442) Phosphorylation of Y (7: 0.17452006980802792) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
1654 1653 P49736 ESLVVNYEDLAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40899 (Experiment 1) 40899 69.026 740.376038 2+ 2+ 1477.7412726346902 1 -4.80106649466548 99.48051948051948 Doubtful
|
|
|
1655 1654 P11310 NTYYASIAK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20465 (Experiment 1) 20465 44.09 555.749207 2+ 2+ 1109.4794411439204 0 3.9765599084455157 Phosphorylation of Y (4: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (4: 1.222860908724783) 0 Y4-{Y3 Y4} 1 100.0 Confident
|
|
|
1656 1655 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31637 (Experiment 1) 31637 57.638 630.796631 2+ 2+ 1259.5798834611805 0 -0.9308814074586899 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1657 1656 P68363, P68366, Q13748, Q71U36, Q9BQE3 LSVDYGKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11928 (Experiment 1) 11928 31.987 455.256378 2+ 2+ 908.4967322830403 0 1.615337843315274 99.20212765957447 Confident
|
|
|
1658 1657 P38159 VEQATKPSFESGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12039 (Experiment 1) 12039 32.171 479.245209 3+ 3+ 1434.7103068595802 0 2.4279487782643225 100.0 Confident
|
|
|
1659 1658 P62249 GPLQSVQVFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38103 (Experiment 1) 38103 65.262 594.331177 2+ 2+ 1186.6458561282202 0 1.636243742009927 100.0 Confident
|
|
|
1660 1659 P78527 VCLDIIYK Phosphorylation of Y(7) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40628 (Experiment 1) 40628 68.649 552.264038 2+ 2+ 1102.5133841244901 0 0.12579300271014876 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.70759289176091) Y7 1 0 99.45799457994579 Confident
|
|
|
1661 1660 O94905 VAQVAEITYGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23981 (Experiment 1) 23981 48.692 653.852539 2+ 2+ 1305.6928658902905 0 -1.7900211323798578 100.0 Confident
|
|
|
1662 1661 O15264, P45983, P45984, P53778, P53779, Q15746, Q15759, Q16539, Q32MK0, Q86YV6, Q9H1R3 IIDFGLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41599 (Experiment 1) 41599 70.056 452.766266 2+ 2+ 903.5178020807903 0 0.1954492125955899 92.7807486631016 Confident
|
|
|
1663 1662 Q9BUL8 VNLSAAQTLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24559 (Experiment 1) 24559 49.396 536.809204 2+ 2+ 1071.6036569630703 0 0.1845193233186024 98.91598915989161 Confident
|
|
|
1664 1663 Q9Y2S6 GPLATGGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16583 (Experiment 1) 16583 39.061 407.244568 2+ 2+ 812.4756029156401 0 -1.2521320935576699 99.45799457994579 Confident
|
|
|
1665 1664 Q9UFW8 TALYVTPLDR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36583 (Experiment 1) 36583 63.427 614.803284 2+ 2+ 1227.5900542220602 0 1.594694997220374 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
1666 1665 Q8WXF1 AELDGTILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29190 (Experiment 1) 29190 54.795 480.274506 2+ 2+ 958.5335117145803 0 0.9862617297316802 92.93478260869566 Confident
|
|
|
1667 1666 O00567 LAQFIGNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23682 (Experiment 1) 23682 48.294 459.761597 2+ 2+ 917.5083000262503 0 0.37088814565091455 96.19565217391303 Confident
|
|
|
1668 1667 Q14103 IFVGGLSPDTPEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34150 (Experiment 1) 34150 60.533 744.88324 2+ 2+ 1487.7507746892304 0 0.7735293096689985 100.0 Confident
|
|
|
1669 1668 Q96RP9 EYGCPCITGKPK Phosphorylation of Y(2) Carbamidomethylation of C(4, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14323 (Experiment 1) 14323 35.773 497.209869 3+ 3+ 1488.61423744791 0 -4.330713429059094 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Doubtful
|
|
|
1670 1669 P52907 DVQDSLTVSNEAQTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24114 (Experiment 1) 24114 48.857 853.413757 2+ 2+ 1704.8166224029208 0 -2.1451076109595566 100.0 Confident
|
|
|
1671 1670 Q9NR30 APQVLVLAPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33969 (Experiment 1) 33969 60.316 582.858215 2+ 2+ 1163.7026427283504 0 -0.6568162307567732 100.0 Confident
|
|
|
1672 1671 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27635 (Experiment 1) 27635 52.978 609.259521 2+ 2+ 1216.5053215385904 0 -0.6831831240813536 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 14.38605341316958) Phosphorylation of Y (3: 16.666666666666668) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1673 1672 P63244 TNHIGHTGYLNTVTVSPDGSLCASGGK Carbamidomethylation of C(22) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28063 (Experiment 1) 28063 53.474 686.834839 4+ 4+ 2742.3031414387706 1 1.3668616332473038 100.0 Doubtful
|
|
|
1674 1673 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19807 (Experiment 1) 19807 43.297 713.289246 2+ 2+ 1424.5666150733405 0 -1.8758182321018655 Phosphorylation of Y (4: Doubtfull, 9: Doubtfull) Phosphorylation of Y (4: 77.48340228706721, 9: 81.67539267015707) 0 Y4-{Y4}, Y9-{Y9} 2 93.28165374677002 Confident
|
|
|
1675 1674 P04350, P68371, Q3ZCM7 AVLVDLEPGTMDSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42080 (Experiment 1) 42080 70.84 801.413635 2+ 2+ 1600.8130576759604 0 -0.21250543870110938 99.7289972899729 Confident
|
|
|
1676 1675 Q15843 EIEIDIEPTDKVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32562 (Experiment 1) 32562 58.702 562.625549 3+ 3+ 1684.8519452824803 0 1.7017368991758814 100.0 Confident
|
|
|
1677 1676 P10412, P16402, P16403 KASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23658 (Experiment 1) 23658 48.262 442.925873 3+ 3+ 1325.7554661468505 0 0.24342131267173187 100.0 Confident
|
|
|
1678 1677 P10809 VGEVIVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16259 (Experiment 1) 16259 38.668 422.76059 2+ 2+ 843.5065686907501 0 0.06904100258086406 100.0 Confident
|
|
|
1679 1678 P62333 GCLLYGPPGTGK Phosphorylation of Y(5) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30904 (Experiment 1) 30904 56.774 650.29425 2+ 2+ 1298.5730242589302 0 0.7095311856631261 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.86914378029078) Y5 1 0 99.7289972899729 Confident
|
|
|
1680 1679 HBA_HUMAN, P69905 MFLSFPTTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43311 (Experiment 1) 43311 72.994 536.279968 2+ 2+ 1070.5470536037403 0 -1.557521129023873 100.0 Confident
|
|
|
1681 1680 Q7KZF4 DYVAPTANLDQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23298 (Experiment 1) 23298 47.809 707.815674 2+ 2+ 1413.6177255218804 0 -0.6572720323059217 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1682 1681 P19338 KFGYVDFESAEDLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39674 (Experiment 1) 39674 67.286 592.949402 3+ 3+ 1775.8253961814705 0 0.5511536231315712 100.0 Confident
|
|
|
1683 1682 Q14978 NKPGPYSSVPPPSAPPPKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11766 (Experiment 1) 11766 31.734 675.678162 3+ 3+ 2024.0132276420204 0 -0.28171316237206323 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.60383944153578) Y6 1 0 96.71052631578947 Confident
|
|
|
1684 1683 P29350 HKEDVYENLHTK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8584 (Experiment 1) 8584 25.746 531.576294 3+ 3+ 1591.7031864813405 0 2.4243165340717114 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.38219895287958) Y6 1 0 92.14285714285715 Doubtful
|
|
|
1685 1684 P43686 GVLMYGPPGCGK Phosphorylation of Y(5) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30605 (Experiment 1) 30605 56.426 658.283447 2+ 2+ 1314.55018063937 0 1.6409576763338125 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 99.73045822102425 Confident
|
|
|
1686 1685 P13010 YGSDIVPFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33993 (Experiment 1) 33993 60.347 556.78479 2+ 2+ 1111.5549754351503 0 0.04636551591293569 92.38845144356955 Confident
|
|
|
1687 1686 Q14566 QNINLSAPIMSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35359 (Experiment 1) 35359 61.938 672.357971 2+ 2+ 1342.70271938134 0 -0.9892897128604743 99.5 Confident
|
|
|
1688 1687 O00116 EYVDPNNIFGNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42111 (Experiment 1) 42111 70.908 759.323181 2+ 2+ 1516.6347725683504 0 -1.9514063746161396 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1689 1688 P51149 FQSLGVAFYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41352 (Experiment 1) 41352 69.69 594.31488 2+ 2+ 1186.6134933707804 0 1.4417425205931198 91.30434782608697 Confident
|
|
|
1690 1689 P55084 LAAAFAVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26282 (Experiment 1) 26282 51.398 453.263458 2+ 2+ 904.5130510535203 0 -0.7589257526423098 100.0 Confident
|
|
|
1691 1690 O43390 LKDYAFVHFEDR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32446 (Experiment 1) 32446 58.568 540.581604 3+ 3+ 1618.7181082694906 0 3.0056175839293653 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.47643979057592) Y4 1 0 99.24812030075188 Confident
|
|
|
1692 1691 O14910, Q9HAP6, Q9NUP9 EQNSPIYISR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27750 (Experiment 1) 27750 53.114 643.792969 2+ 2+ 1285.57038140664 0 0.7794901205720912 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 91.97207678883072) Y7 1 0 95.6639566395664 Confident
|
|
|
1693 1692 P31930 NALVSHLDGTTPVCEDIGR Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32587 (Experiment 1) 32587 58.73 685.337646 3+ 3+ 2052.9898528209606 0 0.61078378788102 100.0 Confident
|
|
|
1694 1693 P07900 NPDDITNEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36059 (Experiment 1) 36059 62.789 957.376648 2+ 2+ 1912.7404194053506 0 -0.875484852575124 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 14: 0.0) Phosphorylation of Y (10: 26.957110844754812) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
1695 1694 P62805 TVTAMDVVYALKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42834 (Experiment 1) 42834 72.13 733.904846 2+ 2+ 1465.7962854130105 0 -0.7809907139891181 100.0 Confident
|
|
|
1696 1695 P36578 MINTDLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19818 (Experiment 1) 19818 43.31 475.241791 2+ 2+ 948.4698659122 0 -0.8804413911372654 99.7289972899729 Confident
|
|
|
1697 1696 Q00796 VAIEPGAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15774 (Experiment 1) 15774 38.016 455.262787 2+ 2+ 908.50796567308 0 3.3556482499562876 99.1869918699187 Confident
|
|
|
1698 1697 Q96G03 DTYMLSSTVSSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28236 (Experiment 1) 28236 53.689 699.795654 2+ 2+ 1397.5785631318404 0 -1.2918507841655322 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 99.72826086956522 Confident
|
|
|
1699 1698 P60866 TPVEPEVAIHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19320 (Experiment 1) 19320 42.69 416.562988 3+ 3+ 1246.6669854956203 0 0.11931285773423439 100.0 Confident
|
|
|
1700 1699 P08134, P61586 EVFEMATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26952 (Experiment 1) 26952 52.173 491.736694 2+ 2+ 981.4589668753304 0 -0.13402389756749825 99.73118279569893 Confident
|
|
|
1701 1700 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35841 (Experiment 1) 35841 62.516 964.386719 2+ 2+ 1926.7560694694905 0 1.4597883504552154 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 4.116630425851677) Phosphorylation of Y (10: 36.65908251500619) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
1702 1701 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43752 (Experiment 1) 43752 73.686 597.635132 3+ 3+ 1789.88464239309 0 -0.600027688557416 92.14285714285715 Doubtful
|
|
|
1703 1702 P46777 NSVTPDMMEEMYKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32273 (Experiment 1) 32273 58.367 568.255188 3+ 3+ 1701.7412152586505 0 1.4778246872421612 100.0 Confident
|
|
|
1704 1703 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32132 (Experiment 1) 32132 58.206 616.268188 2+ 2+ 1230.5209716027305 0 0.6908228026320616 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 26.414230404338767) Phosphorylation of Y (3: 83.0715532286213) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1705 1704 O75608 TLVNPANVTFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34944 (Experiment 1) 34944 61.46 602.34021 2+ 2+ 1202.6659228664603 0 -0.046319406374772096 100.0 Confident
|
|
|
1706 1705 Q7L5N7 KHLDEYASIASSSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15499 (Experiment 1) 15499 37.61 539.250671 3+ 3+ 1614.7290668760104 0 0.6902938865438376 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1707 1706 Q9UKM9 GYAFVQYSNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30520 (Experiment 1) 30520 56.33 707.294678 2+ 2+ 1412.5761950630704 0 -0.9840278515438698 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 30.191465881448934) Phosphorylation of Y (2: 100.0) 0 Y2-{Y2 Y7} 1 100.0 Confident
|
|
|
1708 1707 P27797 FYGDEEKDKGLQTSQDAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16360 (Experiment 1) 16360 38.792 522.497314 4+ 4+ 2085.9603265144906 0 -0.0843936032907737 100.0 Doubtful
|
|
|
1709 1708 P07195 IVADKDYSVTANSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14088 (Experiment 1) 14088 35.424 504.262939 3+ 3+ 1509.7674873825306 0 -0.33037182444425817 100.0 Confident
|
|
|
1710 1709 P23526 VADIGLAAWGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41433 (Experiment 1) 41433 69.803 564.811523 2+ 2+ 1127.6087423435101 0 -0.22067279896430217 99.7289972899729 Confident
|
|
|
1711 1710 Q08170, Q13247 QAGEVTYADAHK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9032 (Experiment 1) 9032 26.689 457.198456 3+ 3+ 1368.5711096826305 0 1.77087302239142 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.30191972076788) Y7 1 0 98.7012987012987 Confident
|
|
|
1712 1711 Q8TCJ2 ESDYFTPQGEFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37696 (Experiment 1) 37696 64.77 778.310669 2+ 2+ 1554.6028037337305 0 2.557682289870505 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65156794425087) Y4 1 0 99.72972972972973 Confident
|
|
|
1713 1712 P50914 VAYVSFGPHAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23407 (Experiment 1) 23407 47.946 411.552094 3+ 3+ 1231.6349570913503 0 -0.40860892828658146 99.28057553956835 Confident
|
|
|
1714 1713 P50990 AIADTGANVVVTGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23061 (Experiment 1) 23061 47.524 686.87616 2+ 2+ 1371.7357933314304 0 1.436749370719975 100.0 Confident
|
|
|
1715 1714 P08670 SLYASSPGGVYATR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27786 (Experiment 1) 27786 53.157 754.84375 2+ 2+ 1507.6708237239004 0 1.406480123788371 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 6.913166293054822) Phosphorylation of Y (3: 99.83844911147011) 0 Y3-{Y3 Y11} 1 100.0 Confident
|
|
|
1716 1715 P51531, P51532 LTQVLNTHYVAPR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26339 (Experiment 1) 26339 51.465 796.404419 2+ 2+ 1590.7919419160903 0 1.4710828296128005 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
1717 1716 P22090, P62701, Q8TD47 YALTGDEVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20659 (Experiment 1) 20659 44.31 498.256653 2+ 2+ 994.4971262058605 0 1.6325553925892988 99.73045822102425 Confident
|
|
|
1718 1717 P27635 FNADEFEDMVAEKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40704 (Experiment 1) 40704 68.751 567.590698 3+ 3+ 1699.7511856953906 0 -0.540938703306552 100.0 Confident
|
|
|
1719 1718 P09874 NREELGFRPEYSASQLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26025 (Experiment 1) 26025 51.102 506.760742 4+ 4+ 2023.0123025177004 0 0.7694046333083974 100.0 Doubtful
|
|
|
1720 1719 P62263 TPGPGAQSALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13539 (Experiment 1) 13539 34.553 527.78595 2+ 2+ 1053.5567067706502 0 0.6065869259911841 100.0 Confident
|
|
|
1721 1720 Q03252 SVFEEEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24360 (Experiment 1) 24360 49.164 497.745514 2+ 2+ 993.4767251144503 0 -0.2511805776197765 99.72826086956522 Confident
|
|
|
1722 1721 P51991 SSGSPYGGGYGSGGGSGGYGSR Phosphorylation of Y(19) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18047 (Experiment 1) 18047 41.045 995.881165 2+ 2+ 1989.7490270264398 0 -0.6275644742498097 Phosphorylation of Y (19: Doubtfull) Phosphorylation of Y (19: 7.164095801608415) Phosphorylation of Y (19: 2.6178010471204187) 0 Y19-{Y6 Y10 Y19} 1 100.0 Confident
|
|
|
1723 1722 Q9P107 DYYQPLAAK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26740 (Experiment 1) 26740 51.924 574.754395 2+ 2+ 1147.4950912080603 0 -0.743048732769213 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 1.9197207678883073) 0 Y2-{Y2 Y3} 1 99.73544973544973 Confident
|
|
|
1724 1723 P22626 EESGKPGAHVTVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5590 (Experiment 1) 5590 19.25 446.905365 3+ 3+ 1337.6939285194503 0 0.25141802933314256 100.0 Confident
|
|
|
1725 1724 O75396 DLQQYQSQAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12641 (Experiment 1) 12641 33.17 644.782532 2+ 2+ 1287.5496459620604 0 0.6708501338058854 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.33507853403141) Y5 1 0 96.19565217391303 Confident
|
|
|
1726 1725 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25146 (Experiment 1) 25146 50.077 757.296082 3+ 3+ 2268.8644082151895 0 0.8840162596914077 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 20.167409345742612) Phosphorylation of Y (11: 0.0) 0 Y6-{Y6 Y11 Y22} 1 100.0 Confident
|
|
|
1727 1726 P61586 IGAFGYMECSAK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34958 (Experiment 1) 34958 61.477 667.299377 2+ 2+ 1332.5842440414403 0 -0.03220073664556638 100.0 Confident
|
|
|
1728 1727 P04350, P07437, P68371 YLTVAAVFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43442 (Experiment 1) 43442 73.175 520.300354 2+ 2+ 1038.5862159937803 0 -0.058550220571265944 99.46236559139786 Confident
|
|
|
1729 1728 Q96ST3 KTQYEEHIYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11128 (Experiment 1) 11128 30.751 482.885864 3+ 3+ 1445.6340442923604 0 1.1861389822847554 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 11.018447226771594) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y4 Y9} 1 100.0 Confident
|
|
|
1730 1729 P61978 NTDEMVELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25674 (Experiment 1) 25674 50.698 553.760132 2+ 2+ 1105.5073736197303 0 -1.5011471236597371 100.0 Confident
|
|
|
1731 1730 P06753, P07951, P09493, P67936 IQLVEEELDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35158 (Experiment 1) 35158 61.704 622.332214 2+ 2+ 1242.6455813447003 0 3.449714148741553 100.0 Confident
|
|
|
1732 1731 P31943 YGDGGSTFQSTTGHCVHMR Carbamidomethylation of C(15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17488 (Experiment 1) 17488 40.276 525.22699 4+ 4+ 2096.8792568261606 0 -0.19167585604292037 100.0 Doubtful
|
|
|
1733 1732 P47755, P52907 LLLNNDNLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40096 (Experiment 1) 40096 67.858 599.350403 2+ 2+ 1196.6877209402003 0 -1.2245524650785176 99.72972972972973 Confident
|
|
|
1734 1733 P23396 ELAEDGYSGVEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26885 (Experiment 1) 26885 52.093 712.341125 2+ 2+ 1422.6626879608202 0 3.5159581496196393 100.0 Confident
|
|
|
1735 1734 Q8TCJ2 ESDYFTPQGEFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38283 (Experiment 1) 38283 65.478 778.811829 2+ 2+ 1554.6028037337305 1 1.8928832012557042 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.38219895287958) Y4 1 0 97.289972899729 Confident
|
|
|
1736 1735 O14744 YSQYQQAIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21693 (Experiment 1) 21693 45.805 686.303284 2+ 2+ 1370.5907824980504 0 0.8979772215162737 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 22.008726686274073) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y1 Y4 Y9} 1 99.73333333333333 Confident
|
|
|
1737 1736 Q15181, Q9H2U2 YVANIFPYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40141 (Experiment 1) 40141 67.918 557.800537 2+ 2+ 1113.5858816406103 0 0.5731673685917282 99.45652173913044 Confident
|
|
|
1738 1737 P07741 AAIGLLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30210 (Experiment 1) 30210 55.976 392.755859 2+ 2+ 783.4966727133901 0 0.6267930614539748 99.1869918699187 Confident
|
|
|
1739 1738 P62906 AVDIPHMDIEALKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35016 (Experiment 1) 35016 61.543 527.288452 3+ 3+ 1578.8439638814204 0 -0.2764342324600437 98.49624060150376 Confident
|
|
|
1740 1739 P07900, P08238, Q14568, Q58FF8, Q58FG1 TLTLVDTGIGMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39822 (Experiment 1) 39822 67.486 675.371155 2+ 2+ 1348.7272027936804 0 0.41034690253023337 100.0 Confident
|
|
|
1741 1740 Q14687 VDTSVHYNIPELQSSSR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30817 (Experiment 1) 30817 56.67 671.304932 3+ 3+ 2010.9047993918505 0 -5.875483305733369 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.51534733441034) Y7 1 0 100.0 Doubtful
|
|
|
1742 1741 P35579 HSQAVEELAEQLEQTKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34580 (Experiment 1) 34580 61.036 666.008911 3+ 3+ 1995.0021317568205 0 1.387292043302484 91.7910447761194 Doubtful
|
|
|
1743 1742 P11142 HWPFMVVNDAGRPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34270 (Experiment 1) 34270 60.676 551.948975 3+ 3+ 1652.8245658495202 0 0.319927044838193 100.0 Confident
|
|
|
1744 1743 P00505 IGASFLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29677 (Experiment 1) 29677 55.353 446.76062 2+ 2+ 890.4974009893801 1 6.64555714904599 98.72773536895674 Doubtful
|
|
|
1745 1744 Q9NWU5 RPAEIYHCR Phosphorylation of Y(6) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7020 (Experiment 1) 7020 22.327 427.85556 3+ 3+ 1280.5485408465902 0 -2.874986141499645 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.47643979057592) Y6 1 0 99.24812030075188 Confident
|
|
|
1746 1745 P49327 VFTTVGSAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17146 (Experiment 1) 17146 39.788 519.776794 2+ 2+ 1037.5393253710104 0 -0.279258863419013 96.24664879356568 Confident
|
|
|
1747 1746 P0CB38, P11940, Q13310 EFTNVYIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30289 (Experiment 1) 30289 56.065 507.268799 2+ 2+ 1012.5229470308802 0 0.09663072666735836 97.289972899729 Confident
|
|
|
1748 1747 P36578 QPYAVSELAGHQTSAESWGTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32632 (Experiment 1) 32632 58.78 778.033691 3+ 3+ 2331.0879866391 0 -3.745770433092465 100.0 Confident
|
|
|
1749 1748 P45880 VNNSSLIGVGYTQTLRPGVK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33365 (Experiment 1) 33365 59.616 728.377869 3+ 3+ 2182.1147325884403 0 -1.352313135827288 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 98.08027923211169) Y11 1 0 99.24812030075188 Confident
|
|
|
1750 1749 O43776 IGALEGYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22816 (Experiment 1) 22816 47.227 439.740417 2+ 2+ 877.4657665079301 0 0.5850710181708977 100.0 Confident
|
|
|
1751 1750 P11940 EFSPFGTITSAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41285 (Experiment 1) 41285 69.579 642.827881 2+ 2+ 1283.6397676882705 0 1.121124148507902 100.0 Confident
|
|
|
1752 1751 Q9BZZ5 ELPQFATGENLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37196 (Experiment 1) 37196 64.16 736.382568 2+ 2+ 1470.7466923683003 0 2.6417710867778226 100.0 Confident
|
|
|
1753 1752 Q92820 FFNVLTTNTDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39928 (Experiment 1) 39928 67.643 678.844849 2+ 2+ 1355.6721304457103 0 2.220409688301606 98.91891891891892 Confident
|
|
|
1754 1753 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28363 (Experiment 1) 28363 53.834 573.632629 3+ 3+ 1717.87474641573 0 0.761919020695218 91.7910447761194 Doubtful
|
|
|
1755 1754 P60866 LIDLHSPSEIVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31686 (Experiment 1) 31686 57.692 450.925415 3+ 3+ 1349.7554661468505 0 -0.7765855400142488 100.0 Confident
|
|
|
1756 1755 P36969 TEVNYTQLVDLHAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33574 (Experiment 1) 33574 59.856 870.417725 2+ 2+ 1737.8087141790404 1 5.074107067234634 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Doubtful
|
|
|
1757 1756 P52272 FESPEVAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19134 (Experiment 1) 19134 42.465 532.25647 2+ 2+ 1062.4981888350203 0 0.18621792661317832 100.0 Confident
|
|
|
1758 1757 P13639 ARPFPDGLAEDIDKGEVSAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35239 (Experiment 1) 35239 61.798 536.52594 4+ 4+ 2142.0705456698106 0 1.9143859131301835 100.0 Doubtful
|
|
|
1759 1758 P31146 AVFVSEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15752 (Experiment 1) 15752 37.984 418.729309 2+ 2+ 835.4439684341903 0 0.11538742911748208 99.73045822102425 Confident
|
|
|
1760 1759 P49327 GNAGQSNYGFANSAMER Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27042 (Experiment 1) 27042 52.276 618.580994 3+ 3+ 1852.7199758276302 0 0.6341248177093856 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 98.42931937172776) Y8 1 0 100.0 Confident
|
|
|
1761 1760 P25788 SNFGYNIPLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36707 (Experiment 1) 36707 63.577 576.806213 2+ 2+ 1151.5975089534702 0 0.3156285527880447 98.91598915989161 Confident
|
|
|
1762 1761 P35232 ILFRPVASQLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32981 (Experiment 1) 32981 59.175 466.286255 3+ 3+ 1395.8350538802301 0 1.345183596917035 100.0 Confident
|
|
|
1763 1762 P62244 IVVNLTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27423 (Experiment 1) 27423 52.722 436.271362 2+ 2+ 870.5287011176601 0 -0.6074785193557591 99.48849104859335 Confident
|
|
|
1764 1763 P10599, THIO_HUMAN TAFQEALDAAGDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36534 (Experiment 1) 36534 63.372 668.823303 2+ 2+ 1335.6306595565502 0 1.0417634008355903 100.0 Confident
|
|
|
1765 1764 P17844, Q92841 STCIYGGAPK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15805 (Experiment 1) 15805 38.06 527.26001 2+ 2+ 1052.4960806600402 0 8.901196475934633 98.67724867724867 Doubtful
|
|
|
1766 1765 P42704 LQDAINILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36206 (Experiment 1) 36206 62.985 514.310852 2+ 2+ 1026.6073453611803 0 -0.18888845824608982 96.4769647696477 Confident
|
|
|
1767 1766 P04406 RVIISAPSADAPMFVMGVNHEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38491 (Experiment 1) 38491 65.744 593.058716 4+ 4+ 2368.20315714583 0 1.0964301270834198 100.0 Doubtful
|
|
|
1768 1767 Q9HDC9 LLEYDTVTR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27370 (Experiment 1) 27370 52.659 595.279724 2+ 2+ 1188.5427696764702 0 1.785205857141646 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.50959860383944) Y4 1 0 98.91891891891892 Confident
|
|
|
1769 1768 Q9BZZ5 QIYNPPSGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10343 (Experiment 1) 10343 29.271 542.247131 2+ 2+ 1082.4797754970903 0 -0.06125501326042504 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1770 1769 O43390, O60506 LFVGSIPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31894 (Experiment 1) 31894 57.938 430.765717 2+ 2+ 859.5167394516302 0 0.16437562642581227 93.13984168865436 Confident
|
|
|
1771 1770 Q96IX5 AGPESDAQYQFTGIKK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25695 (Experiment 1) 25695 50.722 910.419006 2+ 2+ 1818.8189445095704 0 2.479390241722046 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 85.34031413612566) Y9 1 0 95.67567567567568 Confident
|
|
|
1772 1771 P49458 PQYQTWEEFSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39582 (Experiment 1) 39582 67.155 775.820557 2+ 2+ 1549.6238735314805 0 1.73206260525577 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1773 1772 Q16629 VYVGNLGTGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21330 (Experiment 1) 21330 45.189 568.309204 2+ 2+ 1134.6033226099 0 0.4684568906784267 99.7289972899729 Confident
|
|
|
1774 1773 P49736 ISHLPLVEELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36827 (Experiment 1) 36827 63.721 435.922668 3+ 3+ 1304.7452358163202 0 0.717852030955362 91.72932330827068 Doubtful
|
|
|
1775 1774 P07900, P08238, Q14568, Q58FF8 YIDQEELNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18282 (Experiment 1) 18282 41.377 576.282532 2+ 2+ 1150.5506183307002 0 -0.09306573471421091 100.0 Confident
|
|
|
1776 1775 Q13242 GSPHYFSPFRPY Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40208 (Experiment 1) 40208 68.028 512.222534 3+ 3+ 1533.6442150532403 0 1.0135880398175345 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 22.07206573010752) Phosphorylation of Y (5: 85.29886914378028) 0 Y12-{Y5 Y12} 1 92.99363057324841 Doubtful
|
|
|
1777 1776 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27081 (Experiment 1) 27081 52.319 523.251953 2+ 2+ 1044.4892775516303 0 0.07215907224038404 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1778 1777 P40939 FVDLYGAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29349 (Experiment 1) 29349 54.977 520.774048 2+ 2+ 1039.5338460677503 0 -0.2909143490549157 100.0 Confident
|
|
|
1779 1778 P08238, P14625, Q58FF6, Q58FF7, Q58FF8 ELISNASDALDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28487 (Experiment 1) 28487 53.979 638.326355 2+ 2+ 1274.6354105838202 0 2.151319965697248 100.0 Confident
|
|
|
1780 1779 Q9NQR4 AVDNQVYVATASPAR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22971 (Experiment 1) 22971 47.412 547.927002 3+ 3+ 1640.7559503301907 0 1.9627162583462177 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
1781 1780 Q86UX7 LTQLYEQAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19896 (Experiment 1) 19896 43.416 601.284546 2+ 2+ 1200.5540030665104 0 0.4457125231916477 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.33507853403141) Y5 1 0 96.19565217391303 Confident
|
|
|
1782 1781 P01903 NGKPVTTGVSETVFLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38350 (Experiment 1) 38350 65.571 601.660278 3+ 3+ 1800.9733978278402 1 -9.838200128455998 99.28057553956835 Doubtful
|
|
|
1783 1782 P32969 TICSHVQNMIK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22626 (Experiment 1) 22626 47.004 444.225067 3+ 3+ 1329.6533266607703 0 0.033720741055632365 100.0 Confident
|
|
|
1784 1783 P11142 HWPFMVVNDAGRPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33831 (Experiment 1) 33831 60.15 551.948059 3+ 3+ 1652.8245658495202 0 -1.3396471814350217 100.0 Confident
|
|
|
1785 1784 P31948 ALDLDSSCK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18490 (Experiment 1) 18490 41.655 504.738434 2+ 2+ 1007.4593607981501 0 2.9265424155714075 100.0 Confident
|
|
|
1786 1785 P11142 HWPFMVVNDAGRPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34049 (Experiment 1) 34049 60.412 551.949158 3+ 3+ 1652.8245658495202 0 0.6514795376014343 100.0 Confident
|
|
|
1787 1786 Q06830 TIAQDYGVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30496 (Experiment 1) 30496 56.301 554.305725 2+ 2+ 1106.5971746003001 0 -0.25034366613465914 100.0 Confident
|
|
|
1788 1787 P07900 KHLEINPDHSIIETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28824 (Experiment 1) 28824 54.375 479.515778 4+ 4+ 1914.0323096862903 0 0.8844588853664569 100.0 Doubtful
|
|
|
1789 1788 Q14739 TFEVTPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29747 (Experiment 1) 29747 55.436 481.767975 2+ 2+ 961.52328138405 0 -1.9556239588104547 99.46091644204851 Confident
|
|
|
1790 1789 Q14697 DAQHYGGWEHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13007 (Experiment 1) 13007 33.738 479.18985 3+ 3+ 1434.5466262702903 0 0.7612362870665373 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1791 1790 P54727 IDIDPEETVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29095 (Experiment 1) 29095 54.687 579.798279 2+ 2+ 1157.5815841058104 0 0.3630234285547146 96.4769647696477 Confident
|
|
|
1792 1791 P26641 QVLEPSFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27113 (Experiment 1) 27113 52.357 488.266235 2+ 2+ 974.5185303567803 0 -0.6280282918187053 99.72972972972973 Confident
|
|
|
1793 1792 P00519 LATGEEEGGGSSSKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5502 (Experiment 1) 5502 19.106 488.902405 3+ 3+ 1463.6852143105502 0 0.11678474884946692 100.0 Confident
|
|
|
1794 1793 Q9UKK9 TTYMDPTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17381 (Experiment 1) 17381 40.123 507.234009 2+ 2+ 1012.45354714172 0 -0.08090480510879032 91.30434782608697 Confident
|
|
|
1795 1794 Q8NBX0 FYGEPVIK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30351 (Experiment 1) 30351 56.135 516.743591 2+ 2+ 1031.4728992115004 0 -0.2613917797175977 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.35379644588045) Y2 1 0 99.73614775725594 Confident
|
|
|
1796 1795 Q9Y5V0 AALIYTCTVCR Phosphorylation of Y(5) Carbamidomethylation of C(7, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30524 (Experiment 1) 30524 56.334 704.312683 2+ 2+ 1406.6087581446502 0 1.4588156460773476 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 93.36823734729494) Y5 1 0 98.95833333333334 Confident
|
|
|
1797 1796 Q14978 DNQLSEVANK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17107 (Experiment 1) 17107 39.738 559.277527 2+ 2+ 1116.5411162761604 0 -0.550003724973167 98.92183288409704 Confident
|
|
|
1798 1797 P63220 DHASIQMNVAEVDKVTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31256 (Experiment 1) 31256 57.184 657.330322 3+ 3+ 1968.9687234535604 0 0.20950709066756099 100.0 Confident
|
|
|
1799 1798 P78344 LDPSPQTIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22749 (Experiment 1) 22749 47.148 621.294434 2+ 2+ 1240.5740698047505 0 0.19737958398706007 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 96.50959860383944) Y9 1 0 96.22641509433963 Confident
|
|
|
1800 1799 Q16630 GAAPNVVYTYTGK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32929 (Experiment 1) 32929 59.115 710.82489 2+ 2+ 1419.6435463469004 0 -5.851815235171284 Phosphorylation of Y (8: Random) Phosphorylation of Y (8: 0.0, 10: 0.0) Phosphorylation of Y (8: 0.0) 0 Y8-{Y8 Y10} 1 100.0 Doubtful
|
|
|
1801 1800 P19338 SISLYYTGEK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33471 (Experiment 1) 33471 59.738 620.77771 2+ 2+ 1239.5424353233002 0 -1.2631372858935963 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (5: 0.0) 0 Y5-{Y5 Y6} 1 100.0 Confident
|
|
|
1802 1801 P62805 TVTAMDVVYALKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42789 (Experiment 1) 42789 72.067 489.606049 3+ 3+ 1465.7962854130105 0 0.02191323285342033 100.0 Confident
|
|
|
1803 1802 P14625 SGYLLPDTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27853 (Experiment 1) 27853 53.233 497.26651 2+ 2+ 992.5178616504402 0 0.6087442973074868 100.0 Confident
|
|
|
1804 1803 P68104, Q5VTE0 YYVTIIDAPGHR Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34404 (Experiment 1) 34404 60.831 495.569427 3+ 3+ 1483.68607986522 0 0.25003858635631787 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (1: 0.0) 0 Y1-{Y1 Y2} 1 100.0 Confident
|
|
|
1805 1804 P78527 SIGEYDVLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33578 (Experiment 1) 33578 59.861 566.257568 2+ 2+ 1130.5009048644902 0 -0.2841445669568428 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.51534733441034) Y5 1 0 99.74093264248705 Confident
|
|
|
1806 1805 Q16698 VAFITGGGTGLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32778 (Experiment 1) 32778 58.947 589.332275 2+ 2+ 1176.6502728023202 0 -0.2339392321901122 100.0 Confident
|
|
|
1807 1806 ALDOA_RABIT, P04075 ALSDHHIYLEGTLLKPNMVTPGHACTQK Phosphorylation of Y(8) Carbamidomethylation of C(25) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34873 (Experiment 1) 34873 61.372 803.640869 4+ 4+ 3210.5355401332404 0 -0.36396856734892247 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Doubtful
|
|
|
1808 1807 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 KESYSIYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25554 (Experiment 1) 25554 50.561 680.316528 2+ 2+ 1358.6159346167303 0 1.887690794028448 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.33452891645359) Phosphorylation of Y (9: 15.457995359288612) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
1809 1808 P62888 VCTLAIIDPGDSDIIR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45404 (Experiment 1) 45404 77.445 879.460327 2+ 2+ 1756.9029353095198 0 1.7998324976960227 99.72826086956522 Confident
|
|
|
1810 1809 P62888 KSEIEYYAMLAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35136 (Experiment 1) 35136 61.679 509.23822 3+ 3+ 1524.6935333144304 0 -0.4599776133041394 Phosphorylation of Y (7: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (7: 0.17452006980802792) 0 Y7-{Y6 Y7} 1 100.0 Confident
|
|
|
1811 1810 P26368 AMQGLTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13919 (Experiment 1) 13919 35.139 417.218842 2+ 2+ 832.4225217969602 0 0.7301562147326625 96.19565217391303 Confident
|
|
|
1812 1811 P42704 LIASYCNVGDIEGASK Phosphorylation of Y(5) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33640 (Experiment 1) 33640 59.931 888.897522 2+ 2+ 1775.7801164727002 0 0.21070694047742144 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.5767366720517) Y5 1 0 99.72972972972973 Confident
|
|
|
1813 1812 P32969 KFLDGIYVSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32157 (Experiment 1) 32157 58.235 433.571198 3+ 3+ 1297.6918032611304 0 -0.029723349887447247 99.39024390243902 Confident
|
|
|
1814 1813 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29247 (Experiment 1) 29247 54.857 528.26239 2+ 2+ 1054.5100129962104 0 0.20261730989276847 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
1815 1814 P46736 VLYTCFQSIQAQK Phosphorylation of Y(3) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36530 (Experiment 1) 36530 63.367 833.388428 2+ 2+ 1664.7633442097504 0 -0.6246443370377521 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.38219895287958) Y3 1 0 99.7289972899729 Confident
|
|
|
1816 1815 P04843 LPVALDPGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28296 (Experiment 1) 28296 53.757 490.792572 2+ 2+ 979.5702315764702 0 0.3662341873987724 99.72972972972973 Confident
|
|
|
1817 1816 P62942 RGQTCVVHYTGMLEDGKK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19254 (Experiment 1) 19254 42.613 520.509094 4+ 4+ 2078.0037290632904 0 1.7007750319426824 100.0 Doubtful
|
|
|
1818 1817 P27635, Q96L21 LIPDGCGVK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18096 (Experiment 1) 18096 41.131 479.755035 2+ 2+ 957.4953523840502 0 0.1716317101241133 94.03794037940379 Confident
|
|
|
1819 1818 Q6UB35 TIAQAVYGAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23238 (Experiment 1) 23238 47.728 551.27063 2+ 2+ 1100.5267256895104 0 -0.016891099613421254 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 90.40139616055846) Y7 1 0 94.10187667560321 Confident
|
|
|
1820 1819 Q14566 HVEEFSPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11572 (Experiment 1) 11572 31.413 500.745697 2+ 2+ 999.4773938207902 0 -0.5519309625077783 99.73190348525469 Confident
|
|
|
1821 1820 Q14103 IFVGGLSPDTPEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34377 (Experiment 1) 34377 60.799 744.883484 2+ 2+ 1487.7507746892304 0 1.101097679570226 100.0 Confident
|
|
|
1822 1821 P62906 DTLYEAVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24963 (Experiment 1) 24963 49.865 523.729004 2+ 2+ 1045.4481410156402 0 -4.473619243295169 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.30191972076788) Y4 1 0 99.73118279569893 Doubtful
|
|
|
1823 1822 Q02878 HQEGEIFDTEKEKYEITEQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25195 (Experiment 1) 25195 50.135 628.051025 4+ 4+ 2508.1768612131505 0 -0.7432035522924045 100.0 Doubtful
|
|
|
1824 1823 P05141 AAYFGIYDTAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39614 (Experiment 1) 39614 67.207 650.285889 2+ 2+ 1298.5584197406101 0 -0.9185753197898886 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 18.111436865187635) Phosphorylation of Y (7: 99.30191972076788) 0 Y7-{Y3 Y7} 1 99.45652173913044 Confident
|
|
|
1825 1824 P15153 AVLCPQPTR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14549 (Experiment 1) 14549 36.123 521.278992 2+ 2+ 1040.5436995588002 0 -0.2575322996766675 99.47643979057592 Confident
|
|
|
1826 1825 P37802 NVIGLQMGTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30710 (Experiment 1) 30710 56.547 601.819397 2+ 2+ 1201.6237407846502 0 0.4156412505703551 100.0 Confident
|
|
|
1827 1826 Q14240 DQIYEIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42936 (Experiment 1) 42936 72.331 632.286682 2+ 2+ 1262.5584197406104 0 0.3094528936113643 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
1828 1827 P17174 HIYLLPSGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31393 (Experiment 1) 31393 57.346 568.28656 2+ 2+ 1134.55869452413 0 -0.11214213817356668 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
1829 1828 P30041 LPFPIIDDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44406 (Experiment 1) 44406 75.153 543.302795 2+ 2+ 1084.5916952970401 0 -0.6057674207715806 99.45945945945947 Confident
|
|
|
1830 1829 P30086 GNDISSGTVLSDYVGSGPPK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37474 (Experiment 1) 37474 64.496 1015.459656 2+ 2+ 2028.9041306855102 0 0.3094072011647154 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 100.0) Y13 1 0 100.0 Confident
|
|
|
1831 1830 P62854, Q5JNZ5 NIVEAAAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20595 (Experiment 1) 20595 44.239 471.77182 2+ 2+ 941.5294293936504 0 -0.3628100870088299 100.0 Confident
|
|
|
1832 1831 Q9HB71 WDYLTQVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37206 (Experiment 1) 37206 64.173 591.296814 2+ 2+ 1180.5764391557204 0 2.2289284064663595 99.73190348525469 Confident
|
|
|
1833 1832 Q16666 QASGNIVYGVFMLHK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45450 (Experiment 1) 45450 77.55 581.947571 3+ 3+ 1742.8215277922104 0 -0.3689865094430883 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 97.38219895287958) Y8 1 0 92.14285714285715 Doubtful
|
|
|
1834 1833 P39019 KLTPQGQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4563 (Experiment 1) 4563 17.257 464.272156 2+ 2+ 926.5297637468202 0 -0.005040625472898171 99.7289972899729 Confident
|
|
|
1835 1834 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37361 (Experiment 1) 37361 64.36 964.391602 2+ 2+ 1926.7560694694905 0 6.523117232953016 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 6.912389302791533) Phosphorylation of Y (14: 0.4398244085630429) 0 Y14-{Y10 Y14} 1 99.7289972899729 Doubtful
|
|
|
1836 1835 P62888 TGVHHYSGNNIELGTACGK Carbamidomethylation of C(17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15372 (Experiment 1) 15372 37.445 504.490112 4+ 4+ 2013.9326722980104 0 -0.6591627615626173 100.0 Doubtful
|
|
|
1837 1836 P60842 GFKDQIYDIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45517 (Experiment 1) 45517 77.702 791.370911 2+ 2+ 1580.7276103240304 0 -0.21561165329158546 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1838 1837 P13796 EITENLMATGDLDQDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37968 (Experiment 1) 37968 65.096 939.431702 2+ 2+ 1876.8472709082002 0 0.8410188314570908 99.45652173913044 Doubtful
|
|
|
1839 1838 P10809 NAGVEGSLIVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26663 (Experiment 1) 26663 51.834 608.333008 2+ 2+ 1214.6506667251404 0 0.6545278212387181 100.0 Confident
|
|
|
1840 1839 P68104, Q5VTE0 YYVTIIDAPGHR Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34415 (Experiment 1) 34415 60.843 742.850647 2+ 2+ 1483.68607986522 0 0.4450433291278245 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.0) 0 Y1-{Y1 Y2} 1 100.0 Confident
|
|
|
1841 1840 Q16891 VVSQYHELVVQAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23153 (Experiment 1) 23153 47.628 536.602234 3+ 3+ 1606.7868565356505 0 -1.2324048839239716 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1842 1841 P62993 NYVTPVNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13623 (Experiment 1) 13623 34.683 521.741211 2+ 2+ 1041.4644597861204 0 3.267224557393211 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 98.95287958115183) Y2 1 0 99.72972972972973 Confident
|
|
|
1843 1842 P51149 VIILGDSGVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30806 (Experiment 1) 30806 56.658 529.31604 2+ 2+ 1056.6179100448803 0 -0.3617672022816791 100.0 Confident
|
|
|
1844 1843 Q86V81 SLGTADVHFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22833 (Experiment 1) 22833 47.245 411.207367 3+ 3+ 1230.5992998586205 0 0.7877142507132973 100.0 Confident
|
|
|
1845 1844 P11766 LVSEYMSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19641 (Experiment 1) 19641 43.084 518.72522 2+ 2+ 1035.4347994506202 0 1.048355520441468 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 94.06631762652705) Y5 1 0 93.65079365079364 Confident
|
|
|
1846 1845 P49411 GITINAAHVEYSTAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26631 (Experiment 1) 26631 51.797 558.625061 3+ 3+ 1672.8532826951605 0 0.042308882550755156 100.0 Confident
|
|
|
1847 1846 P68104, Q05639, Q5VTE0 EHALLAYTLGVK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41950 (Experiment 1) 41950 70.611 697.85907 2+ 2+ 1393.7006673002004 0 2.0919497997023546 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 74.79806138933765) Y7 1 0 92.54498714652956 Confident
|
|
|
1848 1847 Q02790 DKFSFDLGKGEVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34648 (Experiment 1) 34648 61.112 528.287781 3+ 3+ 1581.8402583999703 0 0.7919929458160291 100.0 Confident
|
|
|
1849 1848 P17987 AFHNEAQVNPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11265 (Experiment 1) 11265 30.97 471.230103 3+ 3+ 1410.6640253735002 0 3.1507891578201486 100.0 Confident
|
|
|
1850 1849 P61158 AEPEDHYFLLTEPPLNTPENR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44568 (Experiment 1) 44568 75.596 854.724121 3+ 3+ 2561.1475488383503 0 1.1640265415383548 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1851 1850 P02786 SSGLPNIPVQTISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37026 (Experiment 1) 37026 63.959 734.911438 2+ 2+ 1467.8045415975903 0 2.5727443598934516 96.4769647696477 Confident
|
|
|
1852 1851 O00232 AIYDTPCIQAESEK Phosphorylation of Y(3) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28560 (Experiment 1) 28560 54.064 852.863464 2+ 2+ 1703.7113682065406 0 0.5902823090533483 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1853 1852 P62937, PPIA_HUMAN VKEGMNIVEAMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34041 (Experiment 1) 34041 60.404 502.586823 3+ 3+ 1504.7377845607205 0 0.5670922841564439 100.0 Confident
|
|
|
1854 1853 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34366 (Experiment 1) 34366 60.788 636.640686 3+ 3+ 1906.8978635366104 0 1.2383049204658756 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 5: 0.0) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y5} 1 100.0 Confident
|
|
|
1855 1854 P20618 DVYTGDALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23555 (Experiment 1) 23555 48.134 505.250214 2+ 2+ 1008.4876241513202 0 -1.7309066558771178 99.72826086956522 Confident
|
|
|
1856 1855 Q13310 IVGSKPLYVALAQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34884 (Experiment 1) 34884 61.386 532.296997 3+ 3+ 1593.8643785803604 0 2.995216052158412 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
1857 1856 P30050 CTGGEVGATSALAPK Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20306 (Experiment 1) 20306 43.904 709.851746 2+ 2+ 1417.6871288868501 0 1.2750421789300026 99.46236559139786 Confident
|
|
|
1858 1857 P51114 IYGESADAVKK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9871 (Experiment 1) 9871 28.328 630.797485 2+ 2+ 1259.5798834611805 0 0.4229609611623073 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
1859 1858 P04350, P07437, P68371, Q13509, Q13885, Q9BVA1 MREIVHIQAGQCGNQIGAK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20419 (Experiment 1) 20419 44.029 704.02771 3+ 3+ 2109.05716161848 0 1.9596715374484464 100.0 Confident
|
|
|
1860 1859 P60174 HVFGESDELIGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26459 (Experiment 1) 26459 51.602 486.912506 3+ 3+ 1457.7150578868502 0 0.43177708405020354 100.0 Confident
|
|
|
1861 1860 P68431, Q16695, Q71DI3 SAPATGGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5338 (Experiment 1) 5338 18.835 394.219666 2+ 2+ 786.4235673427802 0 1.5368658170722063 92.63157894736842 Confident
|
|
|
1862 1861 P38159, Q96E39 DSYGGPPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8611 (Experiment 1) 8611 25.8 464.68161 2+ 2+ 927.3487613275402 0 -0.10142552721384479 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 90.14539579967689) Y3 1 0 99.22680412371135 Confident
|
|
|
1863 1862 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28592 (Experiment 1) 28592 54.1 573.632874 3+ 3+ 1717.87474641573 0 1.1890219683793806 100.0 Confident
|
|
|
1864 1863 P35579 ALELDSNLYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35753 (Experiment 1) 35753 62.411 597.310364 2+ 2+ 1192.6088019131603 0 -2.198891201704903 99.45945945945947 Confident
|
|
|
1865 1864 P04844 FELDTSER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24681 (Experiment 1) 24681 49.538 498.735321 2+ 2+ 995.4559896698702 0 0.0996485626963684 96.4769647696477 Confident
|
|
|
1866 1865 P08238, Q58FF7 IDIIPNPQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32679 (Experiment 1) 32679 58.833 597.827637 2+ 2+ 1193.6404363946103 0 0.23808855232117163 99.7289972899729 Confident
|
|
|
1867 1866 P62917 ASGNYATVISHNPETK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17875 (Experiment 1) 17875 40.78 884.899231 2+ 2+ 1767.7828933540202 0 0.5739144656179822 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1868 1867 P11586 QPSQGPTFGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25050 (Experiment 1) 25050 49.967 580.308228 2+ 2+ 1158.6033226099 0 -1.2230929353405622 91.30434782608697 Confident
|
|
|
1869 1868 P53041 AEGYEVAHGGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7703 (Experiment 1) 7703 23.868 409.171265 3+ 3+ 1224.4924654391102 0 -0.4071965175789812 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.33507853403141) Y4 1 0 94.73684210526316 Confident
|
|
|
1870 1869 P37802 GPAYGLSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13961 (Experiment 1) 13961 35.216 450.702301 2+ 2+ 899.3902322167003 0 -0.20318321718509652 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
1871 1870 P36578 SGQGAFGNMCR Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19649 (Experiment 1) 19649 43.094 592.750488 2+ 2+ 1183.4862613356702 0 0.13642395160463167 99.72972972972973 Confident
|
|
|
1872 1871 P46777 IEGDMIVCAAYAHELPK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39379 (Experiment 1) 39379 66.87 639.981018 3+ 3+ 1915.9172054746707 1 0.34617415201834345 92.99363057324841 Doubtful
|
|
|
1873 1872 C9J202, Q9BT22 AVTVYDKPASFFK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35785 (Experiment 1) 35785 62.448 776.874634 2+ 2+ 1551.7374467317406 0 -1.758108993810742 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.38219895287958) Y5 1 0 98.94179894179894 Confident
|
|
|
1874 1873 P06744 NLVTEDVMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30464 (Experiment 1) 30464 56.264 538.774109 2+ 2+ 1075.5331944447503 0 0.4367524563312649 100.0 Confident
|
|
|
1875 1874 P15880 GTGIVSAPVPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21278 (Experiment 1) 21278 45.121 513.303284 2+ 2+ 1024.5916952970401 0 0.3114819690587707 100.0 Confident
|
|
|
1876 1875 P50990 LFVTNDAATILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42340 (Experiment 1) 42340 71.257 667.379211 2+ 2+ 1332.7401504358804 0 2.786002915856951 100.0 Confident
|
|
|
1877 1876 P14625 IYFMAGSSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34398 (Experiment 1) 34398 60.824 556.236633 2+ 2+ 1110.4569318775302 0 1.601109664307884 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
1878 1877 P13796 EGICAIGGTSEQSSVGTQHSYSEEEK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22485 (Experiment 1) 22485 46.836 924.07605 3+ 3+ 2769.2035465368003 0 1.0006627843310218 100.0 Confident
|
|
|
1879 1878 P07900 DNSTMGYMAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21757 (Experiment 1) 21757 45.892 594.754517 2+ 2+ 1187.4950946838703 0 -0.5158575180670829 100.0 Confident
|
|
|
1880 1879 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44699 (Experiment 1) 44699 75.892 625.279297 2+ 2+ 1248.5427696764702 0 1.0166586390799115 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
1881 1880 P37837 LSSTWEGIQAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29722 (Experiment 1) 29722 55.406 638.829224 2+ 2+ 1275.6459156978704 0 -1.5815089722173148 100.0 Confident
|
|
|
1882 1881 O43390 ENILEEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43696 (Experiment 1) 43696 73.585 554.779907 2+ 2+ 1107.5448046742704 0 0.4113273456753787 100.0 Confident
|
|
|
1883 1882 P09651, P22626, P51991, Q13151, Q32P51 KIFVGGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18952 (Experiment 1) 18952 42.235 431.281036 2+ 2+ 860.5483739330803 0 -0.991077494294655 93.15789473684211 Confident
|
|
|
1884 1883 P61353 YSVDIPLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35023 (Experiment 1) 35023 61.551 525.278687 2+ 2+ 1048.5440763982801 0 -1.1949184645714848 100.0 Confident
|
|
|
1885 1884 P61978 GSDFDCELR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24058 (Experiment 1) 24058 48.785 549.729858 2+ 2+ 1097.44477336317 0 0.35444986145658763 100.0 Confident
|
|
|
1886 1885 P10809 GYISPYFINTSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42034 (Experiment 1) 42034 70.761 735.340027 2+ 2+ 1468.6639474383103 0 1.0564022422992396 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 23.671064608583478) Phosphorylation of Y (2: 9.598603839441536) 0 Y2-{Y2 Y6} 1 100.0 Confident
|
|
|
1887 1886 Q9ULW0 AQPVPHYGVPFKPQIPEAR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32284 (Experiment 1) 32284 58.38 737.710083 3+ 3+ 2210.1037739819203 0 2.0991206448680373 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1888 1887 P50914 VAYVSFGPHAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23918 (Experiment 1) 23918 48.613 438.207611 3+ 3+ 1311.6012876121004 0 -0.21604103309227293 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
1889 1888 P62805 RISGLIYEETR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28923 (Experiment 1) 28923 54.489 472.901276 3+ 3+ 1415.6809944847805 0 0.7077696375322452 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
1890 1889 P26599 GQPIYIQFSNHK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31650 (Experiment 1) 31650 57.652 504.573608 3+ 3+ 1510.6969789020904 0 1.3316194939885697 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1891 1890 P55209, Q99733 FYEEVHDLER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26079 (Experiment 1) 26079 51.164 472.865845 3+ 3+ 1415.5758607099003 0 -0.10934060975685986 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.28057553956835 Confident
|
|
|
1892 1891 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34753 (Experiment 1) 34753 61.231 630.796997 2+ 2+ 1259.5798834611805 0 -0.3506632495040093 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1893 1892 P06753 KLVIIEGDLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30545 (Experiment 1) 30545 56.358 428.921844 3+ 3+ 1283.7449014631502 0 -0.9316868064068755 100.0 Confident
|
|
|
1894 1893 O00231 VVDSLYNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17438 (Experiment 1) 17438 40.206 469.25293 2+ 2+ 936.4916469026002 0 -0.3621033342307182 99.7289972899729 Confident
|
|
|
1895 1894 P06753 AADAEAEVASLNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21496 (Experiment 1) 21496 45.459 658.82489 2+ 2+ 1315.6368075661503 0 -1.1994825200888852 99.1869918699187 Confident
|
|
|
1896 1895 O75347 LEAAYLDLQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36012 (Experiment 1) 36012 62.727 596.32312 2+ 2+ 1190.62953735774 0 1.8024728864187134 99.46666666666667 Confident
|
|
|
1897 1896 O60496 GQEGEYAVPFDAVAR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39952 (Experiment 1) 39952 67.674 844.869019 2+ 2+ 1687.7243158487404 0 -0.4916631675593433 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 95.47657512116317) Y6 1 0 99.22279792746113 Confident
|
|
|
1898 1897 P11142 FDDAVVQSDMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26607 (Experiment 1) 26607 51.77 627.786926 2+ 2+ 1253.5598031154102 0 -0.4014489718855466 100.0 Confident
|
|
|
1899 1898 Q00610 LASTLVHLGEYQAAVDGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37625 (Experiment 1) 37625 64.685 657.681396 3+ 3+ 1970.0221389254104 0 0.11133768776892321 100.0 Confident
|
|
|
1900 1899 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32900 (Experiment 1) 32900 59.083 622.26709 3+ 3+ 1863.7750310922602 0 2.362071309108435 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 68.84816753926702) 0 Y6-{Y6 Y11} 1 99.26470588235294 Confident
|
|
|
1901 1900 P23528 HELQANCYEEVKDR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14077 (Experiment 1) 14077 35.409 448.45871 4+ 4+ 1789.8053465265702 0 0.2160768967048149 100.0 Doubtful
|
|
|
1902 1901 P30041 LSILYPATTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36288 (Experiment 1) 36288 63.084 596.340088 2+ 2+ 1190.6659228664603 0 -0.25136664046414436 97.911227154047 Confident
|
|
|
1903 1902 P15311, P26038, P35241 APDFVFYAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42855 (Experiment 1) 42855 72.171 591.801392 2+ 2+ 1181.5869442697701 0 1.0871873757300126 100.0 Confident
|
|
|
1904 1903 O75874 ATDFVVPGPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28166 (Experiment 1) 28166 53.602 544.292969 2+ 2+ 1086.5709598524602 0 0.3906114040750467 100.0 Confident
|
|
|
1905 1904 P62805 ISGLIYEETR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31228 (Experiment 1) 31228 57.152 590.814819 2+ 2+ 1179.6135529404305 0 1.2966228019146215 100.0 Confident
|
|
|
1906 1905 P22626 TLETVPLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26733 (Experiment 1) 26733 51.915 529.297058 2+ 2+ 1056.5815245361603 0 -1.8528972723073496 99.73684210526315 Confident
|
|
|
1907 1906 Q6UXN9 YTHAANTVVYSSNK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11526 (Experiment 1) 11526 31.353 817.865173 2+ 2+ 1633.7137511650405 0 1.2483132621987956 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 12.992178784560455) Phosphorylation of Y (10: 99.65095986038395) 0 Y10-{Y1 Y10} 1 99.45799457994579 Confident
|
|
|
1908 1907 P62805 DAVTYTEHAKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8742 (Experiment 1) 8742 26.092 457.541321 3+ 3+ 1369.6027441640804 0 -0.44481537641335434 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
1909 1908 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44810 (Experiment 1) 44810 76.144 625.278748 2+ 2+ 1248.5427696764702 0 0.13865010613878317 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
1910 1909 Q96AP0 GLLLRPRPAKELPLPRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11751 (Experiment 1) 11751 31.711 489.569611 3+ 4+ 1953.2363696568002 1 4.911770156832274 100.0 Doubtful
|
|
|
1911 1910 P05387 ILDSVGIEADDDRLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29793 (Experiment 1) 29793 55.488 591.639099 3+ 3+ 1771.8952070767903 0 0.1467802542172175 100.0 Confident
|
|
|
1912 1911 P21281 KDHADVSNQLYACYAIGK Phosphorylation of Y(11) Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27483 (Experiment 1) 27483 52.792 711.654541 3+ 3+ 2131.9398050015807 0 0.931444364693098 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 5.529825963312794) Phosphorylation of Y (11: 15.560050769474854) 0 Y11-{Y11 Y14} 1 100.0 Confident
|
|
|
1913 1912 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44923 (Experiment 1) 44923 76.396 625.279053 2+ 2+ 1248.5427696764702 0 0.626432624399006 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
1914 1913 P09651 SESPKEPEQLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7931 (Experiment 1) 7931 24.301 476.588013 3+ 3+ 1426.7416069878602 0 0.42147651036178796 100.0 Confident
|
|
|
1915 1914 P63244 DETNYGIPQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22354 (Experiment 1) 22354 46.673 596.783325 2+ 2+ 1191.55201531303 0 0.06849500305579036 100.0 Confident
|
|
|
1916 1915 Q92945 HSVGVVIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14030 (Experiment 1) 14030 35.33 462.274719 2+ 2+ 922.53484912726 0 0.0388720342903522 96.51474530831099 Confident
|
|
|
1917 1916 P29692 ATAPQTQHVSPMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10551 (Experiment 1) 10551 29.684 475.241943 3+ 3+ 1422.7037820105002 0 0.1526163674701831 100.0 Confident
|
|
|
1918 1917 P50991 VIDPATATSVDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32600 (Experiment 1) 32600 58.744 679.368591 2+ 2+ 1356.72489429456 0 -1.6671542058602333 100.0 Confident
|
|
|
1919 1918 P31942, P31943, P55795 GLPFGCSK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25783 (Experiment 1) 25783 50.823 433.215057 2+ 2+ 864.41637378736 0 -0.9380101274019852 99.73333333333333 Confident
|
|
|
1920 1919 P60709, P63261 GYSFTTTAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22682 (Experiment 1) 22682 47.07 566.767334 2+ 2+ 1131.5196525555903 0 0.40802543352485876 100.0 Confident
|
|
|
1921 1920 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43157 (Experiment 1) 43157 72.709 586.326294 3+ 3+ 1755.9559568585505 0 0.6229419278816982 100.0 Confident
|
|
|
1922 1921 Q9Y224 EGLPVALDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30281 (Experiment 1) 30281 56.057 471.268738 2+ 2+ 940.5229470308802 0 -0.02542551800972113 99.73118279569893 Confident
|
|
|
1923 1922 P27105 VIAAEGEMNASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17480 (Experiment 1) 17480 40.266 624.306702 2+ 2+ 1246.5975856064601 0 1.0134932030512247 99.73118279569893 Confident
|
|
|
1924 1923 P43243 VIHLSNLPHSGYSDSAVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29786 (Experiment 1) 29786 55.481 510.024567 4+ 4+ 2036.0690891178306 0 0.03578990536157234 100.0 Doubtful
|
|
|
1925 1924 P51991 SSGSPYGGGYGSGGGSGGYGSR Phosphorylation of Y(19) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17008 (Experiment 1) 17008 39.601 995.883484 2+ 2+ 1989.7490270264398 0 1.7010251468031206 Phosphorylation of Y (19: Doubtfull) Phosphorylation of Y (19: 11.426346708140507) Phosphorylation of Y (6: 0.0) 0 Y19-{Y6 Y10 Y19} 1 100.0 Confident
|
|
|
1926 1925 P00492 SIPMTVDFIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44269 (Experiment 1) 44269 74.765 589.815735 2+ 2+ 1177.6165301458902 0 0.3280012634481655 99.7289972899729 Confident
|
|
|
1927 1926 P10696 VQHASPAGAYAHTVNR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8882 (Experiment 1) 8882 26.407 586.941467 3+ 3+ 1757.7998808308407 0 1.52813240971911 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
1928 1927 P68104, Q5VTE0 YYVTIIDAPGHR Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34633 (Experiment 1) 34633 61.096 495.568848 3+ 3+ 1483.68607986522 0 -0.9183146518438181 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.0) 0 Y1-{Y1 Y2} 1 100.0 Confident
|
|
|
1929 1928 P25705 AVDSLVPIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33659 (Experiment 1) 33659 59.954 513.800598 2+ 2+ 1025.5869442697701 0 -0.29311303556980745 100.0 Confident
|
|
|
1930 1929 P22626 EESGKPGAHVTVKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4335 (Experiment 1) 4335 16.934 489.603302 3+ 3+ 1465.7888915334504 0 -0.5548256659736568 99.28057553956835 Confident
|
|
|
1931 1930 Q9NR30 TAITVEHLAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27021 (Experiment 1) 27021 52.252 399.239777 3+ 3+ 1194.6972229947403 0 0.23261283451810907 94.8905109489051 Confident
|
|
|
1932 1931 P49368 TAVETAVLLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45144 (Experiment 1) 45144 76.902 593.363281 2+ 2+ 1184.7128730588802 0 -0.7280462938166269 99.7289972899729 Confident
|
|
|
1933 1932 Q15785 NGQYAEASALYGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27271 (Experiment 1) 27271 52.542 740.316711 2+ 2+ 1478.6191225042103 0 -0.17116849259972386 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 20.07335466941329) Phosphorylation of Y (4: 100.0) 0 Y4-{Y4 Y11} 1 100.0 Confident
|
|
|
1934 1933 P54819 NLETPLCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22566 (Experiment 1) 22566 46.932 487.75235 2+ 2+ 973.4902670036101 0 -0.12294888928497014 99.45799457994579 Confident
|
|
|
1935 1934 P30086 LYEQLSGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17163 (Experiment 1) 17163 39.81 509.236755 2+ 2+ 1016.4579774233503 0 0.9618747650603285 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
1936 1935 O43809 LPGGELNPGEDEVEGLKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30115 (Experiment 1) 30115 55.863 636.992981 3+ 3+ 1907.9588699625106 0 -0.9190898407781812 100.0 Confident
|
|
|
1937 1936 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27885 (Experiment 1) 27885 53.27 528.26123 2+ 2+ 1054.5100129962104 0 -1.993261588590273 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
1938 1937 P51858 IDEMPEAAVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22234 (Experiment 1) 22234 46.527 551.776794 2+ 2+ 1101.5376111188505 0 1.2903309619299101 99.18478260869566 Confident
|
|
|
1939 1938 P43243 SFQQSSLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14785 (Experiment 1) 14785 36.467 520.26239 2+ 2+ 1038.5094222250602 0 0.7734961757724413 99.45799457994579 Confident
|
|
|
1940 1939 P31946, P61981 YDDMAAAMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21327 (Experiment 1) 21327 45.186 508.21524 2+ 2+ 1014.4150534580203 0 0.8594873174087226 100.0 Confident
|
|
|
1941 1940 P50502, Q8NFI4 QDPSVLHTEEMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19490 (Experiment 1) 19490 42.899 481.229889 3+ 3+ 1440.6667277954402 0 0.7687282123458776 99.40119760479041 Confident
|
|
|
1942 1941 Q13404, Q15819 LLEELEEGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29469 (Experiment 1) 29469 55.114 594.31134 2+ 2+ 1186.6081332068204 0 -0.00516601667042475 100.0 Confident
|
|
|
1943 1942 Q15717 VLVDQTTGLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22707 (Experiment 1) 22707 47.099 594.833191 2+ 2+ 1187.6510010783102 0 0.6959838948026354 99.73474801061008 Confident
|
|
|
1944 1943 P09874 TLGDFAAEYAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36735 (Experiment 1) 36735 63.609 593.294006 2+ 2+ 1184.5713537752806 0 1.7742424575190299 100.0 Confident
|
|
|
1945 1944 Q9Y2W1 GSFSDTGLGDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20940 (Experiment 1) 20940 44.639 570.762878 2+ 2+ 1139.50948179471 0 1.5078715940819964 99.72972972972973 Confident
|
|
|
1946 1945 P00338 QVVESAYEVIK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31929 (Experiment 1) 31929 57.976 672.825439 2+ 2+ 1343.6373983373005 0 -0.7975843409741283 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1947 1946 P51570 HIQEHYGGTATFYLSQAADGAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32249 (Experiment 1) 32249 58.34 815.703857 3+ 3+ 2444.0798036317005 0 4.061117743902039 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 19.598659964886828) Phosphorylation of Y (6: 0.0) 0 Y6-{Y6 Y13} 1 100.0 Confident
|
|
|
1948 1947 Q92841 LIDFLESGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42066 (Experiment 1) 42066 70.811 511.282349 2+ 2+ 1020.5491617787202 0 0.9615905999457967 100.0 Confident
|
|
|
1949 1948 P61160 DLMVGDEASELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36249 (Experiment 1) 36249 63.038 667.816345 2+ 2+ 1333.6183806206905 0 -0.18235123481486407 100.0 Confident
|
|
|
1950 1949 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43470 (Experiment 1) 43470 73.217 586.326294 3+ 3+ 1755.9559568585505 0 0.6229419278816982 100.0 Confident
|
|
|
1951 1950 P62333 HGEIDYEAIVK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28602 (Experiment 1) 28602 54.113 677.308838 2+ 2+ 1352.6013471817505 0 1.3109875834764197 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.67689822294022) Y6 1 0 99.45652173913044 Confident
|
|
|
1952 1951 Q6PI48 FYSLPQSPQQFK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37230 (Experiment 1) 37230 64.201 775.360657 2+ 2+ 1548.7013955761904 0 3.460008385479403 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 94.9389179755672) Y2 1 0 98.91598915989161 Confident
|
|
|
1953 1952 P62280 VLLGETGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17174 (Experiment 1) 17174 39.83 408.744598 2+ 2+ 815.4752685624701 0 -0.7651423633289135 98.91891891891892 Confident
|
|
|
1954 1953 P42766 VLTVINQTQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20760 (Experiment 1) 20760 44.428 572.340332 2+ 2+ 1142.6659228664603 0 0.1644126195340218 100.0 Confident
|
|
|
1955 1954 P55769 QQIQSIQQSIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26498 (Experiment 1) 26498 51.647 729.389221 2+ 2+ 1456.7634050616002 0 0.33178783173878296 99.47368421052632 Confident
|
|
|
1956 1955 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30764 (Experiment 1) 30764 56.61 609.260254 2+ 2+ 1216.5053215385904 0 0.519915841209661 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 8: 0.0) Phosphorylation of Y (6: 0.8726003490401396) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1957 1956 P46783, Q9NQ39 KAEAGAGSATEFQFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24118 (Experiment 1) 24118 48.863 523.925842 3+ 3+ 1568.7583196811604 0 -1.6688603670633009 100.0 Confident
|
|
|
1958 1957 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19335 (Experiment 1) 19335 42.707 424.847015 3+ 3+ 1271.5183458337801 0 0.6824153532197419 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.12277867528272) Y5 1 0 92.46575342465754 Doubtful
|
|
|
1959 1958 P61158 YSYVCPDLVK Phosphorylation of Y(3) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32996 (Experiment 1) 32996 59.192 662.289917 2+ 2+ 1322.5617908688903 0 2.6349538113013002 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 12.61099850106637) Phosphorylation of Y (3: 0.1745200698080279) 0 Y3-{Y1 Y3} 1 99.73262032085562 Confident
|
|
|
1960 1959 Q13247 DKYGPPVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9928 (Experiment 1) 9928 28.425 506.236877 2+ 2+ 1010.4586461296901 0 0.5481001239909193 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 83.24607329842932) Y3 1 0 93.76693766937669 Confident
|
|
|
1961 1960 P04843 NIEIDSPYEISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36460 (Experiment 1) 36460 63.286 718.356812 2+ 2+ 1434.6990734695403 0 -0.0016726815978961352 99.7289972899729 Confident
|
|
|
1962 1961 P61254, Q9UNX3 FNPFVTSDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34764 (Experiment 1) 34764 61.245 541.767944 2+ 2+ 1081.5192586327703 0 1.916353309435014 99.45799457994579 Confident
|
|
|
1963 1962 P26038 LNKDQWEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13867 (Experiment 1) 13867 35.051 406.53479 3+ 3+ 1216.5836497944804 0 -0.909470263355214 94.02985074626866 Confident
|
|
|
1964 1963 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21464 (Experiment 1) 21464 45.394 759.858521 2+ 2+ 1517.7014551458406 0 0.680337990647784 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
1965 1964 P30101 LAPEYEAAATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19162 (Experiment 1) 19162 42.499 596.30481 2+ 2+ 1190.5931518490206 0 1.6059072463725463 96.19565217391303 Confident
|
|
|
1966 1965 P29401 AVELAANTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12215 (Experiment 1) 12215 32.48 458.758453 2+ 2+ 915.5025459394703 0 -0.21021198901172244 97.8891820580475 Confident
|
|
|
1967 1966 O14745 AGLLAGDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17783 (Experiment 1) 17783 40.659 386.719086 2+ 2+ 771.4239016959502 0 -0.3654196044333317 98.91598915989161 Confident
|
|
|
1968 1967 P18077 DETEFYLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35186 (Experiment 1) 35186 61.736 551.257568 2+ 2+ 1100.5026055091203 0 -1.8343866387310506 100.0 Confident
|
|
|
1969 1968 P62913 VLEQLTGQTPVFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37788 (Experiment 1) 37788 64.877 773.92395 2+ 2+ 1545.8402583999705 0 -4.465104571848945 100.0 Doubtful
|
|
|
1970 1969 P48735 TIEAEAAHGTVTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12966 (Experiment 1) 12966 33.685 452.569672 3+ 3+ 1354.6840921117405 0 2.2792033050964835 100.0 Confident
|
|
|
1971 1970 Q9Y230 VYSLFLDESR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42552 (Experiment 1) 42552 71.609 614.812805 2+ 2+ 1227.6135529404303 0 -2.029779607714072 100.0 Confident
|
|
|
1972 1971 O94903 IGSTIFGER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29944 (Experiment 1) 29944 55.665 490.265533 3+ 2+ 978.5134449763402 0 3.12901828648163 99.73684210526315 Confident
|
|
|
1973 1972 P06733 YISPDQLADLYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42372 (Experiment 1) 42372 71.301 753.347168 2+ 2+ 1504.6850768057104 0 -3.513466937974355 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 19.26171777773863) Phosphorylation of Y (11: 99.82547993019197) 0 Y11-{Y1 Y11} 1 99.73890339425587 Confident
|
|
|
1974 1973 P26599 LSLDGQNIYNACCTLR Phosphorylation of Y(9) Carbamidomethylation of C(12, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40138 (Experiment 1) 40138 67.915 989.433777 2+ 2+ 1976.8485474690306 0 2.250583855099543 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 99.7289972899729 Confident
|
|
|
1975 1974 P55084 TPFLLSGTSYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39036 (Experiment 1) 39036 66.401 607.325256 2+ 2+ 1212.6390394122802 0 -2.535987152095945 99.23469387755102 Confident
|
|
|
1976 1975 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33528 (Experiment 1) 33528 59.804 616.267334 2+ 2+ 1230.5209716027305 0 -0.6949384724032491 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.33452891645359) Phosphorylation of Y (8: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1977 1976 A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536 IIPGFMCQGGDFTR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42549 (Experiment 1) 42549 71.605 799.875916 2+ 2+ 1597.73811891389 0 -0.5249858487820637 100.0 Confident
|
|
|
1978 1977 P14866 NDQDTWDYTNPNLSGQGDPGSNPNKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28680 (Experiment 1) 28680 54.205 964.092957 3+ 3+ 2889.25500494604 0 0.704169635227554 100.0 Confident
|
|
|
1979 1978 P05141, P12235, P12236 GAWSNVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32767 (Experiment 1) 32767 58.934 451.745453 2+ 2+ 901.47699989797 0 -0.7159243403138316 99.75247524752476 Confident
|
|
|
1980 1979 Q15046 MLVVGGIDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31267 (Experiment 1) 31267 57.197 480.270477 2+ 2+ 958.5269868655 0 -0.6098633943568821 93.19371727748691 Confident
|
|
|
1981 1980 P62937, PPIA_HUMAN VSFELFADK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43865 (Experiment 1) 43865 73.902 528.274902 2+ 2+ 1054.5335117145803 0 1.6462590333066238 100.0 Confident
|
|
|
1982 1981 P62891, Q59GN2 QNRPIPQWIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28264 (Experiment 1) 28264 53.72 436.582703 3+ 3+ 1306.72583778442 0 0.33732844500118087 100.0 Confident
|
|
|
1983 1982 Q15102 LGYTPVCR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19761 (Experiment 1) 19761 43.241 483.24762 2+ 2+ 964.4800366730801 0 0.6729404415934779 93.6 Confident
|
|
|
1984 1983 P62316 EMWTEVPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30947 (Experiment 1) 30947 56.824 510.246368 2+ 2+ 1018.4793679667403 0 -1.1611047747270293 99.45945945945947 Confident
|
|
|
1985 1984 P55072 GVLFYGPPGCGK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35534 (Experiment 1) 35534 62.138 626.312683 2+ 2+ 1250.61177911862 0 -0.7712214085294009 98.65951742627345 Confident
|
|
|
1986 1985 P09651, P22626, P51991, Q32P51 LTDCVVMR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21506 (Experiment 1) 21506 45.473 497.246429 2+ 2+ 992.4783224209202 0 -0.01745064707251732 98.6449864498645 Confident
|
|
|
1987 1986 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28998 (Experiment 1) 28998 54.574 609.260498 2+ 2+ 1216.5053215385904 0 0.9204017176637955 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.33452891645359) Phosphorylation of Y (6: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
1988 1987 O43670 ETIDAVPNAIPGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30862 (Experiment 1) 30862 56.722 676.861023 2+ 2+ 1351.70957858359 0 -1.5405777037378294 99.73684210526315 Confident
|
|
|
1989 1988 P50995 DAQELYAAGENR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19814 (Experiment 1) 19814 43.305 708.793579 2+ 2+ 1415.5718379586206 0 0.5411365122192034 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
1990 1989 P07195 IVADKDYSVTANSK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12356 (Experiment 1) 12356 32.73 795.875488 2+ 2+ 1589.7338179032806 0 1.6366676687083344 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
1991 1990 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28123 (Experiment 1) 28123 53.543 528.261902 2+ 2+ 1054.5100129962104 0 -0.7211662267237998 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
1992 1991 Q07955 DGYDYDGYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23985 (Experiment 1) 23985 48.696 562.220459 2+ 2+ 1122.4254178175802 0 0.8424182885013641 100.0 Confident
|
|
|
1993 1992 P11142, P54652 IINEPTAAAIAYGLDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37795 (Experiment 1) 37795 64.885 596.668274 3+ 3+ 1786.9828998823805 0 0.05179717237800596 100.0 Confident
|
|
|
1994 1993 P46781 LDYILGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42468 (Experiment 1) 42468 71.441 467.783417 2+ 2+ 933.5535188831702 0 -1.32306438351365 99.72826086956522 Confident
|
|
|
1995 1994 Q06830 DISLSDYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29711 (Experiment 1) 29711 55.394 470.734558 2+ 2+ 939.4549270407103 0 -0.3866023721632433 99.74293059125964 Confident
|
|
|
1996 1995 Q5SSJ5 EASYSLIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24931 (Experiment 1) 24931 49.827 509.733887 2+ 2+ 1017.45322639608 0 -0.005227927835801535 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 88.1326352530541) Y4 1 0 93.08510638297872 Confident
|
|
|
1997 1996 O95399, P11021 LTPEEIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20422 (Experiment 1) 20422 44.033 493.762024 2+ 2+ 985.5080252427301 0 1.488394977927856 98.74055415617129 Confident
|
|
|
1998 1997 P49321 SIEVIENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20479 (Experiment 1) 20479 44.106 480.258911 2+ 2+ 958.5083595959004 0 -5.299748145403132 99.45799457994579 Doubtful
|
|
|
1999 1998 P25685 VSLEEIYSGCTKK Phosphorylation of Y(7) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26857 (Experiment 1) 26857 52.06 797.363342 2+ 2+ 1592.7157253109904 0 -2.253826031627781 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
2000 1999 P22087 NLVPGESVYGEKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20764 (Experiment 1) 20764 44.432 509.911987 3+ 3+ 1526.7130228890503 0 0.724772997146633 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 100.0 Confident
|
|
|
2001 2000 Q9UBB6 LQAGEETASHYR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10931 (Experiment 1) 10931 30.38 721.308228 2+ 2+ 1440.6034724400704 0 -1.0878650252262532 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 85.51483420593368) Y11 1 0 94.93333333333334 Confident
|
|
|
2002 2001 Q14444 SFMALSQDIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37065 (Experiment 1) 37065 64.008 634.321533 2+ 2+ 1266.6278231055803 0 0.54385759821438 100.0 Confident
|
|
|
2003 2002 P63244 LTRDETNYGIPQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16886 (Experiment 1) 16886 39.438 548.258423 3+ 3+ 1641.7511993029202 0 1.3620703918212391 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
2004 2003 P61088, Q5JXB2 IYHPNVDK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9931 (Experiment 1) 9931 28.429 533.241943 2+ 2+ 1064.4692108133902 0 0.11463183013512776 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.30191972076788) Y2 1 0 99.75247524752476 Confident
|
|
|
2005 2004 P30101 YGVSGYPTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28786 (Experiment 1) 28786 54.333 542.78595 2+ 2+ 1083.5600608155903 0 -2.4998274463726826 100.0 Confident
|
|
|
2006 2005 Q14444 YQEVTNNLEFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30841 (Experiment 1) 30841 56.698 728.360229 2+ 2+ 1454.7041588499806 0 1.198732727999409 99.46091644204851 Confident
|
|
|
2007 2006 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19602 (Experiment 1) 19602 43.033 514.763672 2+ 2+ 1027.5120650773501 0 0.7051678053726937 100.0 Confident
|
|
|
2008 2007 Q92688 KLELSENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11357 (Experiment 1) 11357 31.104 494.774719 2+ 2+ 987.5349086969104 0 -0.023880094155325562 99.73684210526315 Confident
|
|
|
2009 2008 P06748 ADKDYHFKVDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21425 (Experiment 1) 21425 45.331 515.446777 5+ 5+ 2572.1942426127903 0 1.264944284951813 100.0 Doubtful
|
|
|
2010 2009 P61626 STDYGIFQINSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42256 (Experiment 1) 42256 71.124 740.828674 2+ 2+ 1479.6395235956202 0 2.2079855260807855 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.73474801061008 Confident
|
|
|
2011 2010 O43684 LYDVPANSMR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24854 (Experiment 1) 24854 49.737 623.26947 2+ 2+ 1244.5260740665103 0 -1.353345489117525 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 72.53634894991923) Y2 1 0 92.42819843342036 Confident
|
|
|
2012 2011 O60256 VQVYQEPNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12303 (Experiment 1) 12303 32.642 606.77417 2+ 2+ 1211.5336019751003 0 0.15252075072315807 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
2013 2012 P56381, Q5VTU8 DALKTEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16548 (Experiment 1) 16548 39.014 476.261597 2+ 2+ 950.5072969667403 0 1.41109585661572 96.24664879356568 Confident
|
|
|
2014 2013 P49411 GITINAAHVEYSTAAR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26984 (Experiment 1) 26984 52.209 877.414429 2+ 2+ 1752.8196132159105 0 -3.024872456314316 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.03069466882067) Y11 1 0 99.7289972899729 Confident
|
|
|
2015 2014 Q9BXJ9 LEDAADVYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19035 (Experiment 1) 19035 42.334 566.236572 2+ 2+ 1130.4645193557703 0 -5.234789356811952 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Doubtful
|
|
|
2016 2015 O43264 NCLVYSIPTNSSK Phosphorylation of Y(5) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31577 (Experiment 1) 31577 57.567 781.849487 2+ 2+ 1561.6847595358802 0 -0.21645434113465323 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2017 2016 P06576 IMDPNIVGSEHYDVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30429 (Experiment 1) 30429 56.225 605.963074 3+ 3+ 1814.8621331267004 0 2.8931840382164595 100.0 Confident
|
|
|
2018 2017 P25205 LIVNVNDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37277 (Experiment 1) 37277 64.255 528.314758 2+ 2+ 1054.6134933707801 0 1.3909299500691807 100.0 Confident
|
|
|
2019 2018 P78527 MYAALGDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21404 (Experiment 1) 21404 45.297 523.222717 2+ 2+ 1044.4351338037902 0 -4.063967401671437 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 94.66882067851373) Y2 1 0 99.21671018276761 Confident
|
|
|
2020 2019 Q13905 CFQQAHYDMRR Phosphorylation of Y(7) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40568 (Experiment 1) 40568 68.569 796.817322 2+ 2+ 1590.62211679301 1 -3.378400445353098 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.70759289176091) Y7 1 0 99.19354838709677 Confident
|
|
|
2021 2020 P09874 LTVNPGTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11170 (Experiment 1) 11170 30.821 415.243103 2+ 2+ 828.4705175352001 0 1.367310763806473 99.46091644204851 Confident
|
|
|
2022 2021 P54920 IEEACEIYAR Phosphorylation of Y(8) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22611 (Experiment 1) 22611 46.986 667.278198 2+ 2+ 1332.5421180534702 0 -0.20605126807263224 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 99.73614775725594 Confident
|
|
|
2023 2022 Q13263 DIVENYFMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44261 (Experiment 1) 44261 74.747 593.782471 2+ 2+ 1185.5488445088902 0 1.3006105518112197 93.76693766937669 Confident
|
|
|
2024 2023 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43294 (Experiment 1) 43294 72.963 586.327332 3+ 3+ 1755.9559568585505 0 2.3932883326564776 100.0 Confident
|
|
|
2025 2024 P26599 DYGNSPLHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13567 (Experiment 1) 13567 34.59 529.754028 2+ 2+ 1057.4941065140902 0 -0.5695543014493041 99.73544973544973 Confident
|
|
|
2026 2025 P27824 AEEDEILNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21429 (Experiment 1) 21429 45.339 544.764282 2+ 2+ 1087.5145671751502 0 -0.5104120340853495 100.0 Confident
|
|
|
2027 2026 P52565 TDYMVGSYGPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29187 (Experiment 1) 29187 54.79 663.265564 2+ 2+ 1324.51590330563 0 0.5064043141907587 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 13.100114832749988) Phosphorylation of Y (3: 100.0) 0 Y3-{Y3 Y8} 1 100.0 Confident
|
|
|
2028 2027 A6NIZ1, P01111, P01112, P01116, P61224, P62834 YDPTIEDSYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25272 (Experiment 1) 25272 50.224 629.782471 2+ 2+ 1257.5513466066902 0 -0.7602145427659713 100.0 Confident
|
|
|
2029 2028 Q8NC51 SSFSHYSGLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18515 (Experiment 1) 18515 41.686 596.755859 2+ 2+ 1191.4961538372202 0 0.8472727977457204 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.73890339425587 Confident
|
|
|
2030 2029 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44240 (Experiment 1) 44240 74.689 935.9328 2+ 2+ 1869.85097291384 0 0.03961424307490135 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2031 2030 Q96KP4 TVFGVEPDLTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37668 (Experiment 1) 37668 64.738 617.330994 2+ 2+ 1232.64010204144 0 5.939332837981827 99.73958333333334 Doubtful
|
|
|
2032 2031 P30086 VLTPTQVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15076 (Experiment 1) 15076 36.967 443.274017 2+ 2+ 884.5331177917603 0 0.4097632059445637 100.0 Confident
|
|
|
2033 2032 O00462 FQSAVLYAAQQSK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33185 (Experiment 1) 33185 59.408 760.863342 2+ 2+ 1519.7072092326205 0 3.2343848118165046 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
2034 2033 P11310 IYQIYEGTSQIQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31055 (Experiment 1) 31055 56.95 560.266479 3+ 3+ 1677.7763514216003 0 0.7473698971726344 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 18.118711502856215) Phosphorylation of Y (2: 0.0) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
2035 2034 P09651, P22626, P51991, Q13151, Q32P51 KIFVGGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20972 (Experiment 1) 20972 44.685 431.281494 2+ 2+ 860.5483739330803 0 0.07087401271267042 99.7289972899729 Confident
|
|
|
2036 2035 P61981 EHMQPTHPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6944 (Experiment 1) 6944 22.121 415.876709 3+ 3+ 1244.60842507368 0 -0.1021729920599671 97.87234042553192 Confident
|
|
|
2037 2036 P35579, P35749, Q7Z406 KEEELQAALAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20528 (Experiment 1) 20528 44.162 419.898621 3+ 3+ 1256.6724647988804 0 1.2453820668311628 100.0 Confident
|
|
|
2038 2037 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37407 (Experiment 1) 37407 64.415 964.379761 2+ 2+ 1926.7560694694905 0 -5.755170151215995 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 4.197843481395482) Phosphorylation of Y (14: 89.17609046849758) 0 Y14-{Y10 Y14} 1 90.86021505376344 Doubtful
|
|
|
2039 2038 Q12904 IGCIITAR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22658 (Experiment 1) 22658 47.042 452.256805 2+ 2+ 902.5007721176601 0 -1.8960997525516894 100.0 Confident
|
|
|
2040 2039 P62424 HWGGNVLGPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20161 (Experiment 1) 20161 43.742 532.785461 2+ 2+ 1063.5563128478302 0 0.052759086754759314 100.0 Confident
|
|
|
2041 2040 P22626 LTDCVVMRDPASKR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16544 (Experiment 1) 16544 39.009 412.713318 4+ 4+ 1646.8232455201803 0 0.5576589395873953 100.0 Doubtful
|
|
|
2042 2041 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18254 (Experiment 1) 18254 41.339 514.763306 2+ 2+ 1027.5120650773501 0 -0.005838580856008839 99.73333333333333 Confident
|
|
|
2043 2042 P28070 FQIATVTEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27881 (Experiment 1) 27881 53.265 518.787292 2+ 2+ 1035.5600608155903 0 -0.028671879686272717 100.0 Confident
|
|
|
2044 2043 P13693 DLISHDEMFSDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43604 (Experiment 1) 43604 73.43 598.256348 3+ 3+ 1791.7426683348203 0 2.5330703550821085 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 96.50959860383944) Y13 1 0 99.28571428571429 Confident
|
|
|
2045 2044 P54578 PLYSVTVK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23643 (Experiment 1) 23643 48.242 493.751038 2+ 2+ 985.4885492756403 0 -1.0391959902571848 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 98.64864864864865 Confident
|
|
|
2046 2045 P63244 LWNTLGVCK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34556 (Experiment 1) 34556 61.009 545.789917 2+ 2+ 1089.56410065021 0 1.0813844350815072 99.73333333333333 Confident
|
|
|
2047 2046 P78527 NELEIPGQYDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32001 (Experiment 1) 32001 58.06 695.833862 2+ 2+ 1389.65245763029 0 0.5126485577177755 99.7289972899729 Confident
|
|
|
2048 2047 P68104, Q05639, Q5VTE0 STTTGHLIYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13221 (Experiment 1) 13221 34.036 560.803772 2+ 2+ 1119.5924235730301 0 0.5059645290704318 100.0 Confident
|
|
|
2049 2048 P08559, P29803 LEEGPPVTTVLTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35267 (Experiment 1) 35267 61.831 706.392395 2+ 2+ 1410.7718444869802 0 -1.137766195457104 98.9247311827957 Confident
|
|
|
2050 2049 P22234 DQITAGNAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9798 (Experiment 1) 9798 28.21 508.759674 2+ 2+ 1015.5046711977902 0 0.12173586793282877 98.67724867724867 Confident
|
|
|
2051 2050 P36873, P62136, P62140 IYGFYDECK Phosphorylation of Y(2) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33447 (Experiment 1) 33447 59.709 637.744385 2+ 2+ 1273.4726415113203 0 1.2352574470257447 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 17.267902710535417) Phosphorylation of Y (2: 12.401756184478698) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
2052 2051 Q9Y2X3 TQLYEYLQNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37921 (Experiment 1) 37921 65.036 469.881561 3+ 3+ 1406.6231452554903 0 -0.20690027033495612 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 6: 0.0) Phosphorylation of Y (4: 6.457242582897034) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
2053 2052 P08708 IAGYVTHLMK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25871 (Experiment 1) 25871 50.924 606.796082 2+ 2+ 1211.5773813633803 0 0.189275314889659 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2054 2053 P25398 LVEALCAEHQINLIK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36682 (Experiment 1) 36682 63.547 584.321838 3+ 3+ 1749.9447405518501 0 -0.602380161994425 99.24812030075188 Confident
|
|
|
2055 2054 P15311, P26038, P35241 FVIKPIDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22654 (Experiment 1) 22654 47.037 480.300293 2+ 2+ 958.5851533646203 0 0.9157839108767473 99.7289972899729 Confident
|
|
|
2056 2055 P16401 KATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24163 (Experiment 1) 24163 48.917 670.891968 2+ 2+ 1339.7711162109902 0 -1.291670237742451 100.0 Confident
|
|
|
2057 2056 P24752 NEQDAYAINSYTR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26191 (Experiment 1) 26191 51.294 812.837524 2+ 2+ 1623.6566302117403 0 2.377390136249217 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 6.921055469795117) Phosphorylation of Y (6: 5.49738219895288) 0 Y11-{Y6 Y11} 1 100.0 Confident
|
|
|
2058 2057 P07814 LNLNNTVLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30034 (Experiment 1) 30034 55.768 558.324829 2+ 2+ 1114.6346227381803 0 0.4319424633438365 99.73045822102425 Confident
|
|
|
2059 2058 Q13905 CFQQAHYDMRR Phosphorylation of Y(7) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40564 (Experiment 1) 40564 68.563 796.820007 2+ 2+ 1590.62211679301 1 -0.006633298357669629 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.76898222940227) Y7 1 0 97.58064516129032 Confident
|
|
|
2060 2059 P62249 GGGHVAQIYAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21119 (Experiment 1) 21119 44.881 414.563202 3+ 3+ 1240.6676542019602 0 0.09841492220424766 99.25925925925925 Confident
|
|
|
2061 2060 O00629 IEQLQNHENEDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18701 (Experiment 1) 18701 41.923 926.90979 2+ 2+ 1851.8040227214206 0 0.5417708985010009 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 85.16579406631763) Y13 1 0 94.86486486486486 Confident
|
|
|
2062 2061 P08238, Q58FF7 DNSTMGYMMAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31414 (Experiment 1) 31414 57.37 664.741211 2+ 2+ 1327.4647963329003 0 2.3112306914090444 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 99.73474801061008 Confident
|
|
|
2063 2062 O43390, O60506 AGPIWDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40391 (Experiment 1) 40391 68.318 464.256592 2+ 2+ 926.4974009893799 0 1.3247831554529805 98.69451697127938 Confident
|
|
|
2064 2063 Q9NUU7, Q9UMR2 LKPQLLQGVYAMGFNRPSK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41891 (Experiment 1) 41891 70.493 557.541626 4+ 4+ 2226.1384452384805 0 -0.46951886123474024 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Doubtful
|
|
|
2065 2064 Q9UBT2 ESVLQFYPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38869 (Experiment 1) 38869 66.198 555.795105 2+ 2+ 1109.5757108797302 0 -0.048411142146793484 99.7289972899729 Confident
|
|
|
2066 2065 Q08211 NFLYAWCGK Phosphorylation of Y(4) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46249 (Experiment 1) 46249 79.188 619.757507 2+ 2+ 1237.4991310426801 0 1.0730205829867145 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.50959860383944) Y4 1 0 99.7289972899729 Confident
|
|
|
2067 2066 P13725 AGRGASQPPTPTPASDAFQRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38294 (Experiment 1) 38294 65.5 1071.052124 2+ 2+ 2139.08211341302 1 1.9741357885310566 99.1869918699187 Confident
|
|
|
2068 2067 P13796 VYALPEDLVEVNPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44842 (Experiment 1) 44842 76.216 833.410767 2+ 2+ 1664.8062545675507 0 0.43585898485228547 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2069 2068 P61978 NLPLPPPPPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29754 (Experiment 1) 29754 55.444 597.85321 2+ 2+ 1193.6920780446499 0 -0.17644652004117548 99.1869918699187 Confident
|
|
|
2070 2069 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30468 (Experiment 1) 30468 56.268 528.76001 2+ 2+ 1054.5100129962104 1 -7.4780728148843165 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 99.45799457994579 Doubtful
|
|
|
2071 2070 P00338 VHPVSTMIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14034 (Experiment 1) 14034 35.335 506.286774 2+ 2+ 1010.5582869937803 0 0.6992806520819133 99.45652173913044 Confident
|
|
|
2072 2071 P37837 VSTEVDAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8843 (Experiment 1) 8843 26.333 438.725098 2+ 2+ 875.4348603024703 0 0.8920900669713668 98.6522911051213 Confident
|
|
|
2073 2072 O14818, Q8TAA3 ALLEVVQSGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30796 (Experiment 1) 30796 56.646 550.819641 2+ 2+ 1099.6237237013102 0 0.9126090542757184 100.0 Confident
|
|
|
2074 2073 A0FGR8 VDVGQQPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17396 (Experiment 1) 17396 40.148 506.282471 2+ 2+ 1010.5508931142201 0 -0.4977928548005525 99.72826086956522 Confident
|
|
|
2075 2074 Q9P258 TVVSGSCAAHSLLITTEGK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31104 (Experiment 1) 31104 57.008 644.335815 3+ 3+ 1929.9829765353704 0 1.3652652002938803 100.0 Confident
|
|
|
2076 2075 ALDOA_RABIT, P04075 IGEHTPSALAIMENANVLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45091 (Experiment 1) 45091 76.763 703.037842 3+ 3+ 2106.0891729394107 0 1.1965516041062116 100.0 Confident
|
|
|
2077 2076 P27695 VSYGIGDEEHDQEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17569 (Experiment 1) 17569 40.379 564.248474 3+ 3+ 1689.7230563712503 0 0.3167803478658401 100.0 Confident
|
|
|
2078 2077 P30084 AFAAGADIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19198 (Experiment 1) 19198 42.546 432.23468 2+ 2+ 862.4548674710602 0 -0.06987486501866623 96.19565217391303 Confident
|
|
|
2079 2078 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33899 (Experiment 1) 33899 60.23 652.026184 3+ 3+ 1953.0571274518006 0 -0.2069713165101806 100.0 Confident
|
|
|
2080 2079 P16035 KEYLIAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13779 (Experiment 1) 13779 34.913 501.256805 2+ 2+ 1000.4994483125104 0 -0.39026500759798155 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 98.91891891891892 Confident
|
|
|
2081 2080 Q99714 GGIVGMTLPIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43196 (Experiment 1) 43196 72.782 592.844482 2+ 2+ 1183.67471372835 0 -0.25526247287888537 99.73262032085562 Confident
|
|
|
2082 2081 P37108 ISTVVSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10629 (Experiment 1) 10629 29.826 410.742401 2+ 2+ 819.4701831820303 0 0.08020154588645799 99.7340425531915 Confident
|
|
|
2083 2082 P22314 LQTSSVLVSGLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34845 (Experiment 1) 34845 61.341 630.369751 2+ 2+ 1258.72450037174 0 0.35589810159590946 99.73890339425587 Confident
|
|
|
2084 2083 P12955 AVYEAVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27412 (Experiment 1) 27412 52.708 460.763641 2+ 2+ 919.5127167003502 0 0.01341905583539538 96.22641509433963 Confident
|
|
|
2085 2084 P49321 SGNVAELALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27487 (Experiment 1) 27487 52.797 501.285065 2+ 2+ 1000.5553097883203 0 0.26659294845030207 99.74226804123711 Confident
|
|
|
2086 2085 Q13242 FEDPRDAEDAIYGR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30242 (Experiment 1) 30242 56.011 578.5755 3+ 3+ 1732.7093940605903 0 -2.7213090150878396 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 99.82547993019197) Y12 1 0 100.0 Confident
|
|
|
2087 2086 P14618 GIFPVLCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41687 (Experiment 1) 41687 70.202 467.264771 2+ 2+ 932.5153595526401 0 -0.3964413113973674 96.52406417112299 Confident
|
|
|
2088 2087 P62263 VKADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33397 (Experiment 1) 33397 59.65 858.068237 3+ 3+ 2571.1788660499706 0 1.5599209495546664 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
2089 2088 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36044 (Experiment 1) 36044 62.771 964.385925 2+ 2+ 1926.7560694694905 0 0.6364659805419387 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 7.759123926083362) Phosphorylation of Y (10: 33.21334635162652) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
2090 2089 Q8WX92 NVHYCTLR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11667 (Experiment 1) 11667 31.573 571.745911 2+ 2+ 1141.4739789240002 0 2.8772849783157044 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 91.44851657940663) Y4 1 0 92.11956521739131 Confident
|
|
|
2091 2090 P35232 IFTSIGEDYDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33820 (Experiment 1) 33820 60.138 722.834045 2+ 2+ 1443.65178892395 0 1.2092295262225028 100.0 Confident
|
|
|
2092 2091 P33241 DIVAGDMSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18466 (Experiment 1) 18466 41.623 468.22818 2+ 2+ 934.4429824580202 0 -1.255146762853549 94.3089430894309 Confident
|
|
|
2093 2092 P11142 SFYPEEVSSMVLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44966 (Experiment 1) 44966 76.477 808.897644 2+ 2+ 1615.7803605653505 0 0.2314885664663349 98.91304347826086 Confident
|
|
|
2094 2093 P50552 VQIYHNPTANSFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22960 (Experiment 1) 22960 47.396 542.918884 3+ 3+ 1625.7351553159604 0 -0.20427626663132673 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2095 2094 P14174 PMFIVNTNVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38343 (Experiment 1) 38343 65.562 644.34906 2+ 2+ 1286.6805273847801 0 2.3587283308215867 100.0 Confident
|
|
|
2096 2095 O00487 HYYSITINYR Phosphorylation of Y(2, 3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32816 (Experiment 1) 32816 58.989 497.201813 3+ 3+ 1488.5839964729803 0 -0.2593670590303274 Phosphorylation of Y (2: Confident, 3: Confident) Phosphorylation of Y (2: 100.0, 3: 100.0) Y2, Y3 2 0 100.0 Confident
|
|
|
2097 2096 P29350 DSNIPGSDYINANYIK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42154 (Experiment 1) 42154 70.969 932.411072 2+ 2+ 1862.8087737486903 0 -0.6342060921111592 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 6.216338154907346) Phosphorylation of Y (9: 81.50087260034904) 0 Y14-{Y9 Y14} 1 95.23809523809523 Confident
|
|
|
2098 2097 B2RXH8, B7ZW38, O60812, P07910 QKVDSLLENLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36168 (Experiment 1) 36168 62.941 472.596863 3+ 3+ 1414.7667591065403 0 1.4109952921676308 99.24812030075188 Confident
|
|
|
2099 2098 Q01469 FEETTADGRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6891 (Experiment 1) 6891 22.01 577.275391 2+ 2+ 1152.5411162761602 0 -4.232978897997727 99.72826086956522 Doubtful
|
|
|
2100 2099 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13137 (Experiment 1) 13137 33.921 411.954346 4+ 4+ 1643.7903480854304 0 -1.2561768666913131 100.0 Doubtful
|
|
|
2101 2100 P52272 MGPLGLDHMASSIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37548 (Experiment 1) 37548 64.59 538.597778 3+ 3+ 1612.7701473181603 0 0.8400099908364228 100.0 Confident
|
|
|
2102 2101 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26635 (Experiment 1) 26635 51.803 565.215881 2+ 2+ 1128.4165065341901 0 0.6214728264565701 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 25.354249434789267) Phosphorylation of Y (6: 99.82547993019197) 0 Y6-{Y2 Y6} 1 99.72826086956522 Confident
|
|
|
2103 2102 P15259, P18669, Q8N0Y7 HYGGLTGLNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17086 (Experiment 1) 17086 39.71 570.265808 2+ 2+ 1138.5172236349702 0 -0.14078397253739716 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2104 2103 P22626 LTDCVVMRDPASKR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16491 (Experiment 1) 16491 38.947 549.947388 3+ 3+ 1646.8232455201803 0 -1.7643599756862152 100.0 Confident
|
|
|
2105 2104 Q15397 TNYDIVVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24505 (Experiment 1) 24505 49.335 530.247559 2+ 2+ 1058.4797754970903 0 0.7445294750534355 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.65095986038395) Y3 1 0 99.72826086956522 Confident
|
|
|
2106 2105 Q15365 LVVPATQCGSLIGK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33238 (Experiment 1) 33238 59.468 721.904724 2+ 2+ 1441.79628541301 0 -0.9629700770530154 100.0 Confident
|
|
|
2107 2106 Q14204 TLMAQSIYGGR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28782 (Experiment 1) 28782 54.327 638.791138 2+ 2+ 1275.56827323166 0 -0.43062983688559553 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 99.73045822102425 Confident
|
|
|
2108 2107 P62906 DTLYEAVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25188 (Experiment 1) 25188 50.127 523.731384 2+ 2+ 1045.4481410156402 0 0.07069534425950588 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
2109 2108 P26038 ALELEQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20214 (Experiment 1) 20214 43.802 494.256714 2+ 2+ 986.5032742154601 0 -4.450247596194233 99.74293059125964 Doubtful
|
|
|
2110 2109 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 QVHPDTGISSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8075 (Experiment 1) 8075 24.594 584.802002 2+ 2+ 1167.5884008217504 0 0.8979497034707764 100.0 Confident
|
|
|
2111 2110 P13073 SEDFSLPAYMDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42305 (Experiment 1) 42305 71.205 715.816284 2+ 2+ 1429.6183806206902 0 -0.2553408110537431 96.49595687331536 Confident
|
|
|
2112 2111 Q14204 QYASYEFVQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31573 (Experiment 1) 31573 57.563 685.793335 2+ 2+ 1369.5703814066403 0 1.2654409449999175 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 26.721827155411724) Phosphorylation of Y (2: 21.98952879581152) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
2113 2112 P08865 KSDGIYIINLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35481 (Experiment 1) 35481 62.077 421.914398 3+ 3+ 1262.7234377425802 0 -1.6378832851217262 97.74436090225565 Confident
|
|
|
2114 2113 P06576 FTQAGSEVSALLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41848 (Experiment 1) 41848 70.439 718.381348 2+ 2+ 1434.7466923683003 0 1.0097001713614495 99.48186528497409 Confident
|
|
|
2115 2114 P42704 VIQALAMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25599 (Experiment 1) 25599 50.612 437.264618 2+ 2+ 872.5153595526403 0 -0.7735427395199046 99.45652173913044 Confident
|
|
|
2116 2115 P62312 GNNVLYISTQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31655 (Experiment 1) 31655 57.658 658.816833 2+ 2+ 1315.6173315990602 0 1.3520220150312963 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
2117 2116 P23526 IILLAEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33027 (Experiment 1) 33027 59.227 442.782196 2+ 2+ 883.54910220907 0 0.8320771767884166 99.45799457994579 Confident
|
|
|
2118 2117 Q9Y490 TSTPEDFIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30042 (Experiment 1) 30042 55.778 533.262024 2+ 2+ 1064.5138388991602 0 -4.072871212437724 100.0 Confident
|
|
|
2119 2118 Q86UE4 SQEPIPDDQKVSDDDKEKGEGALPTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17453 (Experiment 1) 17453 40.225 577.484253 5+ 5+ 2882.3781397704906 0 2.3352710175690796 100.0 Doubtful
|
|
|
2120 2119 P42704 LIASYCNVGDIEGASK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33438 (Experiment 1) 33438 59.698 848.909302 2+ 2+ 1695.8137859519502 0 -5.733727816487725 100.0 Doubtful
|
|
|
2121 2120 P49736 DTVDPVQDEMLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35178 (Experiment 1) 35178 61.727 744.851257 2+ 2+ 1487.6926081901104 0 -3.1194880817731723 100.0 Confident
|
|
|
2122 2121 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30649 (Experiment 1) 30649 56.478 528.262573 2+ 2+ 1054.5100129962104 0 0.5490361360970805 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.47643979057592) Y7 1 0 99.73190348525469 Confident
|
|
|
2123 2122 P19338 FGYVDFESAEDLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44513 (Experiment 1) 44513 75.439 824.874268 2+ 2+ 1647.7304331674707 0 2.151786448909352 100.0 Confident
|
|
|
2124 2123 P05141, P12235, P12236, Q9H0C2 GNLANVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23479 (Experiment 1) 23479 48.032 428.753723 2+ 2+ 855.4926499621101 0 0.2835011357158452 100.0 Confident
|
|
|
2125 2124 Q02790 GEHSIVYLKPSYAFGSVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38988 (Experiment 1) 38988 66.343 707.013977 3+ 3+ 2118.0187069452804 0 0.65753306422898 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 25.042367110267527) Phosphorylation of Y (7: 0.0) 0 Y7-{Y7 Y12} 1 100.0 Confident
|
|
|
2126 2125 Q05516 HQLETHYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5759 (Experiment 1) 5759 19.532 388.504303 3+ 3+ 1162.4920715162903 0 -0.8510552516162397 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Confident
|
|
|
2127 2126 P19338 ALVATPGKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8331 (Experiment 1) 8331 25.173 442.781647 2+ 2+ 883.5491022090703 0 -0.40781110657473646 98.91891891891892 Confident
|
|
|
2128 2127 P06744 VWYVSNIDGTHIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34394 (Experiment 1) 34394 60.819 534.946777 3+ 3+ 1601.8201916617304 0 -1.0531018904722433 99.28057553956835 Confident
|
|
|
2129 2128 P14550 GLEVTAYSPLGSSDR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37049 (Experiment 1) 37049 63.987 816.369202 2+ 2+ 1630.7239814955701 0 -0.07988369941906984 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
2130 2129 P15311, P26038, P35241 APDFVFYAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42709 (Experiment 1) 42709 71.915 591.80072 2+ 2+ 1181.5869442697701 0 -0.04832994424037069 100.0 Confident
|
|
|
2131 2130 P49368 TLIQNCGASTIR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21592 (Experiment 1) 21592 45.63 667.347717 2+ 2+ 1332.6819839367602 0 -0.8263079687877677 100.0 Confident
|
|
|
2132 2131 P06576 TIAMDGTEGLVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31736 (Experiment 1) 31736 57.752 631.82373 2+ 2+ 1261.6336367620102 0 -0.5774515726299527 100.0 Confident
|
|
|
2133 2132 P13798 SFNLSALEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38543 (Experiment 1) 38543 65.803 504.771454 2+ 2+ 1007.5287606873103 0 -0.4017865590606963 96.19565217391303 Confident
|
|
|
2134 2133 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 KLAVNMVPFPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35919 (Experiment 1) 35919 62.607 424.580933 3+ 3+ 1270.7219982739402 0 -0.8075991057517993 100.0 Confident
|
|
|
2135 2134 P07195 FIIPQIVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43722 (Experiment 1) 43722 73.626 479.309937 2+ 2+ 956.6058888092002 0 -0.5922498618196951 98.6449864498645 Confident
|
|
|
2136 2135 P62318 VLHEAEGHIVTCETNTGEVYR Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20302 (Experiment 1) 20302 43.9 604.290344 4+ 4+ 2413.1332225793603 0 -0.39403502089981934 100.0 Doubtful
|
|
|
2137 2136 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44176 (Experiment 1) 44176 74.529 936.434387 2+ 2+ 1869.85097291384 1 -0.05699408570039666 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2138 2137 P00519 SSTLTSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6292 (Experiment 1) 6292 20.671 419.71817 2+ 2+ 837.4192102383302 0 3.0697217087936703 99.45652173913044 Confident
|
|
|
2139 2138 P06733 IGAEVYHNLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18318 (Experiment 1) 18318 41.433 408.532013 3+ 3+ 1222.5747385110903 0 -0.43155434685564315 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
2140 2139 P08238, Q58FF8 SIYYITGESK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31210 (Experiment 1) 31210 57.133 620.777527 2+ 2+ 1239.5424353233002 0 -1.5579284259275925 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 1.9197207678883073) 0 Y3-{Y3 Y4} 1 99.74811083123426 Confident
|
|
|
2141 2140 P52597 HSGPNSADSANDGFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13351 (Experiment 1) 13351 34.24 544.245117 3+ 3+ 1629.7131603938901 0 0.22122737381356958 100.0 Confident
|
|
|
2142 2141 P78527 DLCNTHLMR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19812 (Experiment 1) 19812 43.302 387.183289 3+ 3+ 1158.52739787166 0 0.5507540180288546 99.37888198757764 Confident
|
|
|
2143 2142 P15153 KLAPITYPQGLALAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36346 (Experiment 1) 36346 63.153 528.656006 3+ 3+ 1582.9446638988604 0 0.9613700604988697 100.0 Confident
|
|
|
2144 2143 Q14697 YRVPDVLVADPPIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39131 (Experiment 1) 39131 66.525 560.985962 3+ 3+ 1679.9358901203102 0 0.09892063941372899 97.76119402985076 Confident
|
|
|
2145 2144 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32823 (Experiment 1) 32823 58.997 616.267456 2+ 2+ 1230.5209716027305 0 -0.4969725759169258 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 8: 0.0) Phosphorylation of Y (3: 39.703315881326354) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
2146 2145 P60709, P63261 KDLYANTVLSGGTTMYPGIADR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41268 (Experiment 1) 41268 69.552 808.381836 3+ 3+ 2422.1239769428003 0 -0.12302074193998255 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 2.2863038692227615) Phosphorylation of Y (4: 86.98880985206675) 0 Y4-{Y4 Y16} 1 100.0 Confident
|
|
|
2147 2146 P62851 AALQELLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37352 (Experiment 1) 37352 64.347 486.790161 2+ 2+ 971.5651461960301 0 0.6397733503842812 99.7289972899729 Confident
|
|
|
2148 2147 P47756 KLEVEANNAFDQYR Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27861 (Experiment 1) 27861 53.243 592.936218 3+ 3+ 1775.7879787344605 0 -0.6488242256884483 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 93.36823734729494) Y13 1 0 91.7910447761194 Doubtful
|
|
|
2149 2148 Q02790 FDSSLDRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10966 (Experiment 1) 10966 30.436 484.245758 2+ 2+ 966.4770594676202 0 -0.09953751049769138 99.7289972899729 Confident
|
|
|
2150 2149 P49321 EAQLYAAQAHLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20248 (Experiment 1) 20248 43.84 448.24173 3+ 3+ 1341.7040992803304 0 -0.5493169653322671 100.0 Confident
|
|
|
2151 2150 P30086 LYTLVLTDPDAPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42362 (Experiment 1) 42362 71.289 781.419983 2+ 2+ 1559.8195229553903 1 1.6232666610344644 100.0 Confident
|
|
|
2152 2151 P13639 TGTITTFEHAHNMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17898 (Experiment 1) 17898 40.807 539.259644 3+ 3+ 1614.7572741353406 0 -0.10603164317637721 100.0 Confident
|
|
|
2153 2152 Q96ST3 RLDDQESPVYAAQQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20720 (Experiment 1) 20720 44.382 619.618103 3+ 3+ 1854.8261551483306 1 1.5984157251778202 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.03069466882067) Y10 1 0 100.0 Confident
|
|
|
2154 2153 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43473 (Experiment 1) 43473 73.222 895.950623 2+ 2+ 1789.88464239309 0 1.1444133080376742 99.73190348525469 Confident
|
|
|
2155 2154 Q9H3P7 DCHEEVYAGSHQYPGR Phosphorylation of Y(7) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15326 (Experiment 1) 15326 37.373 662.260376 3+ 3+ 1983.7570896123402 0 1.111843498344846 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 4.752026535875183) Phosphorylation of Y (7: 19.3717277486911) 0 Y7-{Y7 Y13} 1 100.0 Confident
|
|
|
2156 2155 P04843 SEDLLDYGPFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45738 (Experiment 1) 45738 78.181 656.316101 2+ 2+ 1310.61428121642 0 2.5657290683960947 99.72826086956522 Confident
|
|
|
2157 2156 Q14566 DQVAIHEAMEQQTISITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33195 (Experiment 1) 33195 59.42 681.344238 3+ 3+ 2041.015004939641 0 -2.0157856294476826 100.0 Confident
|
|
|
2158 2157 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29828 (Experiment 1) 29828 55.529 452.23053 3+ 3+ 1353.6693671719202 0 0.28999056297061243 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
2159 2158 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36015 (Experiment 1) 36015 62.732 630.798218 2+ 2+ 1259.5798834611805 0 1.5849825725812665 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
2160 2159 P30040 SLNILTAFQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45826 (Experiment 1) 45826 78.397 567.8302 2+ 2+ 1133.6444591458903 0 1.2221278312858344 100.0 Confident
|
|
|
2161 2160 P40926 AGAGSATLSMAYAGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29302 (Experiment 1) 29302 54.923 727.856018 2+ 2+ 1453.6983622768903 0 -0.6039724628074578 99.73262032085562 Confident
|
|
|
2162 2161 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33940 (Experiment 1) 33940 60.28 630.796692 2+ 2+ 1259.5798834611805 0 -0.8341783811929855 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2163 2162 P62805 TVTAMDVVYALKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46414 (Experiment 1) 46414 79.433 773.888733 2+ 2+ 1545.7626159337606 0 0.19197376810050912 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2164 2163 O00567 IINDNATYCR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15414 (Experiment 1) 15414 37.501 620.293945 2+ 2+ 1238.5713708586202 0 1.5849025190254962 96.52406417112299 Confident
|
|
|
2165 2164 O00571, O15523 VRPCVVYGGADIGQQIR Phosphorylation of Y(7) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30203 (Experiment 1) 30203 55.967 656.656677 3+ 3+ 1966.9448308123701 0 1.7110884471714531 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2166 2165 P16615 SMSVYCTPNKPSR Phosphorylation of Y(5) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13601 (Experiment 1) 13601 34.641 803.841492 2+ 2+ 1605.66806392592 0 0.22836625339749891 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2167 2166 Q01469 MGAMAKPDCIITCDGK Carbamidomethylation of C(9, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24653 (Experiment 1) 24653 49.504 589.935059 3+ 3+ 1766.78236887798 0 0.5530112229281593 100.0 Confident
|
|
|
2168 2167 P00519 AGGKPSQSPSQEAAGEAVLGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19481 (Experiment 1) 19481 42.888 680.683289 3+ 3+ 2039.0283465046607 0 -0.151272040417774 100.0 Confident
|
|
|
2169 2168 P78371 NIGVDNPAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15084 (Experiment 1) 15084 36.979 499.767242 2+ 2+ 997.5192586327705 0 0.6727472325653373 95.2755905511811 Confident
|
|
|
2170 2169 P09874 LQLLEDDKENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22038 (Experiment 1) 22038 46.278 458.239502 3+ 3+ 1371.6994078227103 0 -1.9867468926188068 100.0 Confident
|
|
|
2171 2170 Q99798 DGYAQILR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28707 (Experiment 1) 28707 54.237 508.234131 2+ 2+ 1014.4535607492501 0 0.145914194448493 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 100.0 Confident
|
|
|
2172 2171 Q9H3P7 DCHEEVYAGSHQYPGR Phosphorylation of Y(7) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15165 (Experiment 1) 15165 37.118 662.260254 3+ 3+ 1983.7570896123402 0 0.9276257193783144 Phosphorylation of Y (7: Random) Phosphorylation of Y (7: 0.0, 13: 0.0) Phosphorylation of Y (7: 92.84467713787086) 0 Y7-{Y7 Y13} 1 94.11764705882352 Confident
|
|
|
2173 2172 Q9BUJ2 NYILDQTNVYGSAQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33411 (Experiment 1) 33411 59.667 607.94397 3+ 3+ 1820.8094424550304 0 0.34989230831993656 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 10.560577283333513) Phosphorylation of Y (10: 87.16163853598408) 0 Y10-{Y2 Y10} 1 100.0 Confident
|
|
|
2174 2173 P62805 DAVTYTEHAKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8855 (Experiment 1) 8855 26.356 457.541016 3+ 3+ 1369.6027441640804 0 -1.1114215391826918 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2175 2174 Q9Y2W1 WEGLVYAPPGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39995 (Experiment 1) 39995 67.732 648.805237 2+ 2+ 1295.5951396025002 0 0.6022333835649274 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2176 2175 P62993 NYVTPVNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13797 (Experiment 1) 13797 34.936 521.74115 2+ 2+ 1041.4644597861204 0 3.150307974827028 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.16055846422339) Y2 1 0 99.1869918699187 Confident
|
|
|
2177 2176 P40123, Q01518 VPTISINK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23207 (Experiment 1) 23207 47.69 436.26593 2+ 2+ 870.5174677276202 0 -0.18413220406424477 97.289972899729 Confident
|
|
|
2178 2177 Q6P2Q9 TNHIYVSSDDIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21923 (Experiment 1) 21923 46.13 491.220642 3+ 3+ 1470.6391892424504 0 0.6157163025744308 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 91.97207678883072) Y5 1 0 97.77777777777777 Confident
|
|
|
2179 2178 Q9Y262 VYELQASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18075 (Experiment 1) 18075 41.103 483.256348 2+ 2+ 964.4977949122001 0 0.3602169974931813 99.73474801061008 Confident
|
|
|
2180 2179 P09429 LGEMWNNTAADDKQPYEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27604 (Experiment 1) 27604 52.944 703.990784 3+ 3+ 2108.94731930264 0 1.5167347144236647 100.0 Confident
|
|
|
2181 2180 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17534 (Experiment 1) 17534 40.336 798.837708 2+ 2+ 1595.6617155921804 0 -0.5336035974686074 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2182 2181 Q9BV40 GENLEHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12763 (Experiment 1) 12763 33.362 484.251923 2+ 2+ 966.4882928576601 0 1.0327369922379892 99.73118279569893 Confident
|
|
|
2183 2182 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22793 (Experiment 1) 22793 47.2 757.295593 3+ 3+ 2268.8644082151895 0 0.23829730800374674 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 8.312256458652044) Phosphorylation of Y (6: 0.0) 0 Y6-{Y6 Y11 Y22} 1 100.0 Confident
|
|
|
2184 2183 P29401 TSRPENAIIYNNNEDFQVGQAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29713 (Experiment 1) 29713 55.396 836.741882 3+ 3+ 2507.2040790205 0 -0.10454076477480792 100.0 Confident
|
|
|
2185 2184 Q9NQR4 FAELAQIYAQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38056 (Experiment 1) 38056 65.205 695.331665 2+ 2+ 1388.6489660805103 0 -0.1359165116052207 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 99.46666666666667 Confident
|
|
|
2186 2185 P14618 NTGIICTIGPASR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29971 (Experiment 1) 29971 55.695 680.358032 2+ 2+ 1358.6976340009 0 2.849291358591528 100.0 Confident
|
|
|
2187 2186 P06576 VALVYGQMNEPPGAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31654 (Experiment 1) 31654 57.657 841.394531 2+ 2+ 1680.76949221935 0 2.981277984153631 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2188 2187 Q96HC4 YTEFYHVPTHSDASK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19231 (Experiment 1) 19231 42.585 621.264587 3+ 3+ 1860.7719943171505 0 -0.033650495881147456 Phosphorylation of Y (1: Doubtfull) Phosphorylation of Y (1: 11.10223872207746) Phosphorylation of Y (1: 0.0) 0 Y1-{Y1 Y5} 1 96.99248120300751 Confident
|
|
|
2189 2188 P55072 EMVELPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37796 (Experiment 1) 37796 64.886 493.770844 2+ 2+ 985.52665251233 0 0.48864193561606706 99.73958333333334 Confident
|
|
|
2190 2189 Q96AE4 IGGDAGTSLNSNDYGYGGQK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23898 (Experiment 1) 23898 48.586 685.288208 3+ 3+ 2052.84259305811 0 0.0980324634543979 Phosphorylation of Y (14: Doubtfull) Phosphorylation of Y (14: 5.743662580281907) Phosphorylation of Y (14: 0.16155088852988692) 0 Y14-{Y14 Y16} 1 100.0 Confident
|
|
|
2191 2190 P62269 IAFAITAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41240 (Experiment 1) 41240 69.517 474.299957 2+ 2+ 946.5851533646203 0 0.21895616710943064 92.43243243243244 Confident
|
|
|
2192 2191 P00338 GEMMDLQHGSLFLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42195 (Experiment 1) 42195 71.032 545.266418 3+ 3+ 1632.7752326986001 0 1.3399589808056676 100.0 Confident
|
|
|
2193 2192 P55209 YAVLYQPLFDK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45472 (Experiment 1) 45472 77.595 718.847656 2+ 2+ 1435.6788692264604 0 1.3144943743855195 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 11.282608434335703) Phosphorylation of Y (5: 99.65095986038395) 0 Y5-{Y1 Y5} 1 99.45799457994579 Confident
|
|
|
2194 2193 P55072 WALSQSNPSALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32687 (Experiment 1) 32687 58.842 665.349121 2+ 2+ 1328.6836981889203 0 -0.006855456892567981 99.45945945945947 Confident
|
|
|
2195 2194 P09651, P22626, Q32P51 IFVGGIKEDTEEHHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20908 (Experiment 1) 20908 44.601 470.747711 4+ 4+ 1878.9588103928604 0 1.5548373232592316 100.0 Doubtful
|
|
|
2196 2195 Q02790 AWDIAIATMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43474 (Experiment 1) 43474 73.223 560.297852 2+ 2+ 1118.5794163611802 0 1.5480229621887382 99.22077922077922 Confident
|
|
|
2197 2196 P63279 KDHPFGFVAVPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28057 (Experiment 1) 28057 53.467 481.597412 3+ 3+ 1441.7717849173303 0 -0.9539893812674272 93.0379746835443 Doubtful
|
|
|
2198 2197 P62937, PPIA_HUMAN VKEGMNIVEAMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33861 (Experiment 1) 33861 60.186 753.378784 2+ 2+ 1504.7377845607205 0 3.471377163475048 99.46236559139786 Confident
|
|
|
2199 2198 P62191, P62195, Q8NB90 GVLLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33886 (Experiment 1) 33886 60.214 619.812561 2+ 2+ 1237.6107896666401 0 -0.1779572075328599 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
2200 2199 P27695 EGYSGVGLLSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34806 (Experiment 1) 34806 61.294 609.282471 2+ 2+ 1216.5489176860701 0 1.207471207842607 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2201 2200 P07737 STGGAPTFNVTVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28600 (Experiment 1) 28600 54.11 690.361328 2+ 2+ 1378.7092442304204 0 -0.8264969771327152 99.47229551451187 Confident
|
|
|
2202 2201 P55263 AGHYAASIIIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26355 (Experiment 1) 26355 51.482 417.879974 3+ 3+ 1250.61727202941 0 0.6545505424723573 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
2203 2202 P05387 NIEDVIAQGIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44230 (Experiment 1) 44230 74.659 628.846252 2+ 2+ 1255.6772158261501 0 0.5845949254697622 100.0 Confident
|
|
|
2204 2203 P63244 LWDLTTGTTTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37958 (Experiment 1) 37958 65.084 632.828979 2+ 2+ 1263.6459156978704 0 -1.983653244066685 99.73118279569893 Confident
|
|
|
2205 2204 P47756 STLNEIYFGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39213 (Experiment 1) 39213 66.637 626.286865 2+ 2+ 1250.5584197406104 0 0.6046160839198972 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2206 2205 Q15459 ASKPLPPAPAPDEYLVSPITGEK Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38386 (Experiment 1) 38386 65.614 819.749695 3+ 3+ 2456.2240082539 0 1.3204640275210469 Phosphorylation of Y (14: Very Confident) Phosphorylation of Y (14: 100.0) Phosphorylation of Y (14: 99.82547993019197) Y14 1 0 99.28057553956835 Confident
|
|
|
2207 2206 Q99661 GIYAMASR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20802 (Experiment 1) 20802 44.477 474.70459 2+ 2+ 947.3936033449802 0 1.078273226442856 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
2208 2207 P50991 GIHPTIISESFQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29304 (Experiment 1) 29304 54.925 486.264221 3+ 3+ 1455.7721788401504 0 -0.9221593855736673 100.0 Confident
|
|
|
2209 2208 O43390 GYAFITFCGK Phosphorylation of Y(2) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43579 (Experiment 1) 43579 73.387 622.264709 2+ 2+ 1242.5144467536502 0 0.3361213164555523 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2210 2209 Q9Y5V0 AALIYTCTVCR Phosphorylation of Y(5) Carbamidomethylation of C(7, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30292 (Experiment 1) 30292 56.069 704.310669 2+ 2+ 1406.6087581446502 0 -1.4007139161437516 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2211 2210 P54646, Q13131 TSCGSPNYAAPEVISGR Phosphorylation of Y(8) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26853 (Experiment 1) 26853 52.055 923.394226 2+ 2+ 1844.7764280745903 0 -1.3694068470288692 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2212 2211 P38117 TALAMGADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16000 (Experiment 1) 16000 38.343 453.732056 2+ 2+ 904.4436511643601 1 2.816527231484748 95.6639566395664 Confident
|
|
|
2213 2212 P49327 HGLYLPTR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26854 (Experiment 1) 26854 52.057 518.75238 2+ 2+ 1035.4902806111402 0 -0.07088618955125778 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.67689822294022) Y4 1 0 99.73821989528795 Confident
|
|
|
2214 2213 Q15393 DYIVVGSDSGR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24621 (Experiment 1) 24621 49.467 624.268127 2+ 2+ 1246.5230968610501 0 -1.1179435993866134 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2215 2214 P30101 IFRDGEEAGAYDGPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20140 (Experiment 1) 20140 43.718 551.594604 3+ 3+ 1651.7590479571502 0 1.7734326363016968 100.0 Confident
|
|
|
2216 2215 P0DKV0 QLEQYMGQRGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16607 (Experiment 1) 16607 39.09 455.896149 3+ 3+ 1364.66191719852 0 3.436760183491343 92.14285714285715 Doubtful
|
|
|
2217 2216 P09429 KKHPDASVNFSEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19597 (Experiment 1) 19597 43.026 574.294373 3+ 3+ 1719.8580337224305 0 1.8897876764050632 100.0 Confident
|
|
|
2218 2217 P14868 IYVISLAEPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41071 (Experiment 1) 41071 69.285 580.837341 2+ 2+ 1159.6601092100302 0 0.017092862884231272 99.73333333333333 Confident
|
|
|
2219 2218 P13639 QFAEMYVAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31492 (Experiment 1) 31492 57.464 583.751709 2+ 2+ 1165.4878976526404 0 0.8286181626141284 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.73544973544973 Confident
|
|
|
2220 2219 P49327 LSPDAIPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18892 (Experiment 1) 18892 42.161 449.255737 2+ 2+ 896.4967322830403 0 0.21010680548557542 92.44791666666666 Confident
|
|
|
2221 2220 P36873, P62136, P62140 HDLDLICR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24234 (Experiment 1) 24234 49.01 521.261597 2+ 2+ 1040.5073140500801 0 1.2728906105895879 99.73890339425587 Confident
|
|
|
2222 2221 P78527 GIFTSEIGTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32689 (Experiment 1) 32689 58.844 526.78418 2+ 2+ 1051.55497543515 0 -1.108962192553992 100.0 Confident
|
|
|
2223 2222 P68371 INVYYNEATGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24564 (Experiment 1) 24564 49.403 664.827393 2+ 2+ 1327.64083031743 0 -0.44917732946663386 100.0 Confident
|
|
|
2224 2223 P04083 GGPGSAVSPYPTFNPSSDVAALHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37959 (Experiment 1) 37959 65.086 786.05542 3+ 3+ 2355.1495242665 0 -2.1600071293251037 100.0 Confident
|
|
|
2225 2224 P16401 ALAAGGYDVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20249 (Experiment 1) 20249 43.841 547.278748 2+ 2+ 1092.5451390274404 0 -2.0062506236981967 100.0 Confident
|
|
|
2226 2225 P32119 RLSEDYGVLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21172 (Experiment 1) 21172 44.958 630.304993 2+ 2+ 1258.5958678784903 0 -0.34492187854749035 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 95.79967689822294) Y6 1 0 95.2127659574468 Confident
|
|
|
2227 2226 Q8N163 VQTLSNQPLLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27444 (Experiment 1) 27444 52.746 620.86676 2+ 2+ 1239.7186867153102 0 0.22577398805193927 99.45799457994579 Confident
|
|
|
2228 2227 P50402 DSAYQSITHYRPVSASR Phosphorylation of Y(4, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22537 (Experiment 1) 22537 46.897 699.96521 3+ 3+ 2096.8717986189404 0 0.9533723978574481 Phosphorylation of Y (4: Very Confident, 10: Very Confident) Phosphorylation of Y (4: 100.0, 10: 100.0) Y4, Y10 2 0 100.0 Confident
|
|
|
2229 2228 P62937, PPIA_HUMAN FEDENFILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39381 (Experiment 1) 39381 66.872 577.790161 2+ 2+ 1153.56554011885 0 0.19812345951649663 99.7289972899729 Confident
|
|
|
2230 2229 Q99623 MLGEALSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21174 (Experiment 1) 21174 44.961 424.731354 2+ 2+ 847.4473395624702 0 0.960024120061411 96.22641509433963 Confident
|
|
|
2231 2230 Q8NFD5 DMGAQYAAASPAWAAAQQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37190 (Experiment 1) 37190 64.153 1022.940613 2+ 2+ 2042.8669744144906 1 -1.7879695552081731 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 90.40139616055846) Y6 1 0 96.50537634408603 Doubtful
|
|
|
2232 2231 P61978 DLAGSIIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34145 (Experiment 1) 34145 60.528 437.255371 2+ 2+ 872.4967322830403 0 -0.6211659853042041 95.6639566395664 Confident
|
|
|
2233 2232 P68104, Q5VTE0 EVSTYIKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10603 (Experiment 1) 10603 29.774 484.276398 2+ 2+ 966.5385970950204 0 -0.3655231974760695 99.45652173913044 Confident
|
|
|
2234 2233 Q9H299 VYSTSVTGSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11473 (Experiment 1) 11473 31.283 568.753235 2+ 2+ 1135.4910684567803 0 0.7460267268949085 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2235 2234 P23396 FIMESGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19652 (Experiment 1) 19652 43.097 441.723267 2+ 2+ 881.4316894983303 0 0.33003484737130967 100.0 Confident
|
|
|
2236 2235 P48047 LVRPPVQVYGIEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31656 (Experiment 1) 31656 57.659 528.305908 3+ 3+ 1581.8991106887702 0 -2.0291795791197877 100.0 Confident
|
|
|
2237 2236 Q9H0Q0, Q9NUQ9 VMLETPEYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28219 (Experiment 1) 28219 53.67 569.28064 2+ 2+ 1136.5535955361602 0 -6.03255043947348 99.7340425531915 Doubtful
|
|
|
2238 2237 P23921 HPDYAILAAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22374 (Experiment 1) 22374 46.696 603.786926 2+ 2+ 1205.5594228001203 0 -0.10246473252761357 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2239 2238 P05107 LGAILTPNDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26688 (Experiment 1) 26688 51.862 563.814087 2+ 2+ 1125.6142216467701 0 -0.5326047081155368 99.73262032085562 Confident
|
|
|
2240 2239 Q16658 VTGTLDANR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10108 (Experiment 1) 10108 28.832 473.752594 2+ 2+ 945.4879585044903 0 2.824859938065554 100.0 Confident
|
|
|
2241 2240 O95202 KLEEGGPVYSPPAEVVVKK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22538 (Experiment 1) 22538 46.9 702.702515 3+ 3+ 2105.0809728486706 0 2.2497721117087206 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.67689822294022) Y9 1 0 100.0 Confident
|
|
|
2242 2241 P61019, Q8WUD1 YIIIGDTGVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34565 (Experiment 1) 34565 61.019 568.321655 2+ 2+ 1134.6284747285802 0 0.24839618838413866 99.73262032085562 Confident
|
|
|
2243 2242 Q86UX7 TGSGGPGNHPHGPDASAEGLNPYGLVAPR Phosphorylation of Y(23) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29078 (Experiment 1) 29078 54.667 954.7724 3+ 3+ 2861.2882332581503 0 2.4918187127416065 Phosphorylation of Y (23: Very Confident) Phosphorylation of Y (23: 100.0) Phosphorylation of Y (23: 98.70759289176091) Y23 1 0 97.74436090225565 Confident
|
|
|
2244 2243 Q9BXS5, Q9Y6Q5 SGYQALPWVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43632 (Experiment 1) 43632 73.491 628.794678 2+ 2+ 1255.5750728642602 0 -0.21453571087303533 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2245 2244 P62310 GDGVVLVAPPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38545 (Experiment 1) 38545 65.805 596.856018 2+ 2+ 1191.69755734791 0 -0.06222734419216874 100.0 Confident
|
|
|
2246 2245 Q02790 LYANMFER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37707 (Experiment 1) 37707 64.783 562.236328 2+ 2+ 1122.4569318775302 0 1.0415460608529867 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 99.73333333333333 Confident
|
|
|
2247 2246 P25787 LAQQYYLVYQEPIPTAQLVQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46754 (Experiment 1) 46754 79.952 867.776062 3+ 3+ 2600.3039899101004 0 0.9091022898429838 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 1.9083401175278722) Phosphorylation of Y (9: 0.0) 0 Y9-{Y5 Y6 Y9} 1 100.0 Confident
|
|
|
2248 2247 P60174 IAVAAQNCYK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15580 (Experiment 1) 15580 37.732 569.289856 2+ 2+ 1136.5648289262 0 0.2899579783190795 100.0 Confident
|
|
|
2249 2248 Q16658 FLIVAHDDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23308 (Experiment 1) 23308 47.823 571.801819 2+ 2+ 1141.58800689893 0 0.9427815954673411 100.0 Confident
|
|
|
2250 2249 P51991 SSGSPYGGGYGSGGGSGGYGSR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17559 (Experiment 1) 17559 40.366 995.88269 2+ 2+ 1989.7490270264398 0 0.9037417664694576 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 10.923954499582685) Phosphorylation of Y (10: 0.0) 0 Y10-{Y6 Y10 Y19} 1 100.0 Confident
|
|
|
2251 2250 Q92945 VQISPDSGGLPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24568 (Experiment 1) 24568 49.407 677.85144 2+ 2+ 1353.68884313901 0 -0.38066780360834235 99.72826086956522 Confident
|
|
|
2252 2251 P42704 LIASYCNVGDIEGASK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33451 (Experiment 1) 33451 59.713 848.919556 2+ 2+ 1695.8137859519502 0 6.345231834578769 100.0 Doubtful
|
|
|
2253 2252 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3, 8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26185 (Experiment 1) 26185 51.287 649.241577 2+ 2+ 1296.4716520593404 0 -2.3496537373951147 Phosphorylation of Y (3: Doubtfull, 8: Doubtfull) Phosphorylation of Y (3: 74.93470752633057, 8: 14.921465968586386) 0 Y3-{Y3}, Y8-{Y8} 2 99.73190348525469 Confident
|
|
|
2254 2253 P11586 GALALAQAVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30543 (Experiment 1) 30543 56.356 549.325195 2+ 2+ 1096.6352914445204 0 0.4966294386698318 100.0 Confident
|
|
|
2255 2254 P61513 TVAGGAWTYNTTSAVTVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34304 (Experiment 1) 34304 60.714 913.968384 2+ 2+ 1825.9210279018107 0 0.6494564565772533 97.8319783197832 Confident
|
|
|
2256 2255 P56537 NSLPDTVQIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27283 (Experiment 1) 27283 52.555 571.812378 2+ 2+ 1141.60913626633 0 0.9328243685105975 93.24324324324324 Confident
|
|
|
2257 2256 Q5VWZ2 ASAVYQALQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21947 (Experiment 1) 21947 46.161 579.781616 2+ 2+ 1157.5481894100803 0 0.42227667171832606 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2258 2257 Q1KMD3 NYYGYQGYR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25655 (Experiment 1) 25655 50.678 632.245178 2+ 2+ 1262.47575274581 0 0.0397951376988051 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0, 5: 0.0, 8: 0.0) Phosphorylation of Y (2: 21.291448516579408) 0 Y2-{Y2 Y3 Y5 Y8} 1 99.73045822102425 Confident
|
|
|
2259 2258 Q9UBQ5 YNPENLATLER Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33198 (Experiment 1) 33198 59.423 700.317017 2+ 2+ 1398.6180598750504 0 1.0146781620948424 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 100.0) Y1 1 0 100.0 Confident
|
|
|
2260 2259 P38159 SDLYSSGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9688 (Experiment 1) 9688 28.014 482.692139 2+ 2+ 963.3698906949401 0 -0.17156746732784067 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 100.0 Confident
|
|
|
2261 2260 P49321 EAQLYAAQAHLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21763 (Experiment 1) 21763 45.9 474.8974 3+ 3+ 1421.6704298010804 0 -0.04155389776007094 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2262 2261 Q9NYF8 TIAPQNAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10441 (Experiment 1) 10441 29.481 484.269775 2+ 2+ 966.5246783663802 0 0.3290522320498093 99.73890339425587 Confident
|
|
|
2263 2262 P10809 APGFGDNRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7458 (Experiment 1) 7458 23.398 481.245667 2+ 2+ 960.4777281739603 0 -0.9840157710510373 100.0 Confident
|
|
|
2264 2263 P49327 AGLYGLPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31907 (Experiment 1) 31907 57.952 463.728882 2+ 2+ 925.4422677895602 0 1.0170573926286426 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.5767366720517) Y4 1 0 99.72972972972973 Confident
|
|
|
2265 2264 P13639 SDPVVSYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17455 (Experiment 1) 17455 40.23 461.734985 2+ 2+ 921.4555957470502 0 -0.19348830538221587 99.73118279569893 Confident
|
|
|
2266 2265 P04899, P08754, P09471, P63096 LFDSICNNK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26331 (Experiment 1) 26331 51.455 555.766235 2+ 2+ 1109.5175443806102 0 0.3352901519417593 100.0 Confident
|
|
|
2267 2266 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21199 (Experiment 1) 21199 44.996 633.32428 2+ 2+ 1264.6339540318404 0 0.04186997043648676 97.55434782608695 Confident
|
|
|
2268 2267 Q8IZQ5 LEAPELPVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31711 (Experiment 1) 31711 57.722 498.292358 2+ 2+ 994.5698972233004 0 0.26675418790564576 98.91598915989161 Confident
|
|
|
2269 2268 P50897 ETIPLQETSLYTQDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37350 (Experiment 1) 37350 64.344 897.450317 2+ 2+ 1792.8843080399206 0 0.9878141291914331 100.0 Confident
|
|
|
2270 2269 P09429 KHPDASVNFSEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23638 (Experiment 1) 23638 48.237 398.947815 4+ 4+ 1591.7630707084304 0 -0.5743703296435311 100.0 Doubtful
|
|
|
2271 2270 P07741 DISPVLKDPASFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34891 (Experiment 1) 34891 61.395 482.264893 3+ 3+ 1443.7721788401502 0 0.463617771353647 100.0 Confident
|
|
|
2272 2271 P06733 YISPDQLADLYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42526 (Experiment 1) 42526 71.559 753.350769 2+ 2+ 1504.6850768057104 0 1.266516980421224 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 18.151971076257574) Phosphorylation of Y (11: 99.65095986038395) 0 Y11-{Y1 Y11} 1 100.0 Confident
|
|
|
2273 2272 P07437, Q13509, Q13885, Q9BVA1 AILVDLEPGTMDSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43893 (Experiment 1) 43893 73.949 808.422974 2+ 2+ 1614.8287077401003 0 1.6620821206525822 100.0 Confident
|
|
|
2274 2273 Q99832 QQLLIGAYAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33002 (Experiment 1) 33002 59.199 552.82373 2+ 2+ 1103.6338944621903 0 -0.893046805986541 99.73118279569893 Confident
|
|
|
2275 2274 P63104 GIVDQSQQAYQEAFEISK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39497 (Experiment 1) 39497 67.038 707.655518 3+ 3+ 2119.9463298506607 0 -0.7561352674936053 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.82547993019197) Y10 1 0 100.0 Confident
|
|
|
2276 2275 P62249 GGGHVAQIYAIR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22432 (Experiment 1) 22432 46.768 661.324341 2+ 2+ 1320.6339847227102 0 0.10913229139489793 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2277 2276 P14174 LLCGLLAER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39736 (Experiment 1) 39736 67.381 522.79718 2+ 2+ 1043.5797507143502 0 0.053894732878750164 99.47089947089947 Confident
|
|
|
2278 2277 P13796, P13797, Q14651 KLENCNYAVELGK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23069 (Experiment 1) 23069 47.533 513.260681 3+ 3+ 1536.7606281802803 0 -0.26924629136361883 100.0 Confident
|
|
|
2279 2278 P13639 GEGQLGPAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11725 (Experiment 1) 11725 31.672 507.254395 2+ 2+ 1012.4937721609201 0 0.4582569156334113 99.45799457994579 Confident
|
|
|
2280 2279 P27824 IVDDWANDGWGLKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38218 (Experiment 1) 38218 65.402 539.607849 3+ 3+ 1615.7994562171502 0 1.396931479676061 99.24812030075188 Confident
|
|
|
2281 2280 P06733 TIAPALVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21843 (Experiment 1) 21843 46.015 450.281403 2+ 2+ 898.5487678559002 0 -0.5716305697046051 100.0 Confident
|
|
|
2282 2281 P11142 NQVAMNPTNTVFDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32583 (Experiment 1) 32583 58.724 825.40271 2+ 2+ 1648.7879055572805 0 1.7939815148838503 100.0 Confident
|
|
|
2283 2282 Q8NFD5 DMGAQYAAASPAWAAAQQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37128 (Experiment 1) 37128 64.081 1022.439575 2+ 2+ 2042.8669744144906 0 -1.1625847673867644 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.54604200323102) Y6 1 0 99.73262032085562 Doubtful
|
|
|
2284 2283 Q00325 GVAPLWMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39236 (Experiment 1) 39236 66.672 465.255676 2+ 2+ 928.4952928144 0 1.6187383539333606 99.74226804123711 Confident
|
|
|
2285 2284 P13796 AECMLQQAER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19507 (Experiment 1) 19507 42.919 618.280151 2+ 2+ 1234.5434418586203 0 1.8658306082994536 100.0 Confident
|
|
|
2286 2285 Q9NQR4 AVDNQVYVATASPAR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23043 (Experiment 1) 23043 47.501 821.384705 2+ 2+ 1640.7559503301907 0 -0.6655000272634402 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2287 2286 P62888 LVILANNCPALR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36344 (Experiment 1) 36344 63.15 677.388428 2+ 2+ 1352.75984033464 0 1.8178168615686128 100.0 Confident
|
|
|
2288 2287 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36820 (Experiment 1) 36820 63.712 473.279663 2+ 2+ 944.5443511818 0 0.44570345729627614 98.72122762148338 Confident
|
|
|
2289 2288 P49588 IVAVTGAEAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14213 (Experiment 1) 14213 35.621 543.810669 2+ 2+ 1085.6080736371705 0 -1.1847590912817185 96.22641509433963 Confident
|
|
|
2290 2289 P83731 CESAFLSK Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19990 (Experiment 1) 19990 43.534 471.223145 2+ 2+ 940.4324177743201 0 -0.7222771839981185 99.7289972899729 Confident
|
|
|
2291 2290 Q969T9 KGTVYLTPYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24655 (Experiment 1) 24655 49.507 639.319397 2+ 2+ 1276.6216887035102 0 1.9961602701828156 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 8.76745481691588) Phosphorylation of Y (5: 5.977382875605816) 0 Y9-{Y5 Y9} 1 100.0 Confident
|
|
|
2292 2291 Q15233 GIVEFSGKPAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19837 (Experiment 1) 19837 43.336 616.343811 2+ 2+ 1230.6720708760602 0 0.809768108400609 98.94179894179894 Confident
|
|
|
2293 2292 P07195 MVVESAYEVIK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37101 (Experiment 1) 37101 64.05 674.316467 2+ 2+ 1346.6193057450105 0 -0.6856409756407921 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 97.20767888307155) Y7 1 0 96.75675675675676 Confident
|
|
|
2294 2293 P52597 GLPFGCTK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26434 (Experiment 1) 26434 51.574 440.223633 2+ 2+ 878.4320238515002 0 0.7828014715555373 99.72826086956522 Confident
|
|
|
2295 2294 P51991 EDTEEYNLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19150 (Experiment 1) 19150 42.485 584.759277 2+ 2+ 1167.5043964142703 0 -0.33804317125660616 99.72972972972973 Confident
|
|
|
2296 2295 P29692 FYEQMNGPVAGASR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27027 (Experiment 1) 27027 52.258 803.841248 2+ 2+ 1605.6646927976403 0 2.021714682240424 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2297 2296 P54819 LQAYHTQTTPLIEYYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34645 (Experiment 1) 34645 61.109 666.344727 3+ 3+ 1996.0054262321103 0 3.464368699435669 100.0 Confident
|
|
|
2298 2297 P62841 HGRPGIGATHSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4091 (Experiment 1) 4091 16.66 444.900024 3+ 3+ 1331.6806784971502 0 -1.8250490816675662 100.0 Confident
|
|
|
2299 2298 P62241 LTPEEEEILNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30147 (Experiment 1) 30147 55.9 657.842529 2+ 2+ 1313.6714617393702 0 -0.7271286489825728 100.0 Confident
|
|
|
2300 2299 Q02790 TQLAVCQQR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13602 (Experiment 1) 13602 34.643 552.284607 2+ 2+ 1102.55532687166 0 -0.6027733476314158 100.0 Confident
|
|
|
2301 2300 O75083 VFASLPQVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33559 (Experiment 1) 33559 59.839 573.320007 2+ 2+ 1144.6240580544802 0 1.2235868234970544 98.92183288409704 Confident
|
|
|
2302 2301 P33241 FVATGHGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4846 (Experiment 1) 4846 17.748 408.721771 2+ 2+ 815.4289870763901 0 0.0024344017735001447 99.72826086956522 Confident
|
|
|
2303 2302 Q9ULW0 AQPVPHYGVPFKPQIPEAR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32518 (Experiment 1) 32518 58.652 737.709534 3+ 3+ 2210.1037739819203 0 1.3549242929943008 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2304 2303 P13796, P13797 YAFVNWINK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45395 (Experiment 1) 45395 77.426 617.786926 2+ 2+ 1233.5583601709602 0 0.7598866935907259 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 100.0) Y1 1 0 100.0 Confident
|
|
|
2305 2304 P62805 TVTAMDVVYALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46528 (Experiment 1) 46528 79.61 655.854797 2+ 2+ 1309.6951743894106 0 -0.10164065418671504 100.0 Confident
|
|
|
2306 2305 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30148 (Experiment 1) 30148 55.902 528.261597 2+ 2+ 1054.5100129962104 0 -1.298530936920847 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82608695652175) Y7 1 0 100.0 Confident
|
|
|
2307 2306 P62805 VFLENVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40121 (Experiment 1) 40121 67.887 495.292847 2+ 2+ 988.5705659296402 0 0.5806030444986635 100.0 Confident
|
|
|
2308 2307 P09651, Q32P51 GFAFVTFDDHDSVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41764 (Experiment 1) 41764 70.318 567.258484 3+ 3+ 1698.7525655943803 0 0.6211194542627458 100.0 Confident
|
|
|
2309 2308 P39687 KLELSDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11058 (Experiment 1) 11058 30.595 487.764404 2+ 2+ 973.5192586327703 0 -5.129054815789264 99.72826086956522 Doubtful
|
|
|
2310 2309 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18040 (Experiment 1) 18040 41.033 506.239471 3+ 3+ 1515.6953850714303 0 0.7891713626427492 100.0 Confident
|
|
|
2311 2310 P14625 SGYLLPDTK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30041 (Experiment 1) 30041 55.777 537.249756 2+ 2+ 1072.4841921711902 0 0.7137236681083517 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 94.02261712439419) Y3 1 0 98.95287958115183 Confident
|
|
|
2312 2311 Q5R372 GHTNAGDAIYEVVSLQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42024 (Experiment 1) 42024 70.746 637.299622 3+ 3+ 1908.8731053407505 0 2.0562106954519774 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.65095986038395) Y10 1 0 100.0 Confident
|
|
|
2313 2312 Q9H8W4 SFAVYAATATEK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31739 (Experiment 1) 31739 57.757 669.804321 2+ 2+ 1337.5904481448804 0 2.7179067653957087 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2314 2313 P54577 NLQEVLGEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31238 (Experiment 1) 31238 57.164 579.804443 2+ 2+ 1157.5928174958503 0 1.3069686897014319 99.7289972899729 Confident
|
|
|
2315 2314 P36578 PLISVYSEK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30542 (Experiment 1) 30542 56.354 558.273621 2+ 2+ 1114.5311423636103 0 1.3852570227292818 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.38219895287958) Y6 1 0 97.289972899729 Confident
|
|
|
2316 2315 P15311, P26038, P35241 KAPDFVFYAPR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38872 (Experiment 1) 38872 66.201 695.831177 2+ 2+ 1389.6482378045202 0 -0.31382469032801363 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2317 2316 O15228 KEDVYSCFR Phosphorylation of Y(5) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19233 (Experiment 1) 19233 42.586 642.260498 2+ 2+ 1282.5053386219302 0 0.8598110881221485 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.46949602122017 Confident
|
|
|
2318 2317 P11142 DAGTIAGLNVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42285 (Experiment 1) 42285 71.173 600.341064 2+ 2+ 1198.66698549562 0 0.49103008316091 100.0 Confident
|
|
|
2319 2318 P08238, Q58FF8 SIYYITGESK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30540 (Experiment 1) 30540 56.351 620.778992 2+ 2+ 1239.5424353233002 0 0.8020115750701439 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.16155088852988692) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
2320 2319 P13010 LFQCLLHR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32325 (Experiment 1) 32325 58.425 543.797668 2+ 2+ 1085.58041942069 0 0.3343576378241191 99.46091644204851 Confident
|
|
|
2321 2320 P15880 GCTATLGNFAK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25097 (Experiment 1) 25097 50.021 570.278809 2+ 2+ 1138.5440934816202 0 -0.9016767769864009 99.73045822102425 Confident
|
|
|
2322 2321 O94903 DLPAIQPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25573 (Experiment 1) 25573 50.582 455.762634 2+ 2+ 908.5079656730802 1 -0.6649418237823697 99.19571045576407 Confident
|
|
|
2323 2322 Q9Y2L1 ASLTYAEAQLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32348 (Experiment 1) 32348 58.452 651.808716 2+ 2+ 1301.6016815349203 0 0.91862269269291 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.45945945945947 Confident
|
|
|
2324 2323 P25705 ILGADTSVDLEETGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34067 (Experiment 1) 34067 60.435 788.3974 2+ 2+ 1574.7787803422202 0 0.9301942902607419 100.0 Confident
|
|
|
2325 2324 O75368 IGFEEKDIAANEENRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20328 (Experiment 1) 20328 43.929 466.48703 4+ 4+ 1861.9170051505305 0 1.0766560779039949 100.0 Doubtful
|
|
|
2326 2325 Q96AE4 GTPQQIDYAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16945 (Experiment 1) 16945 39.519 574.787659 2+ 2+ 1147.5621860739102 0 -1.2361136809752218 100.0 Confident
|
|
|
2327 2326 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14111 (Experiment 1) 14111 35.461 600.788452 2+ 2+ 1199.5587540937802 0 2.993552348949975 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2328 2327 O75367 SIAFPSIGSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36841 (Experiment 1) 36841 63.739 546.299988 2+ 2+ 1090.57710786206 0 7.610532474405071 99.73333333333333 Doubtful
|
|
|
2329 2328 P26641 EYFSWEGAFQHVGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45998 (Experiment 1) 45998 78.744 882.875305 2+ 2+ 1763.7344866096205 0 0.8893997506139998 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2330 2329 P22102 IYSHSLLPVLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40982 (Experiment 1) 40982 69.149 689.369812 2+ 2+ 1376.7217370979502 0 2.4181335109946906 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 97.38219895287958) Y2 1 0 99.1869918699187 Confident
|
|
|
2331 2330 P01889, P01893, P03989, P04222, P04439, P05534, P10319, P13746, P13747, P16188, P17693, P18463, P18464, P18465, P30443, P30447, P30455, P30460, P30461, P30462, P30464, P30466, P30475, P30479, P30480, P30481, P30483, P30484, P30485, P30487, P30488, P30490, P30491, P30492, P30493, P30495, P30498, P30501, P30504, P30505, P30508, P30510, P30685, Q04826, Q07000, Q29718, Q29836, Q29865, Q29940, Q29960, Q29963, Q95365, Q9TNN7 WAAVVVPSGEEQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31996 (Experiment 1) 31996 58.052 714.367798 2+ 2+ 1426.7204776204603 0 0.3957668171034933 92.9539295392954 Confident
|
|
|
2332 2331 P27695 ICSWNVDGLR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36345 (Experiment 1) 36345 63.152 610.297852 2+ 2+ 1218.5815416195 0 -0.31996917397754876 100.0 Confident
|
|
|
2333 2332 P55884 FSHQGVQLIDFSPCER Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38544 (Experiment 1) 38544 65.804 640.641479 3+ 3+ 1918.89958126458 0 1.5746403402599678 97.84172661870504 Confident
|
|
|
2334 2333 Q06830 IGHPAPNFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12311 (Experiment 1) 12311 32.654 490.76947 2+ 2+ 979.5239500903901 0 0.44519495120827324 100.0 Confident
|
|
|
2335 2334 P02786 HPVTGQFLYQDSNWASK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36511 (Experiment 1) 36511 63.346 686.642883 3+ 3+ 2056.9044054690303 0 1.17194999150316 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2336 2335 P62249 VKGGGHVAQIYAIR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18042 (Experiment 1) 18042 41.035 516.940002 3+ 3+ 1547.7973616497004 0 0.5254963753707144 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.83844911147011) Y11 1 0 100.0 Confident
|
|
|
2337 2336 P10809 GANPVEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15858 (Experiment 1) 15858 38.146 428.237885 2+ 2+ 854.4610154806601 0 0.2353665690503774 99.45799457994579 Confident
|
|
|
2338 2337 P61011 DMYEQFQNIMK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45737 (Experiment 1) 45737 78.18 763.806519 2+ 2+ 1525.5982530306003 0 0.15189436395092187 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.03315881326353) Y3 1 0 99.19571045576407 Confident
|
|
|
2339 2338 P50395 VTEGSFVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23616 (Experiment 1) 23616 48.21 555.24884 2+ 2+ 1108.4841921711904 0 -0.959122934031147 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2340 2339 P37802, Q9UI15 GASQAGMTGYGMPR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22183 (Experiment 1) 22183 46.462 732.29364 2+ 2+ 1462.57343526509 0 -0.48354808305892083 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 98.86914378029078) Y10 1 0 99.46091644204851 Confident
|
|
|
2341 2340 P26641 QAFPNTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12369 (Experiment 1) 12369 32.748 474.237061 2+ 2+ 946.4620781098201 0 -2.645340287754244 96.24664879356568 Confident
|
|
|
2342 2341 Q14566 TSILAAANPISGHYDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33450 (Experiment 1) 33450 59.712 562.626221 3+ 3+ 1684.8532826951603 0 2.1037720020062434 100.0 Confident
|
|
|
2343 2342 O60361, P15531, P22392 VMLGETNPADSKPGTIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21844 (Experiment 1) 21844 46.018 595.97699 3+ 3+ 1784.9090833191203 0 0.03203728023087967 100.0 Confident
|
|
|
2344 2343 Q16629 AFSYYGPLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39890 (Experiment 1) 39890 67.585 577.256226 2+ 2+ 1152.50051094167 0 -2.262313741850417 Phosphorylation of Y (5: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.5235602094240838) 0 Y5-{Y4 Y5} 1 100.0 Confident
|
|
|
2345 2344 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27525 (Experiment 1) 27525 52.842 523.252075 2+ 2+ 1044.4892775516303 0 0.3053163650836789 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
2346 2345 P61247 TSYAQHQQVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5318 (Experiment 1) 5318 18.808 649.28894 2+ 2+ 1296.5612137052703 0 1.6274453596400487 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2347 2346 P55884 DQYSVIFESGDR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37932 (Experiment 1) 37932 65.05 748.308105 2+ 2+ 1494.6028037337303 0 -0.7661726956623166 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2348 2347 P0DMV8, P17066, P34931, P48741 ATAGDTHLGGEDFDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18977 (Experiment 1) 18977 42.264 559.249329 3+ 3+ 1674.7233907244204 0 1.6491628827376532 100.0 Confident
|
|
|
2349 2348 P11279 TVESITDIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26938 (Experiment 1) 26938 52.153 517.279663 2+ 2+ 1032.5451390274402 0 -0.3537360551870891 100.0 Confident
|
|
|
2350 2349 P50402 DSAYQSITHYRPVSASR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24759 (Experiment 1) 24759 49.628 673.309265 3+ 3+ 2016.9054680981903 0 0.2462966733235756 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 8.249468548842493) Phosphorylation of Y (4: 65.70680628272252) 0 Y10-{Y4 Y10} 1 100.0 Confident
|
|
|
2351 2350 Q99733 KYAALYQPLFDK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39908 (Experiment 1) 39908 67.61 768.875366 2+ 2+ 1535.7425321121802 0 -4.1313715060709635 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 6: 0.0) Phosphorylation of Y (2: 0.6462035541195477) 0 Y2-{Y2 Y6} 1 99.74358974358975 Confident
|
|
|
2352 2351 P14868 TSTSQAVFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15585 (Experiment 1) 15585 37.737 498.759491 2+ 2+ 995.5036085686304 0 0.8225391550763096 100.0 Confident
|
|
|
2353 2352 P22626 SGNFGGSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6506 (Experiment 1) 6506 21.085 391.182922 2+ 2+ 780.3514650316802 0 -0.22235795017727505 100.0 Confident
|
|
|
2354 2353 P52565 TDYMVGSYGPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28961 (Experiment 1) 28961 54.531 663.264771 2+ 2+ 1324.51590330563 0 -0.6891958264835907 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 4.788508429081698) Phosphorylation of Y (3: 99.03069466882067) 0 Y3-{Y3 Y8} 1 99.72826086956522 Confident
|
|
|
2355 2354 P54819 AVLLGPPGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25242 (Experiment 1) 25242 50.19 490.300049 2+ 2+ 978.5862159937801 0 -0.6842003650112152 98.75311720698254 Confident
|
|
|
2356 2355 P31942 DGMDNQGGYGSVGR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15087 (Experiment 1) 15087 36.984 746.780151 2+ 2+ 1491.54497158778 0 0.5205541413648428 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2357 2356 Q10472 HYFSLGEIR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35754 (Experiment 1) 35754 62.412 601.274231 2+ 2+ 1200.53287369911 0 0.860978322231185 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 86.03839441535777) Y2 1 0 95.32467532467533 Confident
|
|
|
2358 2357 O75821 VTNLSEDTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11554 (Experiment 1) 11554 31.392 517.758606 2+ 2+ 1033.5040024914504 0 -1.2973452455288883 99.73474801061008 Confident
|
|
|
2359 2358 Q02790 VGEVCHITCKPEYAYGSAGSPPK Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20223 (Experiment 1) 20223 43.812 627.549133 4+ 4+ 2506.16208017949 0 2.129699638480118 100.0 Doubtful
|
|
|
2360 2359 Q9BSJ8 LLAETVAPAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28138 (Experiment 1) 28138 53.565 570.343384 2+ 2+ 1138.6710082469003 0 1.057977339790913 100.0 Confident
|
|
|
2361 2360 P31949 DGYNYTLSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21311 (Experiment 1) 21311 45.166 570.733521 2+ 2+ 1139.4536203189004 0 -0.9910504305852058 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 16.86685734877816) Phosphorylation of Y (3: 32.55250403877221) 0 Y5-{Y3 Y5} 1 100.0 Confident
|
|
|
2362 2361 P39023 VIAHTQMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6868 (Experiment 1) 6868 21.95 478.262543 2+ 2+ 954.5069201272602 0 3.7771646718343797 92.76485788113695 Confident
|
|
|
2363 2362 P08865 SDGIYIINLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45735 (Experiment 1) 45735 78.178 608.304688 2+ 2+ 1214.5948052493304 0 0.014644836837527462 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.50959860383944) Y5 1 0 99.7289972899729 Confident
|
|
|
2364 2363 P15311, P26038, P35241 KAPDFVFYAPR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38870 (Experiment 1) 38870 66.199 464.223602 3+ 3+ 1389.6482378045202 0 0.5304882047692133 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.65095986038395) Y8 1 0 100.0 Confident
|
|
|
2365 2364 P61158 KDYEEIGPSICR Phosphorylation of Y(3) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23394 (Experiment 1) 23394 47.931 773.833313 2+ 2+ 1545.6534594076 0 -0.8957613732911134 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 93.36823734729494) Y3 1 0 98.94459102902374 Confident
|
|
|
2366 2365 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 RNLDIERPTYTNLNR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21699 (Experiment 1) 21699 45.812 652.322144 3+ 3+ 1953.94218796008 0 1.2338701491964594 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
2367 2366 Q8NDV3 YFYKKMLTR Phosphorylation of Y(1, 3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25077 (Experiment 1) 25077 49.998 705.305542 2+ 2+ 1408.6015611134203 0 -3.5658511160241764 Phosphorylation of Y (1: Very Confident, 3: Very Confident) Phosphorylation of Y (1: 96.33507853403141, 3: 96.33507853403141) Y1, Y3 2 0 96.19565217391303 Confident
|
|
|
2368 2367 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17706 (Experiment 1) 17706 40.563 532.895386 3+ 3+ 1595.6617155921804 0 1.634474434935863 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2369 2368 P49327 LSIPTYGLQCTR Phosphorylation of Y(6) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38542 (Experiment 1) 38542 65.802 744.848083 2+ 2+ 1487.68436561306 0 -1.847720133181902 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 99.45799457994579 Confident
|
|
|
2370 2369 P07900 KFYEQFSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19735 (Experiment 1) 19735 43.207 578.757446 2+ 2+ 1155.5001765885004 0 0.14036786854472275 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 91.97207678883072) Y3 1 0 96.4769647696477 Confident
|
|
|
2371 2370 P33992 VLGIQVDTDGSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31407 (Experiment 1) 31407 57.362 658.844238 2+ 2+ 1315.6731930748701 0 0.5539943040082301 100.0 Confident
|
|
|
2372 2371 P23396 IMLPWDPTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46752 (Experiment 1) 46752 79.95 579.304443 2+ 2+ 1156.5950664253203 0 -0.6329646605644685 95.6639566395664 Confident
|
|
|
2373 2372 P06493, P24941, Q00526 IGEGTYGVVYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26660 (Experiment 1) 26660 51.83 633.294006 2+ 2+ 1264.5740698047505 0 -0.4821915843274898 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 7.218395230764212) Phosphorylation of Y (6: 94.02261712439419) 0 Y10-{Y6 Y10} 1 98.91598915989161 Confident
|
|
|
2374 2373 Q92945 SVSLTGAPESVQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21090 (Experiment 1) 21090 44.842 651.848755 2+ 2+ 1301.6826951294104 0 0.2009185536236557 100.0 Confident
|
|
|
2375 2374 P30101 FVMQEEFSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33435 (Experiment 1) 33435 59.694 586.77478 2+ 2+ 1171.5331944447503 0 1.5445657235109354 100.0 Confident
|
|
|
2376 2375 P07900 RAPFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39906 (Experiment 1) 39906 67.607 632.825195 2+ 2+ 1263.6360197205104 0 -0.14431640015957997 98.66666666666667 Confident
|
|
|
2377 2376 A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65 EDAANNYAR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.36 min, Period: 1, Cycle(s): 6624 (Experiment 1) 6624 21.34 552.211304 2+ 2+ 1102.4080671088102 0 -0.010903827978044161 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2378 2377 O43175 GTIQVITQGTSLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31737 (Experiment 1) 31737 57.755 673.388367 4+ 2+ 1344.76127980328 0 0.6692005260835061 96.46739130434783 Confident
|
|
|
2379 2378 Q8TEM1 VYVSDNIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18976 (Experiment 1) 18976 42.263 483.257385 2+ 2+ 964.4977949122001 0 2.5060768042673085 92.80000000000001 Confident
|
|
|
2380 2379 P55072 ELQELVQYPVEHPDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32825 (Experiment 1) 32825 59.0 608.644409 3+ 3+ 1822.9101288649406 0 0.6948422243587367 99.28057553956835 Confident
|
|
|
2381 2380 P62906 DTLYEAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25847 (Experiment 1) 25847 50.897 483.747406 2+ 2+ 965.4818104948902 0 -1.6035497110963222 99.73333333333333 Confident
|
|
|
2382 2381 P18124 KAGNFYVPAEPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21091 (Experiment 1) 21091 44.843 440.90329 3+ 3+ 1319.6873865870305 0 0.49444921512749695 100.0 Confident
|
|
|
2383 2382 P38159, Q96E39 DSYESYGNSR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11556 (Experiment 1) 11556 31.394 629.224426 2+ 2+ 1256.4346757794704 0 -0.29934707409367395 Phosphorylation of Y (6: Random) Phosphorylation of Y (3: 0.0, 6: 0.0) Phosphorylation of Y (6: 67.4266832643796) 0 Y6-{Y3 Y6} 1 96.22641509433963 Confident
|
|
|
2384 2383 Q02790 LQAFSAAIESCNK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31131 (Experiment 1) 31131 57.041 719.853394 2+ 2+ 1437.6922142672904 0 0.014446751157199442 100.0 Confident
|
|
|
2385 2384 P37837 ALAGCDFLTISPK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42283 (Experiment 1) 42283 71.17 696.863159 2+ 2+ 1391.7118870827103 0 -0.08754683196134752 99.46091644204851 Confident
|
|
|
2386 2385 P35579 ELEDATETADAMNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23613 (Experiment 1) 23613 48.206 783.342651 2+ 2+ 1564.6675156410802 0 2.0638681967662573 96.22641509433963 Confident
|
|
|
2387 2386 P14625 EEASDYLELDTIK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42021 (Experiment 1) 42021 70.738 803.352234 2+ 2+ 1604.6858646513504 0 2.520952245404823 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 95.15347334410339) Y6 1 0 99.49622166246851 Confident
|
|
|
2388 2387 Q8TAQ2, Q92922 SKTPEIYLAYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32827 (Experiment 1) 32827 59.002 474.234344 3+ 3+ 1419.6799318556202 0 0.8931906732044633 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 4.505364436250828) Phosphorylation of Y (7: 99.83844911147011) 0 Y7-{Y7 Y10} 1 100.0 Confident
|
|
|
2389 2388 Q99623 LLLGAGAVAYGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40676 (Experiment 1) 40676 68.713 630.376221 2+ 2+ 1258.7397565130602 0 -1.4812138022514465 98.91598915989161 Confident
|
|
|
2390 2389 Q9UKK9 VYSYALALK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37855 (Experiment 1) 37855 64.956 554.278625 3+ 2+ 1106.5413131244902 0 1.2484187112979086 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.33452891645359) Phosphorylation of Y (2: 98.86914378029078) 0 Y2-{Y2 Y4} 1 98.93048128342245 Confident
|
|
|
2391 2390 O00231 TTANAIYCPPK Phosphorylation of Y(7) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16389 (Experiment 1) 16389 38.828 658.292114 2+ 2+ 1314.5679388784902 0 1.3187080159608537 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73333333333333 Confident
|
|
|
2392 2391 Q12934 EPETPTELYTKER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32416 (Experiment 1) 32416 58.532 796.886536 2+ 2+ 1591.7729666857902 0 -9.064959561103102 96.53333333333333 Doubtful
|
|
|
2393 2392 P50990 DIDEVSSLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43983 (Experiment 1) 43983 74.108 573.803711 2+ 2+ 1145.59281749585 0 0.04493742991967124 100.0 Confident
|
|
|
2394 2393 P31040 IDEYDYSKPIQGQQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20325 (Experiment 1) 20325 43.924 631.28772 3+ 3+ 1890.8400738769703 0 0.6635766798618976 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 7.880043408382123) Phosphorylation of Y (4: 0.0) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
2395 2394 Q96IV0 EVEDHYCDACQFSNR Phosphorylation of Y(6) Carbamidomethylation of C(7, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18997 (Experiment 1) 18997 42.288 670.911865 3+ 3+ 2008.7080908145904 1 1.15321005590644 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.03315881326353) Y6 1 0 92.46575342465754 Doubtful
|
|
|
2396 2395 P04406 RVIISAPSADAPMFVMGVNHEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38547 (Experiment 1) 38547 65.807 790.736755 3+ 3+ 2368.20315714583 1 -7.623226040895723 100.0 Doubtful
|
|
|
2397 2396 P30086 LYEQLSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18152 (Experiment 1) 18152 41.202 469.252869 2+ 2+ 936.4916469026002 0 -0.49209714786170966 99.45945945945947 Confident
|
|
|
2398 2397 O60361, P15531, P22392 VMLGETNPADSKPGTIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22034 (Experiment 1) 22034 46.274 595.977051 3+ 3+ 1784.9090833191203 0 0.13439022831021866 100.0 Confident
|
|
|
2399 2398 P61313 GATYGKPVHHGVNQLK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7352 (Experiment 1) 7352 23.156 595.964844 3+ 3+ 1784.8723174951103 0 0.2153955558575198 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2400 2399 P41091, Q2VIR3 IVLTNPVCTEVGEK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33714 (Experiment 1) 33714 60.016 779.911255 2+ 2+ 1557.8072440195303 0 0.4571335308103424 99.1869918699187 Confident
|
|
|
2401 2400 P62873, P62879, Q9HAV0 AGVLAGHDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7257 (Experiment 1) 7257 22.964 505.261444 2+ 2+ 1008.5100909314001 0 -1.737577638221561 99.75247524752476 Confident
|
|
|
2402 2401 Q15393 HIANYISGIQTIGHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29325 (Experiment 1) 29325 54.949 560.637695 3+ 3+ 1678.8903369102202 0 0.5462171938203505 100.0 Confident
|
|
|
2403 2402 A8MTJ3, P04899, P08754, P09471, P11488, P19087, P38405, P63092, P63096, Q03113, Q14344, Q5JWF2 LLLLGAGESGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35991 (Experiment 1) 35991 62.7 529.316895 2+ 2+ 1056.6179100448803 0 1.253524279704063 96.49595687331536 Confident
|
|
|
2404 2403 Q04912 SMEYLAEQKFVHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5239 (Experiment 1) 5239 18.618 819.414917 2+ 2+ 1636.8031616986007 0 7.39518963389106 96.19565217391303 Doubtful
|
|
|
2405 2404 O15144 DYLHYHIK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19835 (Experiment 1) 19835 43.333 584.763855 2+ 2+ 1167.5114099785403 0 1.4938427115037378 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 5.633223415363209) Phosphorylation of Y (2: 87.7221324717286) 0 Y2-{Y2 Y5} 1 97.5609756097561 Confident
|
|
|
2406 2405 P07900, Q58FG0 TKFENLCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12490 (Experiment 1) 12490 32.933 520.265686 2+ 2+ 1038.5168161046201 0 0.002846387638718541 92.40837696335078 Confident
|
|
|
2407 2406 P27797 IKDPDASKPEDWDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17725 (Experiment 1) 17725 40.586 600.951843 3+ 3+ 1799.8326068202302 0 0.6061384168694762 100.0 Confident
|
|
|
2408 2407 P10809 GYISPYFINTSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41050 (Experiment 1) 41050 69.255 735.340515 2+ 2+ 1468.6639474383103 0 1.720041507978392 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 17.845058675886186) Phosphorylation of Y (6: 64.71613029204653) 0 Y6-{Y2 Y6} 1 99.72826086956522 Confident
|
|
|
2409 2408 P36578 KLDELYGTWR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34140 (Experiment 1) 34140 60.522 680.817993 2+ 2+ 1359.6224169795003 0 -0.7225957770987158 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2410 2409 P60900 YGYEIPVDMLCK Phosphorylation of Y(1) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45573 (Experiment 1) 45573 77.826 784.333069 2+ 2+ 1566.6499542502902 0 1.039620695336303 Phosphorylation of Y (1: Doubtfull) Phosphorylation of Y (1: 8.913534624122764) Phosphorylation of Y (1: 0.0) 0 Y1-{Y1 Y3} 1 99.72972972972973 Confident
|
|
|
2411 2410 Q15233 HEHQVMLMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12340 (Experiment 1) 12340 32.704 394.195618 3+ 3+ 1179.5641177335501 0 0.7668499834291823 99.28057553956835 Confident
|
|
|
2412 2411 P18124 IALTDNALIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36510 (Experiment 1) 36510 63.345 585.846741 2+ 2+ 1169.6768219033302 0 1.7983942622149731 100.0 Confident
|
|
|
2413 2412 P12268 TSSAQVEGGVHSLHSYEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16773 (Experiment 1) 16773 39.295 479.733704 4+ 4+ 1914.9071687428207 0 -0.7601138652001183 77.77777777777779 Doubtful
|
|
|
2414 2413 Q07955 DGTGVVEFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34747 (Experiment 1) 34747 61.225 539.780518 2+ 2+ 1077.5454733806102 0 0.9352752427426345 100.0 Confident
|
|
|
2415 2414 Q9Y6E2 LLELFPVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45212 (Experiment 1) 45212 77.033 550.824524 2+ 2+ 1099.6389798426303 0 -4.070949823176951 99.73474801061008 Confident
|
|
|
2416 2415 P26641 EYFSWEGAFQHVGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45849 (Experiment 1) 45849 78.449 588.919434 3+ 3+ 1763.7344866096205 0 1.1240882093329638 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 97.03315881326353) Y2 1 0 92.46575342465754 Doubtful
|
|
|
2417 2416 P33991 DMFEEALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39849 (Experiment 1) 39849 67.523 505.734253 2+ 2+ 1009.4538814948901 0 0.07075997985704233 99.45652173913044 Confident
|
|
|
2418 2417 P0DMV8, P11142, P17066, P34931, P48741, P54652 TTPSYVAFTDTER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32666 (Experiment 1) 32666 58.818 744.354736 2+ 2+ 1486.6939880891005 0 0.6253589938851872 100.0 Confident
|
|
|
2419 2418 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38796 (Experiment 1) 38796 66.112 912.997498 2+ 2+ 1823.9781488551102 0 1.2564186391653864 100.0 Confident
|
|
|
2420 2419 Q9BVC6 EAPVDVLTQIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43495 (Experiment 1) 43495 73.255 649.358582 2+ 2+ 1296.7037649271601 0 -0.8884611609013251 93.65079365079364 Confident
|
|
|
2421 2420 P15531, P22392 TFIAIKPDGVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26199 (Experiment 1) 26199 51.302 448.92627 3+ 3+ 1343.7561348531901 0 0.6279775852359188 100.0 Confident
|
|
|
2422 2421 P46782 YLPHSAGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7478 (Experiment 1) 7478 23.444 450.738251 2+ 2+ 899.4613498338301 0 0.6647238646067174 97.289972899729 Confident
|
|
|
2423 2422 P09874 ASLCISTK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17726 (Experiment 1) 17726 40.589 440.235596 2+ 2+ 878.4531532189001 0 3.9590861216458255 96.19565217391303 Confident
|
|
|
2424 2423 P21796 YQIDPDACFSAK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32665 (Experiment 1) 32665 58.816 707.818298 2+ 2+ 1413.6234660011303 0 -1.0051543793970785 99.72972972972973 Confident
|
|
|
2425 2424 P62491, Q15907 AQIWDTAGQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26682 (Experiment 1) 26682 51.856 637.809998 2+ 2+ 1273.60511351505 0 0.2583460684377866 99.73474801061008 Confident
|
|
|
2426 2425 P13995 LVGDVDFEGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36261 (Experiment 1) 36261 63.053 603.315979 2+ 2+ 1204.6088019131603 0 7.1299409057186205 99.45945945945947 Doubtful
|
|
|
2427 2426 P43487 ICANHYITPMMELKPNAGSDR Phosphorylation of Y(6) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37375 (Experiment 1) 37375 64.376 833.373901 3+ 3+ 2497.09533675015 0 1.8146547190524578 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2428 2427 P62701 FDTGNLCMVTGGANLGR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41007 (Experiment 1) 41007 69.184 891.917969 2+ 2+ 1781.8188884157298 0 1.3995985208641042 100.0 Confident
|
|
|
2429 2428 P13798 AESFFQTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27384 (Experiment 1) 27384 52.676 479.237946 2+ 2+ 956.4603467743202 0 1.0352822553979903 97.55434782608695 Confident
|
|
|
2430 2429 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19574 (Experiment 1) 19574 42.997 636.766907 2+ 2+ 1271.5183458337801 0 0.718656421441768 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2431 2430 P11142, P17066, P54652 LLQDFFNGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42606 (Experiment 1) 42606 71.703 541.287109 2+ 2+ 1080.5603951687601 0 -0.6744127836833671 99.7340425531915 Confident
|
|
|
2432 2431 Q08170, Q13247 QAGEVTYADAHK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9020 (Experiment 1) 9020 26.666 685.29248 2+ 2+ 1368.5711096826305 0 -0.5126394314116206 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.50959860383944) Y7 1 0 99.45799457994579 Confident
|
|
|
2433 2432 ALDOA_RABIT, P04075 ELSDIAHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13124 (Experiment 1) 13124 33.905 470.746185 2+ 2+ 939.4773938207902 0 0.4495477495904673 99.74093264248705 Confident
|
|
|
2434 2433 P14618 LDIDSPPITAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31812 (Experiment 1) 31812 57.842 599.327637 2+ 2+ 1196.64010204144 0 0.5164330970471174 100.0 Confident
|
|
|
2435 2434 P04080 VHVGDEDFVHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27385 (Experiment 1) 27385 52.677 474.909424 3+ 3+ 1421.7051619094902 0 0.8989020924884251 100.0 Confident
|
|
|
2436 2435 P27348 YLIANATNPESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23537 (Experiment 1) 23537 48.111 660.843689 2+ 2+ 1319.6721304457103 0 0.5255562262688566 100.0 Confident
|
|
|
2437 2436 P28062 ASAGSYISALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31908 (Experiment 1) 31908 57.953 548.293091 2+ 2+ 1094.5720224816203 0 -0.3587635059639382 100.0 Confident
|
|
|
2438 2437 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(22) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25166 (Experiment 1) 25166 50.1 1135.440308 2+ 2+ 2268.8644082151895 0 0.7287271644781662 Phosphorylation of Y (22: Doubtfull) Phosphorylation of Y (22: 7.097466240474155) Phosphorylation of Y (11: 0.0) 0 Y22-{Y6 Y11 Y22} 1 100.0 Confident
|
|
|
2439 2438 P49327 TGTVSLEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21526 (Experiment 1) 21526 45.518 481.26944 2+ 2+ 960.5240096600403 0 0.3297596045231612 99.1869918699187 Confident
|
|
|
2440 2439 P38646 VLENAEGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9687 (Experiment 1) 9687 28.011 479.75116 2+ 2+ 957.4879585044903 0 -0.19951809595194162 98.91598915989161 Confident
|
|
|
2441 2440 P06748 ADKDYHFKVDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21250 (Experiment 1) 21250 45.076 515.446533 5+ 5+ 2572.1942426127903 0 0.7915679452666027 100.0 Doubtful
|
|
|
2442 2441 P62753 DIPGLTDTTVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36537 (Experiment 1) 36537 63.375 642.843689 2+ 2+ 1283.6721304457103 0 0.5402721165322206 100.0 Confident
|
|
|
2443 2442 P0CG47, P0CG48, P62979, P62987 TLSDYNIQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20063 (Experiment 1) 20063 43.625 581.263489 2+ 2+ 1160.5114695481905 0 0.8219327283979636 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82578397212544) Y5 1 0 100.0 Confident
|
|
|
2444 2443 P52948 LYQTPLELK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35486 (Experiment 1) 35486 62.083 592.801453 2+ 2+ 1183.5889915929004 0 -0.5385666459703403 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.76898222940227) Y2 1 0 99.45799457994579 Confident
|
|
|
2445 2444 P62851 DKLNNLVLFDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38878 (Experiment 1) 38878 66.21 659.872742 2+ 2+ 1317.7292513990103 0 1.2727222966039067 99.1869918699187 Confident
|
|
|
2446 2445 P18621 EQIVPKPEEEVAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18586 (Experiment 1) 18586 41.776 541.95752 3+ 3+ 1622.8515513596608 0 -0.5048118176709612 100.0 Confident
|
|
|
2447 2446 P36542 THSDQFLVAFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35006 (Experiment 1) 35006 61.531 431.559174 3+ 3+ 1291.6560864587505 0 -0.3042140301617105 100.0 Confident
|
|
|
2448 2447 P26196 GVTQYYAYVTER Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37774 (Experiment 1) 37774 64.86 765.33783 2+ 2+ 1528.6599246870305 0 0.7724564319350236 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0, 8: 0.0) Phosphorylation of Y (5: 0.17452006980802792) 0 Y5-{Y5 Y6 Y8} 1 100.0 Confident
|
|
|
2449 2448 P61978 VVLIGGKPDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15854 (Experiment 1) 15854 38.141 527.324463 2+ 2+ 1052.63422881536 0 0.13677635469772673 99.74358974358975 Confident
|
|
|
2450 2449 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1 NMMAACDPR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15936 (Experiment 1) 15936 38.259 533.217529 2+ 2+ 1064.4201559218 0 0.3273942352229637 100.0 Confident
|
|
|
2451 2450 P60174 IIYGGSVTGATCK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21608 (Experiment 1) 21608 45.651 663.840454 2+ 2+ 1325.66493689029 0 1.0681614778510509 100.0 Confident
|
|
|
2452 2451 P13667 QLEPVYNSLAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29530 (Experiment 1) 29530 55.185 671.325012 2+ 2+ 1340.6377326904706 0 -1.6844451231992166 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.47643979057592) Y6 1 0 99.7289972899729 Confident
|
|
|
2453 2452 P35232 NVPVITGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17512 (Experiment 1) 17512 40.306 457.768982 2+ 2+ 913.52328138405 0 0.14164605891542836 99.73684210526315 Confident
|
|
|
2454 2453 P23246 GIVEFASKPAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21445 (Experiment 1) 21445 45.361 415.903076 3+ 3+ 1244.6877209402003 0 -0.25834589162643173 100.0 Confident
|
|
|
2455 2454 P68363, P68366, Q13748, Q71U36, Q9BQE3 LSVDYGKK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10368 (Experiment 1) 10368 29.317 495.2388 2+ 2+ 988.4630628037903 0 -0.01588871260041895 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
2456 2455 P07900, P08238, Q12931, Q58FF7 GVVDSEDLPLNISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40259 (Experiment 1) 40259 68.115 757.396484 2+ 2+ 1512.7783864194002 0 0.0189114794735476 100.0 Confident
|
|
|
2457 2456 TRYP_PIG VATVSLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22379 (Experiment 1) 22379 46.702 421.758514 2+ 2+ 841.5021520166501 0 0.382979642282311 100.0 Confident
|
|
|
2458 2457 P14618, P30613 GDLGIEIPAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35415 (Experiment 1) 35415 62.002 571.308777 2+ 2+ 1140.6026539035604 0 0.30383125101752484 100.0 Confident
|
|
|
2459 2458 P19338 EAMEDGEIDGNKVTLDWAKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34566 (Experiment 1) 34566 61.02 587.538086 4+ 4+ 2345.1209265601606 1 -0.4441032690389153 100.0 Doubtful
|
|
|
2460 2459 P12268 GMGSLDAMDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24657 (Experiment 1) 24657 49.51 512.725159 2+ 2+ 1023.4365171785903 0 -0.7334452480811608 99.1869918699187 Confident
|
|
|
2461 2460 O94921, P06239, P06241, P06493, P07947, P07948, P08631, P09769, P11362, P11802, P20794, P21802, P22455, P22607, P24941, P50750, P51451, Q00526, Q00534, Q00535, Q00536, Q00537, Q07002, Q14004, Q8IZL9, Q96Q40, Q9NYV4, Q9UPZ9 LADFGLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32801 (Experiment 1) 32801 58.973 431.742798 2+ 2+ 861.4708518883701 0 0.22140270682849605 99.74424552429667 Confident
|
|
|
2462 2461 P09874 VVSEDFLQDVSASTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42091 (Experiment 1) 42091 70.859 812.907898 2+ 2+ 1623.7991814336303 0 1.2680620799470503 93.65079365079364 Confident
|
|
|
2463 2462 Q969H8 SYLYFTQFK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45971 (Experiment 1) 45971 78.7 638.785217 2+ 2+ 1275.5576914646203 0 -1.4170613462005655 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 4: 0.0) Phosphorylation of Y (2: 18.32460732984293) 0 Y2-{Y2 Y4} 1 100.0 Confident
|
|
|
2464 2463 P31948 AAALEFLNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38444 (Experiment 1) 38444 65.685 502.780731 2+ 2+ 1003.5450794577903 0 1.819492874288432 100.0 Confident
|
|
|
2465 2464 P78371 HGINCFINR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20804 (Experiment 1) 20804 44.479 565.779907 2+ 2+ 1129.54509654113 0 0.1453968828005508 98.92761394101876 Confident
|
|
|
2466 2465 P23246 FAQHGTFEYEYSQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25344 (Experiment 1) 25344 50.308 614.919006 3+ 3+ 1841.7410285420403 0 -3.165687367983593 Phosphorylation of Y (9: Random) Phosphorylation of Y (9: 0.0, 11: 0.0) Phosphorylation of Y (9: 0.16155088852988692) 0 Y9-{Y9 Y11} 1 100.0 Confident
|
|
|
2467 2466 P68104, Q05639, Q5VTE0 QTVAVGVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21595 (Experiment 1) 21595 45.633 457.787262 2+ 2+ 913.5596668927701 0 0.3322216805386323 100.0 Confident
|
|
|
2468 2467 P41252 SDTPLIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24987 (Experiment 1) 24987 49.893 508.738556 2+ 2+ 1015.4627284506203 0 -0.1664747186443658 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.70759289176091) Y7 1 0 99.7289972899729 Confident
|
|
|
2469 2468 P63241, Q6IS14, Q9GZV4 KYEDICPSTHNMDVPNIKR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22559 (Experiment 1) 22559 46.924 580.031616 4+ 4+ 2316.09908600011 0 -0.744729263074561 100.0 Doubtful
|
|
|
2470 2469 P38646 VINEPTAAALAYGLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41939 (Experiment 1) 41939 70.596 823.44696 2+ 2+ 1644.8722868042403 0 4.299179497169731 100.0 Confident
|
|
|
2471 2470 P10412, P16402, P16403 KASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23457 (Experiment 1) 23457 48.006 442.926147 3+ 3+ 1325.7554661468505 0 0.8620351336073564 100.0 Confident
|
|
|
2472 2471 P04080 VFQSLPHENKPLTLSNYQTNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27945 (Experiment 1) 27945 53.338 615.324768 4+ 4+ 2457.26522272508 0 1.9272005043482283 100.0 Doubtful
|
|
|
2473 2472 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30295 (Experiment 1) 30295 56.072 609.260498 2+ 2+ 1216.5053215385904 0 0.9204017176637955 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 9.280802714116714) Phosphorylation of Y (6: 1.3961605584642234) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
2474 2473 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24179 (Experiment 1) 24179 48.937 420.235199 3+ 3+ 1257.68296991293 0 0.6327307030223298 99.28057553956835 Confident
|
|
|
2475 2474 Q96C19 VFNPYTEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38280 (Experiment 1) 38280 65.474 572.786316 2+ 2+ 1143.5600608155903 0 -1.7299171878919688 93.65079365079364 Confident
|
|
|
2476 2475 O60678 DFIYQNPHIFK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37704 (Experiment 1) 37704 64.78 501.23465 3+ 3+ 1500.6802662087905 0 1.2332168578016593 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2477 2476 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36262 (Experiment 1) 36262 63.054 630.798828 2+ 2+ 1259.5798834611805 0 2.5520128357789917 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.86914378029078) Y6 1 0 99.75247524752476 Confident
|
|
|
2478 2477 P35268 ITVTSEVPFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33174 (Experiment 1) 33174 59.396 604.332764 2+ 2+ 1206.6496040959805 0 1.134285638698398 100.0 Confident
|
|
|
2479 2478 Q8IYB8 NDIYSVSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15401 (Experiment 1) 15401 37.486 517.222412 2+ 2+ 1032.4277399242303 0 2.446866454463002 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 100.0 Confident
|
|
|
2480 2479 P16150 TGALVLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21170 (Experiment 1) 21170 44.956 408.750671 2+ 2+ 815.4865019525103 0 0.351209168643822 92.74611398963731 Confident
|
|
|
2481 2480 Q9NSD9 TYTIANQFPLNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39490 (Experiment 1) 39490 67.028 745.359375 2+ 2+ 1488.7013955761902 0 1.8792917513732155 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 83.03715670436188) Y2 1 0 90.78590785907859 Confident
|
|
|
2482 2481 P13639 ARPFPDGLAEDIDKGEVSAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34950 (Experiment 1) 34950 61.467 536.52533 4+ 4+ 2142.0705456698106 0 0.7774396403866254 100.0 Doubtful
|
|
|
2483 2482 P36578 PLISVYSEKGESSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22370 (Experiment 1) 22370 46.692 527.610901 3+ 3+ 1579.8093521945104 0 0.9611922429249274 100.0 Confident
|
|
|
2484 2483 P01903 ANLEIMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24382 (Experiment 1) 24382 49.19 460.249695 2+ 2+ 918.4844533471801 0 0.41685997848309464 99.47229551451187 Confident
|
|
|
2485 2484 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 KESYSIYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24562 (Experiment 1) 24562 49.401 680.315979 2+ 2+ 1358.6159346167303 0 1.0807119632563162 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 9.94210316877388) Phosphorylation of Y (4: 4.846526655896607) 0 Y4-{Y4 Y7 Y9} 1 99.45799457994579 Confident
|
|
|
2486 2485 Q06830 ATAVMPDGQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24569 (Experiment 1) 24569 49.408 582.788086 2+ 2+ 1163.5644945730303 0 -2.4670198563898174 93.12169312169311 Confident
|
|
|
2487 2486 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44320 (Experiment 1) 44320 74.942 935.933594 2+ 2+ 1869.85097291384 0 0.887965782182974 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2488 2487 P36578 SNYNLPMHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17459 (Experiment 1) 17459 40.235 552.268799 2+ 2+ 1102.5229641142203 0 0.07329054399348288 99.2084432717678 Confident
|
|
|
2489 2488 Q13151 AVPKEDIYSGGGGGGSR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12670 (Experiment 1) 12670 33.211 562.920898 3+ 3+ 1685.7410285420399 0 -0.09707844722406446 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2490 2489 P62805 DAVTYTEHAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10421 (Experiment 1) 10421 29.447 567.775024 2+ 2+ 1133.5353026197304 0 0.16947441329935936 100.0 Confident
|
|
|
2491 2490 P07900 YYTSASGDEMVSLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30881 (Experiment 1) 30881 56.746 775.855286 2+ 2+ 1549.6970248642103 0 -0.6481860733103827 96.22641509433963 Confident
|
|
|
2492 2491 P04350, P07437, P68371, Q13509, Q13885, Q9BVA1 EIVHIQAGQCGNQIGAK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20583 (Experiment 1) 20583 44.225 911.960205 2+ 2+ 1821.91556568189 0 -5.32290980621415 95.68733153638814 Doubtful
|
|
|
2493 2492 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 QIFHPEQLITGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36581 (Experiment 1) 36581 63.425 470.929749 3+ 3+ 1409.7666995368902 0 0.5082591337251731 92.14285714285715 Doubtful
|
|
|
2494 2493 Q15084 GSFSEQGINEFLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43728 (Experiment 1) 43728 73.635 742.363464 2+ 2+ 1482.71030685958 0 1.3929899417185816 99.45799457994579 Confident
|
|
|
2495 2494 Q13151 AVPKEDIYSGGGGGGSR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12509 (Experiment 1) 12509 32.96 562.920227 3+ 3+ 1685.7410285420399 0 -1.289075293060746 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2496 2495 P11021 NQLTSNPENTVFDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31159 (Experiment 1) 31159 57.073 839.408203 2+ 2+ 1676.8005784159607 0 0.7592559724390509 99.73333333333333 Confident
|
|
|
2497 2496 P00505 FVTVQTISGTGALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36580 (Experiment 1) 36580 63.424 725.406372 2+ 2+ 1448.79872794116 0 -0.3700509163736845 100.0 Confident
|
|
|
2498 2497 Q9BXY0 NEYSLTGLCNR Phosphorylation of Y(3) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29654 (Experiment 1) 29654 55.329 704.294556 2+ 2+ 1405.56972978364 1 1.0475002838140501 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2499 2498 P49321 EAQLYAAQAHLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21783 (Experiment 1) 21783 45.931 711.842957 2+ 2+ 1421.6704298010804 0 0.6541231428405239 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2500 2499 O43390 TLIEAGLPQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28055 (Experiment 1) 28055 53.465 535.315002 2+ 2+ 1068.61791004488 0 -2.2967531708278606 99.73890339425587 Confident
|
|
|
2501 2500 Q92841 GTAYTFFTPGNLK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44322 (Experiment 1) 44322 74.947 748.845398 2+ 2+ 1495.6748464751802 0 0.9324972162602393 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.72972972972973 Confident
|
|
|
2502 2501 P62829 GSAITGPVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12672 (Experiment 1) 12672 33.216 450.760834 2+ 2+ 899.5076313199104 0 -0.5726465120281943 100.0 Confident
|
|
|
2503 2502 P46776 LWTLVSEQTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39383 (Experiment 1) 39383 66.874 616.834839 2+ 2+ 1231.6560864587505 0 -0.7792942005117647 100.0 Confident
|
|
|
2504 2503 P07437 ISVYYNEATGGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24233 (Experiment 1) 24233 49.008 691.303589 2+ 2+ 1380.5962618013102 0 -2.630338845632644 Phosphorylation of Y (5: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.16155088852988692) 0 Y5-{Y4 Y5} 1 100.0 Confident
|
|
|
2505 2504 Q06830, Q13162 GLFIIDDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41662 (Experiment 1) 41662 70.167 460.757935 2+ 2+ 919.5014833103103 0 -0.18040264922894053 99.45799457994579 Confident
|
|
|
2506 2505 Q9P258 AGGAAVVITEPEHTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17181 (Experiment 1) 17181 39.839 493.931793 3+ 3+ 1478.7729071161405 0 0.4335846307565607 100.0 Confident
|
|
|
2507 2506 P49327 VLEALLPLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44288 (Experiment 1) 44288 74.824 498.329376 2+ 2+ 994.6426682407402 0 1.5359600104822015 99.72972972972973 Confident
|
|
|
2508 2507 Q86V81 SLGTADVHFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22851 (Experiment 1) 22851 47.266 616.3078 2+ 2+ 1230.5992998586205 0 1.4174818427401723 100.0 Confident
|
|
|
2509 2508 Q02543 SSGEIVYCGQVFEK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33553 (Experiment 1) 33553 59.833 801.878052 2+ 2+ 1601.7395583825305 0 1.242512072979723 100.0 Confident
|
|
|
2510 2509 P61981 YLAEVATGEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19833 (Experiment 1) 19833 43.33 540.782898 2+ 2+ 1079.5498900547102 0 1.2509764670182313 99.75247524752476 Confident
|
|
|
2511 2510 Q99961, Q99962 TIEYLQPNPASR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27002 (Experiment 1) 27002 52.228 734.84845 2+ 2+ 1467.6759091043402 0 4.380488410196695 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2512 2511 P26641 VLSAPPHFHFGQTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26082 (Experiment 1) 26082 51.169 427.723022 4+ 4+ 1706.8641221623802 0 -0.666335928832167 100.0 Doubtful
|
|
|
2513 2512 TRYP_PIG LSSPATLNSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16605 (Experiment 1) 16605 39.088 523.286133 2+ 2+ 1044.5563724174804 0 1.2809919164757542 99.45652173913044 Confident
|
|
|
2514 2513 P10768 SGYHQSASEHGLVVIAPDTSPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23530 (Experiment 1) 23530 48.101 577.789673 4+ 4+ 2307.124372147821 0 2.256009815198977 100.0 Doubtful
|
|
|
2515 2514 P48735 ATDFVADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17032 (Experiment 1) 17032 39.632 447.719391 2+ 2+ 893.4242956187702 0 -0.07432377351173133 99.1869918699187 Confident
|
|
|
2516 2515 P14868 IHDPQLLTER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20580 (Experiment 1) 20580 44.222 407.891541 3+ 3+ 1220.65133543148 0 1.1916319863653426 100.0 Confident
|
|
|
2517 2516 Q02543 KSSGEIVYCGQVFEK Phosphorylation of Y(8) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29212 (Experiment 1) 29212 54.819 604.609436 3+ 3+ 1809.8008519172806 1 1.2532083290339318 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2518 2517 Q16540 NYLEGIYNVPVAAVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45470 (Experiment 1) 45470 77.593 879.434998 2+ 2+ 1756.8549360954703 0 0.28823679563753074 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 18.402886808757653) Phosphorylation of Y (7: 82.16783216783216) 0 Y7-{Y2 Y7} 1 100.0 Confident
|
|
|
2519 2518 O43933, P55072, Q8IYT4 GILLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38442 (Experiment 1) 38442 65.681 626.820374 2+ 2+ 1251.6264397307802 0 -0.19516305369290757 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2520 2519 O00231 TTANAIYCPPK Phosphorylation of Y(7) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16604 (Experiment 1) 16604 39.085 658.291016 2+ 2+ 1314.5679388784902 0 -0.34924671803388185 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2521 2520 O43615 DQDELNPYAAWR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39973 (Experiment 1) 39973 67.704 779.323059 2+ 2+ 1556.6296871879103 0 1.2048153241478612 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 96.76898222940227) Y8 1 0 99.4949494949495 Confident
|
|
|
2522 2521 O00483 FYSVNVDYSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30306 (Experiment 1) 30306 56.085 651.275635 2+ 2+ 1300.5376842960302 0 -0.7425649634320436 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 17.26598817399075) Phosphorylation of Y (2: 100.0) 0 Y2-{Y2 Y8} 1 100.0 Confident
|
|
|
2523 2522 P28066 GVNTFSPEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18728 (Experiment 1) 18728 41.958 532.263245 2+ 2+ 1062.50942222506 0 2.3624092782316555 99.72972972972973 Confident
|
|
|
2524 2523 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33716 (Experiment 1) 33716 60.018 630.797546 2+ 2+ 1259.5798834611805 0 0.5196639874280117 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2525 2524 P49773 MVVNEGSDGGQSVYHVHLHVLGGR Phosphorylation of Y(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29211 (Experiment 1) 29211 54.817 657.560059 4+ 4+ 2626.2111692377603 0 -0.014867466225281411 Phosphorylation of Y (14: Very Confident) Phosphorylation of Y (14: 100.0) Phosphorylation of Y (14: 100.0) Y14 1 0 100.0 Doubtful
|
|
|
2526 2525 P62273 GHQQLYWSHPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15187 (Experiment 1) 15187 37.15 470.233734 3+ 3+ 1407.6796158679902 0 -0.1724450109085301 100.0 Confident
|
|
|
2527 2526 P35637, Q92804 AAIDWFDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42441 (Experiment 1) 42441 71.4 511.75058 2+ 2+ 1021.4868958753302 0 -0.2821773769312151 100.0 Confident
|
|
|
2528 2527 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 KESYSIYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24640 (Experiment 1) 24640 49.49 453.879333 3+ 3+ 1358.6159346167303 0 0.17257367551797848 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 9.952880760141328) Phosphorylation of Y (4: 60.20942408376963) 0 Y4-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
2529 2528 P11142 SQIHDIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27602 (Experiment 1) 27602 52.941 494.607544 3+ 3+ 1480.79979057032 0 0.6820423900320418 100.0 Confident
|
|
|
2530 2529 P45880 VNNSSLIGVGYTQTLRPGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33631 (Experiment 1) 33631 59.922 701.727783 3+ 3+ 2102.1484020676903 0 6.231102681162295 100.0 Doubtful
|
|
|
2531 2530 O43423, P39687 VSGGLEVLAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31595 (Experiment 1) 31595 57.589 551.311584 2+ 2+ 1100.6077392840004 0 0.7942723284927337 99.7289972899729 Confident
|
|
|
2532 2531 P26038 ALTSELANARDESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19380 (Experiment 1) 19380 42.76 502.258881 3+ 3+ 1503.7528999475503 0 1.270031927408329 100.0 Confident
|
|
|
2533 2532 P23528 NIILEEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23146 (Experiment 1) 23146 47.62 458.260559 2+ 2+ 914.5072969667403 0 -0.7985629195173242 99.46091644204851 Confident
|
|
|
2534 2533 Q13263 VLVNDAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9827 (Experiment 1) 9827 28.248 443.753601 2+ 2+ 885.4919812557703 0 0.7524571145031986 99.73614775725594 Confident
|
|
|
2535 2534 P07900, P08238, Q58FF6, Q58FF7 EDQTEYLEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21920 (Experiment 1) 21920 46.127 656.288147 2+ 2+ 1310.5626395663803 0 -0.6845311724368313 100.0 Confident
|
|
|
2536 2535 P78347, Q6EKJ0, Q86UP8 EQVNDLFSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32414 (Experiment 1) 32414 58.53 554.278259 2+ 2+ 1106.5356369729002 0 5.708441109276413 99.45652173913044 Doubtful
|
|
|
2537 2536 P22234 EVTPEGLQMVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30709 (Experiment 1) 30709 56.546 615.823547 2+ 2+ 1229.6325741328503 0 -0.026847360592747452 95.32467532467533 Confident
|
|
|
2538 2537 P49327 RVYATILNAGTNTDGFK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35594 (Experiment 1) 35594 62.208 640.978516 3+ 3+ 1919.91424187674 0 -0.2721240627742903 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2539 2538 P04406 VVDLMAHMASKE ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28881 (Experiment 1) 28881 54.441 444.221252 3+ 3+ 1329.6420932707306 0 -0.12506616541559545 100.0 Confident
|
|
|
2540 2539 P08238, Q58FF8 SIYYITGESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28548 (Experiment 1) 28548 54.052 580.795898 2+ 2+ 1159.5761048025502 0 0.9799181992751365 100.0 Confident
|
|
|
2541 2540 P26358 GAQYQPILR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22773 (Experiment 1) 22773 47.177 563.27655 2+ 2+ 1124.53795907955 0 0.5219346808771338 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.03069466882067) Y4 1 0 99.74489795918367 Confident
|
|
|
2542 2541 Q1KMD3 NYYGYQGYR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24046 (Experiment 1) 24046 48.77 632.244934 2+ 2+ 1262.47575274581 0 -0.34613111095673443 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 5: 0.0, 8: 0.0) Phosphorylation of Y (3: 73.47294938917976) 0 Y3-{Y2 Y3 Y5 Y8} 1 96.19565217391303 Confident
|
|
|
2543 2542 Q9UN86 QYYTLLNK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33297 (Experiment 1) 33297 59.536 561.765442 2+ 2+ 1121.51582665264 0 0.4489542472462435 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 0.0) 0 Y2-{Y2 Y3} 1 93.76693766937669 Confident
|
|
|
2544 2543 P31942, P31943, P55795 GLPFGCSK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26012 (Experiment 1) 26012 51.085 433.215912 2+ 2+ 864.41637378736 0 1.0356036336790926 99.7289972899729 Confident
|
|
|
2545 2544 Q9UKM9 SSELQAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16782 (Experiment 1) 16782 39.306 438.2453 2+ 2+ 874.4759968384603 0 0.057305712805226866 93.65079365079364 Confident
|
|
|
2546 2545 P22626 DYFEEYGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31008 (Experiment 1) 31008 56.895 525.724854 2+ 2+ 1049.4341915961302 0 0.9163264027764916 99.73045822102425 Confident
|
|
|
2547 2546 P31146 RCEPIAMTVPR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22512 (Experiment 1) 22512 46.867 443.897003 3+ 3+ 1328.66931107808 0 -0.0987304879482008 100.0 Confident
|
|
|
2548 2547 P37802, Q9UI15 GASQAGMTGYGMPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23930 (Experiment 1) 23930 48.627 692.310181 2+ 2+ 1382.60710474434 0 -0.9357631790774013 100.0 Confident
|
|
|
2549 2548 Q13347 SGEVLVNVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21252 (Experiment 1) 21252 45.079 472.774078 2+ 2+ 943.5338460677501 0 -0.2569951726895924 99.7289972899729 Confident
|
|
|
2550 2549 P07900, P08238, Q58FF6, Q58FF7, Q58FF8 IRYESLTDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20188 (Experiment 1) 20188 43.771 436.898254 3+ 3+ 1307.6721304457103 0 0.6120069813073664 100.0 Confident
|
|
|
2551 2550 P62277 GLSQSALPYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25685 (Experiment 1) 25685 50.711 546.295654 2+ 2+ 1090.57710786206 0 -0.3228980202325791 100.0 Confident
|
|
|
2552 2551 P04406 GALQNIIPASTGAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34484 (Experiment 1) 34484 60.924 706.39978 2+ 2+ 1410.7830778770206 0 1.3655100441502206 100.0 Confident
|
|
|
2553 2552 P62993 FNSLNELVDYHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37042 (Experiment 1) 37042 63.979 502.916382 3+ 3+ 1505.7262912768904 0 0.679585054336052 99.24812030075188 Confident
|
|
|
2554 2553 P13073 DHPLPEVAHVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15416 (Experiment 1) 15416 37.503 414.559235 3+ 3+ 1240.6564208119205 0 -0.438386983489363 100.0 Confident
|
|
|
2555 2554 Q99497 VTVAGLAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20749 (Experiment 1) 20749 44.416 408.253143 2+ 2+ 814.4912529797803 0 0.5879769530044405 100.0 Confident
|
|
|
2556 2555 P19338 GFGFVDFNSEEDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44178 (Experiment 1) 44178 74.533 781.344116 2+ 2+ 1560.6732526445203 0 0.272877188913979 100.0 Confident
|
|
|
2557 2556 P62854, Q5JNZ5 LHYCVSCAIHSK Phosphorylation of Y(3) Carbamidomethylation of C(4, 7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15266 (Experiment 1) 15266 37.273 518.891357 3+ 3+ 1553.6520199389604 0 0.1423937350375415 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2558 2557 ALDOA_RABIT, P04075, P09972 YASICQQNGIVPIVEPEILPDGDHDLKR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43578 (Experiment 1) 43578 73.385 795.154114 4+ 4+ 3175.5971981821403 1 -4.152339277012637 100.0 Doubtful
|
|
|
2559 2558 Q63HK5 EKAVTDEKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34223 (Experiment 1) 34223 60.62 572.81427 2+ 2+ 1143.6135529404303 0 0.37894142372839895 99.1869918699187 Confident
|
|
|
2560 2559 P08865 AIVAIENPADVSVISSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41320 (Experiment 1) 41320 69.635 870.978821 2+ 2+ 1739.9417633463904 0 0.7610523714780747 100.0 Confident
|
|
|
2561 2560 O95185, Q8IZJ1 LSDTANYTCVAK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30309 (Experiment 1) 30309 56.088 671.818237 2+ 2+ 1341.6234660011303 0 -1.1498147066014364 98.73417721518987 Confident
|
|
|
2562 2561 P49327 AGLYGLPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32141 (Experiment 1) 32141 58.216 463.728455 2+ 2+ 925.4422677895602 0 0.09625980839393838 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65034965034964) Y4 1 0 100.0 Confident
|
|
|
2563 2562 Q02790 VLQLYPNNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27000 (Experiment 1) 27000 52.226 544.809631 2+ 2+ 1087.6025943339102 0 1.9408032177597743 99.47089947089947 Confident
|
|
|
2564 2563 Q15029 VVYSAFLMATPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44910 (Experiment 1) 44910 76.367 717.846497 2+ 2+ 1433.6778236806401 0 0.4300264776626594 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2565 2564 Q06830 DISLSDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27590 (Experiment 1) 27590 52.927 510.718048 2+ 2+ 1019.4212575614604 0 0.27951332114050303 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
2566 2565 P04350, P07437, P68371, Q13509 IMNTFSVVPSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37170 (Experiment 1) 37170 64.129 660.355347 2+ 2+ 1318.6955087425804 0 0.4787756328354797 100.0 Confident
|
|
|
2567 2566 P07900, P08238, Q14568 HNDDEQYAWESSAGGSFTVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37046 (Experiment 1) 37046 63.982 779.306091 3+ 3+ 2334.9178832566904 0 -9.170320778776741 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.68411867364746) Y7 1 0 97.74436090225565 Doubtful
|
|
|
2568 2567 P29401 TSRPENAIIYNNNEDFQVGQAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31814 (Experiment 1) 31814 57.844 863.397888 3+ 3+ 2587.17040954125 0 0.5501747292083244 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
2569 2568 P62899 EYTINIHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19177 (Experiment 1) 19177 42.52 509.271606 2+ 2+ 1016.5290950404803 0 -0.4280367415652359 99.19354838709677 Confident
|
|
|
2570 2569 Q96JB5 QYGITGENVR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19656 (Experiment 1) 19656 43.102 608.772278 2+ 2+ 1215.5285165946602 0 1.2208781380157945 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 99.1869918699187 Confident
|
|
|
2571 2570 P07900, P08238, Q14568, Q58FF7, Q58FF8 YESLTDPSKLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22517 (Experiment 1) 22517 46.874 513.92395 3+ 3+ 1538.7464175847801 0 2.3369366899119215 100.0 Confident
|
|
|
2572 2571 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38798 (Experiment 1) 38798 66.115 931.481506 2+ 2+ 1860.9498991094704 0 -0.7729847410724888 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 94.24083769633508) Y5 1 0 97.57412398921834 Confident
|
|
|
2573 2572 O00299 NSNPALNDNLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18159 (Experiment 1) 18159 41.213 664.82605 2+ 2+ 1327.6368075661505 0 0.5561609962615554 99.74358974358975 Confident
|
|
|
2574 2573 P23528, Q9Y281 YALYDATYETK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32748 (Experiment 1) 32748 58.912 709.299316 2+ 2+ 1416.5850284112705 0 -0.6692127272495472 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 23.886254776734564) Phosphorylation of Y (8: 0.0) 0 Y8-{Y1 Y4 Y8} 1 100.0 Confident
|
|
|
2575 2574 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29478 (Experiment 1) 29478 55.123 528.262329 2+ 2+ 1054.5100129962104 0 0.08714436789640084 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
2576 2575 P84090 ADTQTYQPYNK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11371 (Experiment 1) 11371 31.131 704.792542 2+ 2+ 1407.5707753294603 0 -0.1732871926737864 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 9.677620972789686) Phosphorylation of Y (6: 5.5846422338568935) 0 Y9-{Y6 Y9} 1 100.0 Confident
|
|
|
2577 2576 P53701 TYSVPAHQER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8635 (Experiment 1) 8635 25.852 423.186371 3+ 3+ 1266.5394156315303 0 -1.6793455019636805 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
2578 2577 P10696 VQHASPAGAYAHTVNR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8773 (Experiment 1) 8773 26.156 586.940674 3+ 3+ 1757.7998808308407 0 0.177058654602688 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
2579 2578 Q14807 STQQDIYAGSVQPILR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37250 (Experiment 1) 37250 64.222 928.452087 2+ 2+ 1854.8876927757303 0 1.0384448885195459 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2580 2579 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24917 (Experiment 1) 24917 49.809 757.292175 3+ 3+ 2268.8644082151895 0 -4.275132911457174 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 12.82958457065266) Phosphorylation of Y (6: 4.091776693253489) 0 Y6-{Y6 Y11 Y22} 1 100.0 Doubtful
|
|
|
2581 2580 P55769 LLDLVQQSCNYK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35598 (Experiment 1) 35598 62.213 740.876709 2+ 2+ 1479.7391644597103 0 -0.20205337157571723 100.0 Confident
|
|
|
2582 2581 O60711 TYCQPCFNK Phosphorylation of Y(2) Carbamidomethylation of C(3, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18158 (Experiment 1) 18158 41.212 649.240417 2+ 2+ 1296.4668449382302 0 -0.4342548575086971 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2583 2582 GSTP1_HUMAN, P09211 PPYTVVYFPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43986 (Experiment 1) 43986 74.111 669.36676 2+ 2+ 1336.7179584393202 0 0.7534194075793103 100.0 Confident
|
|
|
2584 2583 P50995 NTPAFFAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32060 (Experiment 1) 32060 58.126 526.760864 2+ 2+ 1051.5086939490702 0 -1.4417173032688804 100.0 Confident
|
|
|
2585 2584 P09651, Q32P51 DYFEQYGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27342 (Experiment 1) 27342 52.624 565.215576 2+ 2+ 1128.4165065341901 0 0.08185566474189057 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 9.906311311625508) Phosphorylation of Y (2: 64.28181330013791) 0 Y6-{Y2 Y6} 1 98.92761394101876 Confident
|
|
|
2586 2585 P10809 VTDALNATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13549 (Experiment 1) 13549 34.566 480.759338 2+ 2+ 959.5036085686302 0 0.5350889525951751 100.0 Confident
|
|
|
2587 2586 C9J202, Q9BT22 AVTVYDKPASFFK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35817 (Experiment 1) 35817 62.483 518.253479 3+ 3+ 1551.7374467317406 0 0.7466543798648579 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.28057553956835 Confident
|
|
|
2588 2587 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38729 (Experiment 1) 38729 66.03 621.323975 3+ 3+ 1860.9498991094704 0 0.10541473916500246 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
2589 2588 P25398 TALIHDGLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18803 (Experiment 1) 18803 42.053 533.804138 2+ 2+ 1065.59309227937 0 0.5908415967267642 99.73614775725594 Confident
|
|
|
2590 2589 Q01081 AVIDLNNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22298 (Experiment 1) 22298 46.606 457.75351 2+ 2+ 913.4981292653702 0 -6.184730265515627 90.2439024390244 Doubtful
|
|
|
2591 2590 P11142 NSLESYAFNMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40813 (Experiment 1) 40813 68.907 692.286194 2+ 2+ 1382.5577681176103 0 0.04835339013280003 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2592 2591 Q9BQA1 YEHDDIVSTVSVLSSGTQAVSGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41585 (Experiment 1) 41585 70.039 822.738464 3+ 3+ 2465.1921769241203 0 0.561408143745543 92.85714285714286 Doubtful
|
|
|
2593 2592 P63244 VWNLANCK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27341 (Experiment 1) 27341 52.623 502.752258 2+ 2+ 1003.49093570995 0 -0.9673180156097667 99.73474801061008 Confident
|
|
|
2594 2593 P61201 ALYEQSLHIK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24835 (Experiment 1) 24835 49.715 641.31665 2+ 2+ 1280.6166033230704 0 1.6713638172119207 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.38219895287958) Y3 1 0 97.289972899729 Confident
|
|
|
2595 2594 Q9UMS4 FIASTGMDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20146 (Experiment 1) 20146 43.725 499.241577 2+ 2+ 996.4698659122 0 -1.2667657101625767 95.2127659574468 Confident
|
|
|
2596 2595 P48047 LVRPPVQVYGIEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31679 (Experiment 1) 31679 57.685 528.640625 3+ 3+ 1581.8991106887702 1 -1.5268439863769767 100.0 Confident
|
|
|
2597 2596 O15042 LYSILQGDSPTK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35332 (Experiment 1) 35332 61.906 701.34198 2+ 2+ 1400.6588620578702 0 7.5177930892425415 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Doubtful
|
|
|
2598 2597 P06733 TIAPALVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22033 (Experiment 1) 22033 46.272 450.281403 2+ 2+ 898.5487678559002 0 -0.5716305697046051 100.0 Confident
|
|
|
2599 2598 P07339 YYTVFDRDNNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26013 (Experiment 1) 26013 51.087 514.883423 3+ 3+ 1541.6300215410802 0 -1.024141145527841 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 3.4904013961605584) 0 Y2-{Y1 Y2} 1 100.0 Confident
|
|
|
2600 2599 Q9H299 VYSTSVTGSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11301 (Experiment 1) 11301 31.018 568.753479 2+ 2+ 1135.4910684567803 0 1.1750355957111267 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2601 2600 O43390 DYAFVHFEDR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37771 (Experiment 1) 37771 64.857 460.186432 3+ 3+ 1377.5390812783603 0 -1.1695817140163538 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
2602 2601 P22626 NYYEQWGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27949 (Experiment 1) 27949 53.342 584.229065 2+ 2+ 1166.4433899883702 0 0.1601067516132033 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 10.471204188481677) 0 Y2-{Y2 Y3} 1 93.76693766937669 Confident
|
|
|
2603 2602 P06493, P24941, Q00526 IGEGTYGVVYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27864 (Experiment 1) 27864 53.246 633.299988 2+ 2+ 1264.5740698047505 0 8.963653566379959 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 16.033061460567254) Phosphorylation of Y (10: 96.33507853403141) 0 Y10-{Y6 Y10} 1 96.19565217391303 Doubtful
|
|
|
2604 2603 P13639 TGTITTFEHAHNMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17893 (Experiment 1) 17893 40.802 404.695374 4+ 4+ 1614.7572741353406 0 -3.017076650094343 72.72727272727273 Doubtful
|
|
|
2605 2604 P11142 VCNPIITK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18793 (Experiment 1) 18793 42.04 472.765991 2+ 2+ 943.5160878286301 0 1.4185026778589946 100.0 Confident
|
|
|
2606 2605 P08865 KSDGIYIINLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39099 (Experiment 1) 39099 66.484 448.570221 3+ 3+ 1342.6897682633303 0 -0.6945498335784753 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 96.4458804523425) Y6 1 0 98.49624060150376 Confident
|
|
|
2607 2606 P36578 RGPCIIYNEDNGIIK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30299 (Experiment 1) 30299 56.076 587.97113 3+ 3+ 1760.88795395172 0 2.044689517711012 100.0 Confident
|
|
|
2608 2607 P07954 YYGAQTVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13945 (Experiment 1) 13945 35.19 479.242371 2+ 2+ 956.4715801643601 0 -1.4513490973382506 97.289972899729 Confident
|
|
|
2609 2608 P49327 GLVQALQTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27208 (Experiment 1) 27208 52.467 479.290161 2+ 2+ 956.5654805492002 0 0.3009839198125458 99.49367088607595 Confident
|
|
|
2610 2609 Q8N6M0 HAYGLGEHYNSVTR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15417 (Experiment 1) 15417 37.505 561.914551 3+ 3+ 1682.7202335278103 0 0.9432473619311031 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 7.698043197994125) Phosphorylation of Y (9: 96.33507853403141) 0 Y9-{Y3 Y9} 1 96.32352941176471 Confident
|
|
|
2611 2610 P22087 ANCIDSTASAEAVFASEVKK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37773 (Experiment 1) 37773 64.859 700.009094 3+ 3+ 2097.004834178761 0 0.2944823574756417 100.0 Confident
|
|
|
2612 2611 Q9H0D6 YYYQGCASWK Phosphorylation of Y(2) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30960 (Experiment 1) 30960 56.839 703.267883 2+ 2+ 1404.5209886860703 0 0.15952693615911798 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 4.712041884816754) 0 Y2-{Y1 Y2 Y3} 1 94.90616621983914 Confident
|
|
|
2613 2612 O15372 EFTAQNLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20661 (Experiment 1) 20661 44.312 504.261078 2+ 2+ 1006.5083595959002 0 -0.7501361790572136 99.72826086956522 Confident
|
|
|
2614 2613 P15531, P22392 TFIAIKPDGVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26015 (Experiment 1) 26015 51.089 672.884949 2+ 2+ 1343.7561348531901 0 -0.5868658170621762 100.0 Confident
|
|
|
2615 2614 O75347 LEAAYLDLQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37293 (Experiment 1) 37293 64.274 636.306152 2+ 2+ 1270.59586787849 0 1.4797834867813606 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 99.74293059125964 Confident
|
|
|
2616 2615 P48735 LVPGWTKPITIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35597 (Experiment 1) 35597 62.212 479.956696 3+ 3+ 1436.8503695912 0 -1.4660965309543026 100.0 Confident
|
|
|
2617 2616 P62995 AAQDRDQIYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9246 (Experiment 1) 9246 27.154 658.292969 2+ 2+ 1314.5717783889702 0 -0.298744248693474 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 90.22687609075044) Y9 1 0 94.03794037940379 Confident
|
|
|
2618 2617 P40926 IFGVTTLDIVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46695 (Experiment 1) 46695 79.867 617.363831 2+ 2+ 1232.7128730588802 0 0.1911413731635177 93.1758530183727 Confident
|
|
|
2619 2618 Q02790 EGTGTEMPMIGDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30706 (Experiment 1) 30706 56.543 697.310852 2+ 2+ 1392.60135065756 0 4.159144321238667 100.0 Confident
|
|
|
2620 2619 Q8IWS0 EKPSQGIYMVYCR Phosphorylation of Y(8) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30360 (Experiment 1) 30360 56.146 570.917053 3+ 3+ 1709.7306641824803 0 -0.7792036042075771 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 13.739487640234529) Phosphorylation of Y (8: 99.82547993019197) 0 Y8-{Y8 Y11} 1 100.0 Confident
|
|
|
2621 2620 Q14141, Q16181, Q6ZU15, Q92599, Q9NVA2 VNIIPIIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41582 (Experiment 1) 41582 70.035 490.828644 2+ 2+ 979.6430025939103 0 -0.2725263333567613 99.45799457994579 Confident
|
|
|
2622 2621 P19338 NDLAVVDVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28284 (Experiment 1) 28284 53.743 500.774445 2+ 2+ 999.5349086969102 0 -0.5707461847543397 100.0 Confident
|
|
|
2623 2622 P02787, P02788, TRFE_HUMAN YYGYTGAFR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33257 (Experiment 1) 33257 59.49 589.238098 2+ 2+ 1176.4641254329501 0 -2.106416195542864 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.9693053311793215) 0 Y2-{Y1 Y2 Y4} 1 100.0 Confident
|
|
|
2624 2623 P36578 LDELYGTWR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39571 (Experiment 1) 39571 67.141 616.769897 2+ 2+ 1231.5274539655002 0 -1.7939390080851778 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.09208400646203) Y5 1 0 99.72972972972973 Confident
|
|
|
2625 2624 P04350, P07437, P68371, Q13509, Q13885, Q9BVA1 ISEQFTAMFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42791 (Experiment 1) 42791 72.07 615.30304 2+ 2+ 1228.5910436740403 0 0.3928084976326694 100.0 Confident
|
|
|
2626 2625 Q13263 MNEAFGDTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15934 (Experiment 1) 15934 38.256 506.723419 2+ 2+ 1011.4331460503101 0 -0.8495593161507948 100.0 Confident
|
|
|
2627 2626 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38363 (Experiment 1) 38363 65.585 952.978271 2+ 2+ 1903.9444793758603 0 -1.3065912972489235 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 95.79967689822294) Y5 1 0 98.92183288409704 Confident
|
|
|
2628 2627 P11388, Q02880 ELILFSNSDNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40816 (Experiment 1) 40816 68.911 718.85321 2+ 2+ 1435.6943224422703 0 -1.7078394218023771 92.43243243243244 Confident
|
|
|
2629 2628 P62750 LYDIDVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29133 (Experiment 1) 29133 54.73 468.755249 2+ 2+ 935.4963979298705 0 -0.48304875155965027 99.45799457994579 Confident
|
|
|
2630 2629 P31948 TYEEGLKHEANNPQLK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14882 (Experiment 1) 14882 36.619 650.970459 3+ 3+ 1949.8884210517203 0 0.5768559222943156 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2631 2630 Q9UK99 NKNEVFYQCPDQMAR Phosphorylation of Y(7) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25903 (Experiment 1) 25903 50.96 660.609619 3+ 3+ 1978.8066826570503 0 0.17405265471855302 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 99.37888198757764 Confident
|
|
|
2632 2631 P38159 SDLYSSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11890 (Experiment 1) 11890 31.926 442.708923 2+ 2+ 883.40356017419 0 -0.3016742146372353 96.21621621621621 Confident
|
|
|
2633 2632 Q07955 VKVDGPRSPSYGR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11372 (Experiment 1) 11372 31.134 499.911713 3+ 3+ 1496.7136915953902 0 -0.25470879419227094 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 94.76439790575917) Y11 1 0 92.99363057324841 Doubtful
|
|
|
2634 2633 P37235, P84074 IYANFFPYGDASK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45572 (Experiment 1) 45572 77.823 786.841431 2+ 2+ 1571.6697610947404 0 -0.9226935489327737 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 8: 0.0) Phosphorylation of Y (2: 91.59935379644588) 0 Y2-{Y2 Y8} 1 98.9247311827957 Confident
|
|
|
2635 2634 P08134, P61586 HFCPNVPIILVGNKK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33377 (Experiment 1) 33377 59.629 579.326599 3+ 3+ 1734.9603310463403 0 -1.359879767625159 98.49624060150376 Confident
|
|
|
2636 2635 Q00839 SSGPTSLFAVTVAPPGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43982 (Experiment 1) 43982 74.105 857.959473 2+ 2+ 1713.9049839148504 0 -0.34433343862712745 100.0 Confident
|
|
|
2637 2636 P11586 KITIGQAPTEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13809 (Experiment 1) 13809 34.952 593.345581 2+ 2+ 1184.6764875501601 0 0.10239920220827253 92.14092140921409 Confident
|
|
|
2638 2637 Q08211 AAECNIVVTQPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20405 (Experiment 1) 20405 44.014 679.851929 2+ 2+ 1356.6819839367602 1 2.919188875554476 100.0 Confident
|
|
|
2639 2638 P61247 APAMFNIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33840 (Experiment 1) 33840 60.161 460.244446 2+ 2+ 918.4745573698201 0 -0.23716026796421896 100.0 Confident
|
|
|
2640 2639 P53621 KDMSGHYQNALYLGDVSER Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29739 (Experiment 1) 29739 55.426 755.000793 3+ 3+ 2261.9776470622805 0 1.2814737104966953 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 9.750654092385615) Phosphorylation of Y (7: 18.93542757417103) 0 Y7-{Y7 Y12} 1 99.25373134328358 Confident
|
|
|
2641 2640 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20404 (Experiment 1) 20404 44.013 514.767517 2+ 2+ 1027.5120650773501 0 8.174620139464173 99.7289972899729 Doubtful
|
|
|
2642 2641 P52565 AEEYEFLTPVEEAPK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42794 (Experiment 1) 42794 72.073 611.274109 3+ 3+ 1830.7964777294908 0 2.1920765309466352 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 99.37888198757764 Confident
|
|
|
2643 2642 P10412, P16402, P16403 KASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23450 (Experiment 1) 23450 47.997 663.885071 2+ 2+ 1325.7554661468505 0 0.09257591576236822 100.0 Confident
|
|
|
2644 2643 P11142 SQIHDIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27382 (Experiment 1) 27382 52.674 494.607147 3+ 3+ 1480.79979057032 0 -0.12061473804379222 100.0 Confident
|
|
|
2645 2644 Q9C0C9 VQSCPDPAVYGVVQSGDHIGR Phosphorylation of Y(10) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32934 (Experiment 1) 32934 59.121 774.35321 3+ 3+ 2320.0307452643005 0 3.0370966804777426 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
2646 2645 P52565 AEEYEFLTPVEEAPK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42942 (Experiment 1) 42942 72.341 916.40686 2+ 2+ 1830.7964777294908 0 1.4673290591206263 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2647 2646 P26599 NNQFQALLQYADPVSAQHAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46093 (Experiment 1) 46093 78.909 775.035522 3+ 3+ 2322.07940970888 0 2.291036017794652 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 97.03315881326353) Y10 1 0 92.46575342465754 Doubtful
|
|
|
2648 2647 Q13813 EQADYCVSHMKPYVDGK Phosphorylation of Y(5) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23104 (Experiment 1) 23104 47.572 702.959717 3+ 3+ 2105.8587777995604 0 -0.6905085056141339 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 4.735688234533786) Phosphorylation of Y (5: 3.392568659127625) 0 Y5-{Y5 Y13} 1 100.0 Confident
|
|
|
2649 2648 P07900, P08238, Q58FF7, Q58FF8 IRYESLTDPSKLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24319 (Experiment 1) 24319 49.117 603.651672 3+ 3+ 1807.9315925855103 0 0.8802070965020535 100.0 Confident
|
|
|
2650 2649 P62805 KTVTAMDVVYALK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45570 (Experiment 1) 45570 77.818 759.886292 2+ 2+ 1517.7564679241605 0 1.0285379797302354 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
2651 2650 DHE3_BOVIN, P00367 HGGTIPIVPTAEFQDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34703 (Experiment 1) 34703 61.174 579.970581 3+ 3+ 1736.8845828234403 0 3.0638292304215344 100.0 Confident
|
|
|
2652 2651 P52209 TIFQGIAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30964 (Experiment 1) 30964 56.845 474.779999 2+ 2+ 947.5440168286304 0 1.5041070567592714 99.74811083123426 Confident
|
|
|
2653 2652 P04264 AQYEDIAQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13278 (Experiment 1) 13278 34.12 573.24646 2+ 2+ 1144.4801694199105 0 -1.5720556750455166 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 96.19565217391303 Confident
|
|
|
2654 2653 Q53QZ3 VSGNLATIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17114 (Experiment 1) 17114 39.747 515.798462 2+ 2+ 1029.5818588893303 0 0.49648975085941477 96.19565217391303 Confident
|
|
|
2655 2654 Q96G03 IVLANDPDADRLAVAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29392 (Experiment 1) 29392 55.026 603.995911 3+ 3+ 1808.9632270669604 0 1.4771273052279075 92.99363057324841 Doubtful
|
|
|
2656 2655 Q08211 LFTAHNNMTNYATVWASK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40066 (Experiment 1) 40066 67.82 716.992981 3+ 3+ 2147.9499757624603 0 3.318424298394629 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.82547993019197) Y11 1 0 99.28057553956835 Confident
|
|
|
2657 2656 Q15366 GVTIPYRPKPSSSPVIFAGGQDR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33255 (Experiment 1) 33255 59.487 628.069885 4+ 4+ 2508.25262304358 0 -0.8712839818954262 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.67689822294022) Y6 1 0 100.0 Doubtful
|
|
|
2658 2657 P49411 TVVTGIEMFHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32936 (Experiment 1) 32936 59.123 421.225281 3+ 3+ 1260.6536439306005 0 0.29253473009207404 100.0 Confident
|
|
|
2659 2658 P46063 YKGQSGIIYCFSQK Phosphorylation of Y(9) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34225 (Experiment 1) 34225 60.624 586.93512 3+ 3+ 1757.7848079303203 0 -0.7254236377565587 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 5.091376872673607) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y1 Y9} 1 100.0 Confident
|
|
|
2660 2659 P11021 ITPSYVAFTPEGER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36400 (Experiment 1) 36400 63.219 783.894165 2+ 2+ 1565.7725727629706 0 0.7681549271347062 99.45652173913044 Confident
|
|
|
2661 2660 P04406 IISNASCTTNCLAPLAK Carbamidomethylation of C(7, 11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30487 (Experiment 1) 30487 56.29 611.97821 3+ 3+ 1832.9124544474003 0 0.18854278536046573 100.0 Confident
|
|
|
2662 2661 P62249 ALVAYYQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22896 (Experiment 1) 22896 47.318 478.264893 2+ 2+ 954.5174677276202 0 -2.3362116436448335 100.0 Confident
|
|
|
2663 2662 P20039 AVTELGRPDEEYWNSQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29610 (Experiment 1) 29610 55.277 674.658386 3+ 3+ 2020.9490335548005 0 2.1220882384482564 92.7536231884058 Doubtful
|
|
|
2664 2663 P13473 IPLNDLFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43980 (Experiment 1) 43980 74.103 494.284698 2+ 2+ 986.5549158655001 0 -0.0736408783992141 99.45652173913044 Confident
|
|
|
2665 2664 P13798 VVFDSAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16784 (Experiment 1) 16784 39.308 461.243683 2+ 2+ 920.4715801643601 0 1.3364992400974425 96.53333333333333 Confident
|
|
|
2666 2665 P05198 INLIAPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30223 (Experiment 1) 30223 55.99 447.282593 2+ 2+ 892.5494365622401 0 1.3375277230944296 99.7289972899729 Confident
|
|
|
2667 2666 P42167 YVPLADVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25422 (Experiment 1) 25422 50.402 452.760406 2+ 2+ 903.5065686907503 0 -0.34192948885840757 93.6 Confident
|
|
|
2668 2667 Q5SSJ5 SGASVVAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18151 (Experiment 1) 18151 41.201 430.253082 2+ 2+ 858.4923156089401 0 -0.8187529812373456 95.4054054054054 Confident
|
|
|
2669 2668 P09874 AEPVEVVAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21257 (Experiment 1) 21257 45.086 533.798157 2+ 2+ 1065.5818588893303 0 -0.09162915262241572 100.0 Confident
|
|
|
2670 2669 Q9NWQ8 ENDYESISDLQQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29998 (Experiment 1) 29998 55.728 867.350159 2+ 2+ 1732.6941379192701 0 -4.8266622162578905 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Doubtful
|
|
|
2671 2670 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30224 (Experiment 1) 30224 55.991 677.841553 2+ 2+ 1353.6693671719202 0 -0.6005127982095267 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.08027923211169) Y4 1 0 99.72972972972973 Confident
|
|
|
2672 2671 Q08211 ELDALDANDELTPLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43056 (Experiment 1) 43056 72.53 871.433655 2+ 2+ 1740.8530079116401 0 -0.14392675027404045 99.46091644204851 Confident
|
|
|
2673 2672 Q01469 LVVECVMNNVTCTR Carbamidomethylation of C(5, 12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38982 (Experiment 1) 38982 66.336 847.90387 2+ 2+ 1693.79498216701 0 -1.0585508554885146 100.0 Confident
|
|
|
2674 2673 P62277 KGLTPSQIGVILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35810 (Experiment 1) 35810 62.476 461.289398 3+ 3+ 1380.8452842107602 0 0.7807027085509503 100.0 Confident
|
|
|
2675 2674 Q06830 LVQAFQFTDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36663 (Experiment 1) 36663 63.524 598.819702 2+ 2+ 1195.6237237013104 0 0.9413235093431838 100.0 Confident
|
|
|
2676 2675 P00338 DYNVTANSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9380 (Experiment 1) 9380 27.442 546.223694 2+ 2+ 1090.4332192274903 0 -0.3516516983373374 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2677 2676 P62263 ADRDESSPYAAMLAAQDVAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39096 (Experiment 1) 39096 66.481 755.690674 3+ 3+ 2264.0491586022304 0 0.45609393743629717 100.0 Confident
|
|
|
2678 2677 P33991 VNVTGIYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23725 (Experiment 1) 23725 48.352 501.244507 2+ 2+ 1000.4742961938302 0 0.16446322169227243 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 97.09208400646203) Y7 1 0 99.73333333333333 Confident
|
|
|
2679 2678 P04075 FSHEEIAMATVTALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38983 (Experiment 1) 38983 66.338 559.287109 3+ 3+ 1674.8399411301402 0 -0.2643427390378727 100.0 Confident
|
|
|
2680 2679 P26038 ALTSELANAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22291 (Experiment 1) 22291 46.597 523.285828 2+ 2+ 1044.5563724174801 0 0.698136053752334 100.0 Confident
|
|
|
2681 2680 P29218 SLLVTELGSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36664 (Experiment 1) 36664 63.525 581.330322 2+ 2+ 1160.64010204144 0 5.151164114138122 100.0 Doubtful
|
|
|
2682 2681 P31946 YLSEVASGDNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15419 (Experiment 1) 15419 37.507 591.785034 2+ 2+ 1181.5564319871303 0 -0.7747070231668494 100.0 Confident
|
|
|
2683 2682 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65 VGINYQPPTVVPGGDLAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38157 (Experiment 1) 38157 65.326 952.980896 2+ 2+ 1903.9444793758603 0 1.4479275099043198 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2684 2683 Q9UBR2 VGDYGSLSGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16900 (Experiment 1) 16900 39.455 545.731689 2+ 2+ 1089.4492036448 0 -0.3468538666347559 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 84.00646203554119) Y4 1 0 90.3485254691689 Doubtful
|
|
|
2685 2684 Q9NUL3 AGPEYGQGMNPISR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25634 (Experiment 1) 25634 50.651 778.833618 2+ 2+ 1555.6490427335 0 2.3370468989589974 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 99.73262032085562 Confident
|
|
|
2686 2685 P0CG47, P0CG48, P62979, P62987 TLSDYNIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20540 (Experiment 1) 20540 44.176 541.279602 2+ 2+ 1080.5451390274404 0 -0.4507474906811214 100.0 Confident
|
|
|
2687 2686 P17987 SSLGPVGLDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25223 (Experiment 1) 25223 50.168 486.7724 2+ 2+ 971.5287606873101 0 1.5267724047064217 98.69791666666666 Confident
|
|
|
2688 2687 O14548 LTSDSTVYDYAGK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24021 (Experiment 1) 24021 48.741 750.319336 2+ 2+ 1498.6228704719704 0 0.8320426946908152 Phosphorylation of Y (8: Random) Phosphorylation of Y (8: 0.0, 10: 0.0) Phosphorylation of Y (8: 0.16155088852988692) 0 Y8-{Y8 Y10} 1 100.0 Confident
|
|
|
2689 2688 P09651 SESPKEPEQLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10832 (Experiment 1) 10832 30.188 433.889435 3+ 3+ 1298.6466439738601 0 -0.1293526727727213 100.0 Confident
|
|
|
2690 2689 P61353 VYNYNHLMPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25867 (Experiment 1) 25867 50.919 704.344543 2+ 2+ 1406.6765046335 0 -1.3995738195276948 96.53333333333333 Confident
|
|
|
2691 2690 Q13263 MIVDPVEPHGEMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24628 (Experiment 1) 24628 49.476 494.575378 3+ 3+ 1480.7054218032804 0 -0.7529710837821854 100.0 Confident
|
|
|
2692 2691 Q9UQ80 TIIQNPTDQQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17215 (Experiment 1) 17215 39.891 643.340942 2+ 2+ 1284.6673794184403 0 -0.0375788787831856 98.91304347826086 Confident
|
|
|
2693 2692 Q9Y2W2 DDVYEAFMK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39611 (Experiment 1) 39611 67.204 599.231079 2+ 2+ 1196.4460924103105 0 1.2621658218749292 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 99.74424552429667 Confident
|
|
|
2694 2693 P37108 FQMAYSNLLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43073 (Experiment 1) 43073 72.552 661.80072 2+ 2+ 1321.5890086762402 0 -1.6029043181242053 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.68411867364746) Y5 1 0 98.70466321243524 Confident
|
|
|
2695 2694 P62244 MNVLADALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38117 (Experiment 1) 38117 65.28 487.770752 2+ 2+ 973.5266525123302 0 0.3060394007403202 97.5609756097561 Confident
|
|
|
2696 2695 Q9BZK7 HQEPVYSVAFSPDGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29399 (Experiment 1) 29399 55.034 884.888916 2+ 2+ 1767.7617639866203 0 0.8560854505048151 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2697 2696 P16520, P62873, P62879, Q9HAV0 LLVSASQDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16071 (Experiment 1) 16071 38.434 509.284821 2+ 2+ 1016.5502244078803 0 4.775993244703579 99.73958333333334 Doubtful
|
|
|
2698 2697 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21236 (Experiment 1) 21236 45.054 506.908203 3+ 3+ 1517.7014551458406 0 0.8709367028838056 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.8272884283247) Y11 1 0 100.0 Confident
|
|
|
2699 2698 P13796, P13797 MINLSVPDTIDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41617 (Experiment 1) 41617 70.091 751.881104 2+ 2+ 1501.7446437629703 0 2.002517033474257 99.46380697050938 Confident
|
|
|
2700 2699 Q8WUA2 NTNQDIYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10462 (Experiment 1) 10462 29.52 552.227966 2+ 2+ 1102.4444526175303 0 -2.7828567098296695 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.50959860383944) Y7 1 0 98.93048128342245 Confident
|
|
|
2701 2700 P46777 GAVDGGLSIPHSTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21192 (Experiment 1) 21192 44.987 669.854492 2+ 2+ 1337.69392851945 0 0.3751166263630138 99.45799457994579 Confident
|
|
|
2702 2701 Q13247 TNEGVIEFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29372 (Experiment 1) 29372 55.003 532.772522 2+ 2+ 1063.5298233164704 0 0.6266748906416645 100.0 Confident
|
|
|
2703 2702 P84103 AFGYYGPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36479 (Experiment 1) 36479 63.308 522.269836 2+ 2+ 1042.52361573722 0 1.4392285518676202 100.0 Confident
|
|
|
2704 2703 P13639 GVQYLNEIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29678 (Experiment 1) 29678 55.355 532.292542 2+ 2+ 1062.5709598524602 0 -0.4027727966755195 100.0 Confident
|
|
|
2705 2704 Q9UNM6 YYQTIGNHASYYK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20516 (Experiment 1) 20516 44.148 563.243286 3+ 3+ 1686.7079375086103 0 0.053908592706233056 Phosphorylation of Y (1: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (1: 0.0) 0 Y1-{Y1 Y2 Y11 Y12} 1 100.0 Confident
|
|
|
2706 2705 Q12906 EDITQSAQHALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20870 (Experiment 1) 20870 44.555 456.900574 3+ 3+ 1367.6793410844703 0 0.4023598328002244 100.0 Confident
|
|
|
2707 2706 P61158 KDYEEIGPSICR Phosphorylation of Y(3) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23195 (Experiment 1) 23195 47.676 773.83313 2+ 2+ 1545.6534594076 0 -1.1322461988912558 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.03069466882067) Y3 1 0 99.72826086956522 Confident
|
|
|
2708 2707 P50990 HEKEDGAISTIVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24547 (Experiment 1) 24547 49.383 523.286865 3+ 3+ 1566.83657000186 0 1.3985960166003553 98.55072463768117 Confident
|
|
|
2709 2708 P09651, Q32P51 DYFEQYGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29732 (Experiment 1) 29732 55.418 525.233093 2+ 2+ 1048.4501760134401 0 1.3870555533153877 99.72826086956522 Confident
|
|
|
2710 2709 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 HQGVMVGMGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13113 (Experiment 1) 13113 33.891 586.288086 2+ 2+ 1170.56378338038 0 -1.8457734866393338 100.0 Confident
|
|
|
2711 2710 O76021 LLPSLIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37485 (Experiment 1) 37485 64.513 434.784424 2+ 2+ 867.5541875895101 0 0.1235978951212371 93.76693766937669 Confident
|
|
|
2712 2711 P62241 QWYESHYALPLGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39557 (Experiment 1) 39557 67.121 850.38739 2+ 2+ 1698.7555564073702 0 2.746202429074286 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 18.449845694020865) Phosphorylation of Y (7: 2.6178010471204187) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
2713 2712 Q02790 AKESWEMNSEEKLEQSTIVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30560 (Experiment 1) 30560 56.376 592.294373 4+ 4+ 2365.1471413080003 0 0.5254251357176664 77.77777777777779 Doubtful
|
|
|
2714 2713 O15270 DAIVYGQPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18440 (Experiment 1) 18440 41.59 549.75415 2+ 2+ 1097.4906745339601 0 2.794468219808935 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
2715 2714 O43390 STAYEDYYYHPPPR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26061 (Experiment 1) 26061 51.144 613.586548 3+ 3+ 1837.7348805324402 0 1.5939461787871037 Phosphorylation of Y (4: Random) Phosphorylation of Y (7: 0.0, 8: 0.0, 9: 0.0) Phosphorylation of Y (8: 0.0) 0 Y4-{Y4 Y7 Y8 Y9} 1 100.0 Confident
|
|
|
2716 2715 Q02790 DKFSFDLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33045 (Experiment 1) 33045 59.248 528.77002 2+ 2+ 1055.52876068731 0 -3.095495845853508 99.7289972899729 Confident
|
|
|
2717 2716 O75525, Q07666, Q5VWX1 YLPELMAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36165 (Experiment 1) 36165 62.937 547.284241 2+ 2+ 1092.5525329070003 0 1.275535682991268 100.0 Confident
|
|
|
2718 2717 Q96I99 EAQVYQAFK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24885 (Experiment 1) 24885 49.774 582.259766 2+ 2+ 1162.5059902449304 0 -0.8683217831462396 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 99.73614775725594 Confident
|
|
|
2719 2718 P62805 KTVTAMDVVYALKR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42424 (Experiment 1) 42424 71.375 558.959534 3+ 3+ 1673.8575789477604 0 -0.4808623640551354 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.83844911147011) Y10 1 0 100.0 Confident
|
|
|
2720 2719 P05141, P12235, P12236, Q9H0C2 GNLANVIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23272 (Experiment 1) 23272 47.775 428.753876 2+ 2+ 855.4926499621101 0 0.6403494502138393 98.91598915989161 Confident
|
|
|
2721 2720 Q07955 EAGDVCYADVYR Phosphorylation of Y(11) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27174 (Experiment 1) 27174 52.429 749.290405 2+ 2+ 1496.5643100500301 0 1.299241830865342 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 7.759123926083362) Phosphorylation of Y (11: 0.9693053311793215) 0 Y11-{Y7 Y11} 1 100.0 Confident
|
|
|
2722 2721 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21523 (Experiment 1) 21523 45.514 713.288513 2+ 2+ 1424.5666150733405 0 -2.9034499105798344 Phosphorylation of Y (4: Confident, 7: Doubtfull) Phosphorylation of Y (4: 99.82547993019197, 7: 87.51113633312586) Y4 1 Y9-{Y7} 1 100.0 Confident
|
|
|
2723 2722 P08238, Q58FF7 DNSTMGYMMAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31636 (Experiment 1) 31636 57.635 664.739075 2+ 2+ 1327.4647963329003 0 -0.9020572791675887 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2724 2723 Q99497 VTVAGLAGKDPVQCSR Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23879 (Experiment 1) 23879 48.563 553.294922 3+ 3+ 1656.8617392038802 0 0.7213732977644877 100.0 Confident
|
|
|
2725 2724 P62937, PPIA_HUMAN VKEGMNIVEAMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33818 (Experiment 1) 33818 60.134 502.586395 3+ 3+ 1504.7377845607205 0 -0.28450235208997143 100.0 Confident
|
|
|
2726 2725 Q9Y2R9 FYQVPVPLPDRR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35551 (Experiment 1) 35551 62.158 522.933105 3+ 3+ 1565.77556357596 0 1.2251573164535323 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2727 2726 P78371 NIGVDNPAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14942 (Experiment 1) 14942 36.728 499.767212 2+ 2+ 997.5192586327705 0 0.6127192481374162 99.45652173913044 Confident
|
|
|
2728 2727 P05204 PAPPKPEPKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4889 (Experiment 1) 4889 17.843 395.904144 3+ 3+ 1184.6917436914803 0 -0.9607467172136516 99.28057553956835 Confident
|
|
|
2729 2728 P62158 EAFSLFDKDGDGTITTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38340 (Experiment 1) 38340 65.559 615.635986 3+ 3+ 1843.8839736867506 0 1.1667692037952664 100.0 Confident
|
|
|
2730 2729 Q15366 IANPVEGSTDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16270 (Experiment 1) 16270 38.682 579.791748 2+ 2+ 1157.5676653771702 0 1.1018530514113685 99.73474801061008 Confident
|
|
|
2731 2730 Q9BXY0 NEYSLTGLCNR Phosphorylation of Y(3) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29479 (Experiment 1) 29479 55.126 703.792603 2+ 2+ 1405.56972978364 0 0.6559342464591424 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2732 2731 P48735 GKLDGNQDLIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18110 (Experiment 1) 18110 41.149 410.225952 3+ 3+ 1227.65714908791 0 -0.91208866458904 98.50746268656717 Confident
|
|
|
2733 2732 Q12906, Q96SI9 YELISETGGSHDKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15182 (Experiment 1) 15182 37.142 531.261597 3+ 3+ 1590.7637989844202 0 -0.5254062033897295 100.0 Confident
|
|
|
2734 2733 P30048 HLSVNDLPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26087 (Experiment 1) 26087 51.174 402.891296 3+ 3+ 1205.65166978465 0 0.3216872995610768 100.0 Confident
|
|
|
2735 2734 P35579 EQEVNILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23498 (Experiment 1) 23498 48.058 486.771851 2+ 2+ 971.5287606873103 0 0.39893352499613516 90.81081081081082 Confident
|
|
|
2736 2735 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36246 (Experiment 1) 36246 63.034 964.385864 2+ 2+ 1926.7560694694905 0 0.5732132543081041 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 11.377380872906286) Phosphorylation of Y (10: 0.16155088852988692) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
2737 2736 P09874 SDAYYCTGDVTAWTK Phosphorylation of Y(4) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38892 (Experiment 1) 38892 66.226 909.358704 2+ 2+ 1816.7015317988305 0 0.7275833520357442 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.0) 0 Y4-{Y4 Y5} 1 100.0 Confident
|
|
|
2738 2737 P59998 IVAEEFLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35777 (Experiment 1) 35777 62.438 474.773743 2+ 2+ 947.5327834385903 0 0.1575780165070027 96.7479674796748 Confident
|
|
|
2739 2738 P37173 FPQLCKFCDVR Carbamidomethylation of C(5, 8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37334 (Experiment 1) 37334 64.324 735.355896 2+ 2+ 1468.6955258259202 0 1.164906993208174 99.45652173913044 Confident
|
|
|
2740 2739 P35579 RGDLPFVVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33312 (Experiment 1) 33312 59.554 385.892853 3+ 3+ 1154.6560268891003 0 0.6070000043209509 100.0 Confident
|
|
|
2741 2740 P14678, P63162 MLQHIDYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18625 (Experiment 1) 18625 41.831 578.255188 2+ 2+ 1154.4943800154101 0 1.2477646515109202 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 94.76439790575917) Y7 1 0 94.08602150537635 Confident
|
|
|
2742 2741 Q969Q0 GKDSLYAQGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9040 (Experiment 1) 9040 26.7 587.766357 2+ 2+ 1173.5179519109602 0 0.17792397468406834 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
2743 2742 Q92499 ALIVEPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21317 (Experiment 1) 21317 45.173 442.763336 2+ 2+ 883.5127167003502 0 -0.6748905365878607 94.03794037940379 Confident
|
|
|
2744 2743 A5A3E0, P0CG38, P0CG39, P60709, P63261, P68032, P68133, Q6S8J3, Q9BYX7 IWHHTFYNELR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26874 (Experiment 1) 26874 52.079 532.578674 3+ 3+ 1594.7082122921302 0 3.743002433356179 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2745 2744 Q9UQR1 NDYLPLYSSSTKVK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26118 (Experiment 1) 26118 51.21 848.401245 2+ 2+ 1693.7964181598406 1 -6.979510963541525 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 7.165696228856888) Phosphorylation of Y (3: 90.40139616055846) 0 Y7-{Y3 Y7} 1 91.30434782608697 Doubtful
|
|
|
2746 2745 P25705 HALIIYDDLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33150 (Experiment 1) 33150 59.369 644.34729 2+ 2+ 1286.6870522338602 0 -5.451353095296913 100.0 Doubtful
|
|
|
2747 2746 P52272 FEPYANPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19659 (Experiment 1) 19659 43.105 533.764709 2+ 2+ 1065.5131106231702 0 1.6434639266483582 92.40837696335078 Confident
|
|
|
2748 2747 Q96RU3 ADYSSILQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26142 (Experiment 1) 26142 51.237 552.752686 2+ 2+ 1103.4900058276203 0 0.735626777121184 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2749 2748 Q08211 YQILPLHSQIPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33761 (Experiment 1) 33761 60.07 488.948975 3+ 3+ 1463.82488311935 0 0.14485509100438027 100.0 Confident
|
|
|
2750 2749 P14625 DISTNYYASQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19359 (Experiment 1) 19359 42.736 685.286377 2+ 2+ 1368.5598762925904 0 -1.2222803656476162 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (7: 0.0) 0 Y6-{Y6 Y7} 1 100.0 Confident
|
|
|
2751 2750 Q15366 GVTIPYRPKPSSSPVIFAGGQDR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33231 (Experiment 1) 33231 59.461 837.090454 3+ 3+ 2508.25262304358 0 -1.2306277448665282 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2752 2751 P60842 DQIYDIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45036 (Experiment 1) 45036 76.65 625.27887 2+ 2+ 1248.5427696764702 0 0.3337631134792359 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
2753 2752 P16401 KALAAGGYDVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14587 (Experiment 1) 14587 36.174 407.886688 3+ 3+ 1220.6401020414403 0 -1.5261093185731602 92.61744966442953 Doubtful
|
|
|
2754 2753 P38919 EQIYDVYR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30417 (Experiment 1) 30417 56.212 583.250671 2+ 2+ 1164.4852548003503 0 1.3152732777397285 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 21.903613622409644) Phosphorylation of Y (4: 52.62298712804211) 0 Y4-{Y4 Y7} 1 100.0 Confident
|
|
|
2755 2754 P11388 TPPLITDYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30918 (Experiment 1) 30918 56.789 538.29303 2+ 2+ 1074.5709598524602 0 0.5082865311235008 92.22520107238606 Confident
|
|
|
2756 2755 Q07666 ILGPQGNTIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18876 (Experiment 1) 18876 42.142 520.808167 2+ 2+ 1039.6025943339102 0 -0.7807739498853774 95.4177897574124 Confident
|
|
|
2757 2756 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 DLTDYLMK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46492 (Experiment 1) 46492 79.565 539.730103 2+ 2+ 1077.4453641343202 0 0.2676635334150622 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
2758 2757 Q06830 DISLSDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26537 (Experiment 1) 26537 51.692 510.717926 2+ 2+ 1019.4212575614604 0 0.04063389518047642 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.77835951134381) Y7 1 0 99.73045822102425 Confident
|
|
|
2759 2758 P18669 HGESAWNLENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20767 (Experiment 1) 20767 44.435 438.205994 3+ 3+ 1311.59561146051 0 0.41163234029953044 100.0 Confident
|
|
|
2760 2759 P31146 LQATVQELQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20453 (Experiment 1) 20453 44.076 579.330261 2+ 2+ 1156.6451874218803 0 0.6746109044739094 100.0 Confident
|
|
|
2761 2760 P67809 RPQYSNPPVQGEVMEGADNQGAGEQGRPVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20451 (Experiment 1) 20451 44.074 826.629883 4+ 4+ 3302.4888006228407 0 0.49160777494014585 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Doubtful
|
|
|
2762 2761 P52209 GILFVGSGVSGGEEGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39009 (Experiment 1) 39009 66.369 796.407043 2+ 2+ 1590.8001844931403 0 -0.40897836327114806 100.0 Confident
|
|
|
2763 2762 P23284 DFMIQGGDFTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41180 (Experiment 1) 41180 69.441 643.794373 2+ 2+ 1285.5761218858902 0 -1.4980067440322662 99.73474801061008 Confident
|
|
|
2764 2763 P08865 LLVVTDPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26417 (Experiment 1) 26417 51.554 456.77948 2+ 2+ 911.54401682863 0 0.42716226300394944 100.0 Confident
|
|
|
2765 2764 P11142 NQVAMNPTNTVFDAKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27095 (Experiment 1) 27095 52.336 602.636597 3+ 3+ 1804.8890165808805 0 -0.583536139945142 100.0 Confident
|
|
|
2766 2765 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27961 (Experiment 1) 27961 53.356 523.251038 2+ 2+ 1044.4892775516303 0 -1.6765206235411527 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
2767 2766 P52566 APNVVVTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13529 (Experiment 1) 13529 34.538 428.255737 2+ 2+ 854.4974009893801 0 -0.5603225989293683 99.73474801061008 Confident
|
|
|
2768 2767 P55884 GTYLATFHQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21942 (Experiment 1) 21942 46.154 637.2901 2+ 2+ 1272.5652364565503 0 0.3221530962906877 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2769 2768 Q9NV06 SIYSQIQEQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26338 (Experiment 1) 26338 51.464 666.302429 2+ 2+ 1330.5918451272103 0 -1.1556757019381407 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2770 2769 Q5T1J5, Q9Y6H1 AAPRPAPVAQPPAAAPPSAVGSSAAAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20568 (Experiment 1) 20568 44.208 845.125549 3+ 3+ 2532.356103418151 0 -0.507150658173822 100.0 Confident
|
|
|
2771 2770 Q14566 LGFSEYCR Phosphorylation of Y(6) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28050 (Experiment 1) 28050 53.458 556.217834 2+ 2+ 1110.4205463688102 0 0.5112186464853276 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.73118279569893 Confident
|
|
|
2772 2771 P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0 FDSDVGEYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19819 (Experiment 1) 19819 43.312 584.220581 2+ 2+ 1166.4281338470503 0 -1.3049683066147655 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
2773 2772 P62917 GVAMNPVEHPFGGGNHQHIGKPSTIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19939 (Experiment 1) 19939 43.474 548.281311 5+ 5+ 2736.3666851851904 0 1.2721517644500548 100.0 Doubtful
|
|
|
2774 2773 P05141 AAYFGIYDTAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40022 (Experiment 1) 40022 67.764 650.285889 2+ 2+ 1298.5584197406101 0 -0.9185753197898886 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 18.111436865187635) Phosphorylation of Y (7: 96.68411867364746) 0 Y7-{Y3 Y7} 1 98.7468671679198 Confident
|
|
|
2775 2774 P62244 WQNNLLPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32306 (Experiment 1) 32306 58.405 564.302246 2+ 2+ 1126.5883412521 0 1.4157453290387856 100.0 Confident
|
|
|
2776 2775 Q13813 TATDEAYKDPSNLQGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13082 (Experiment 1) 13082 33.848 606.60083 3+ 3+ 1816.7880383041104 0 -4.0541073424755085 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2777 2776 P27695 NAGFTPQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13398 (Experiment 1) 13398 34.316 510.248535 2+ 2+ 1018.4832074772203 0 -0.6765432232873384 98.91304347826086 Confident
|
|
|
2778 2777 P62906 ILGPGLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20121 (Experiment 1) 20121 43.694 406.255493 2+ 2+ 810.4963383602201 0 0.11655986032959631 99.73333333333333 Confident
|
|
|
2779 2778 P62241 LTPEEEEILNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29927 (Experiment 1) 29927 55.645 657.843384 2+ 2+ 1313.6714617393702 0 0.5725735451064742 96.19565217391303 Confident
|
|
|
2780 2779 Q16881 VVYENAYGQFIGPHR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30916 (Experiment 1) 30916 56.787 610.618835 3+ 3+ 1828.8297839767902 0 2.6703160550651175 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 5.927251481515231) Phosphorylation of Y (7: 0.0) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
2781 2780 Q5EBM0 TTVTQSVADSLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29320 (Experiment 1) 29320 54.944 625.334351 2+ 2+ 1248.6561460284004 0 -1.596712888720261 99.73544973544973 Confident
|
|
|
2782 2781 P00338 DYNVTANSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9503 (Experiment 1) 9503 27.693 546.224365 2+ 2+ 1090.4332192274903 0 0.8767823139977277 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.74811083123426 Confident
|
|
|
2783 2782 P43307 FLVGFTNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36285 (Experiment 1) 36285 63.08 463.260376 2+ 2+ 924.5069030439201 0 -0.7598070605997941 99.72826086956522 Confident
|
|
|
2784 2783 P18754 SGQVYSFGCNDEGALGR Phosphorylation of Y(5) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32537 (Experiment 1) 32537 58.674 948.883545 2+ 2+ 1895.75094160274 0 0.8407064204655275 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
2785 2784 P12235, P12236 AAYFGVYDTAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35198 (Experiment 1) 35198 61.749 643.279358 2+ 2+ 1284.5427696764702 0 1.0830375616600738 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 21.224711603109583) Phosphorylation of Y (7: 100.0) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
2786 2785 P42166, P42167 SELVANNVTLPAGEQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29821 (Experiment 1) 29821 55.52 849.44281 2+ 2+ 1696.8744120625604 0 -1.9689316096835465 100.0 Confident
|
|
|
2787 2786 Q14974 TVSPDRLELEAAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23459 (Experiment 1) 23459 48.009 519.614441 3+ 3+ 1555.8205855845506 0 0.5824931403264895 100.0 Confident
|
|
|
2788 2787 P27348 KQTIDNSQGAYQEAFDISKK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23143 (Experiment 1) 23143 47.616 588.528503 4+ 4+ 2350.0842203058005 0 0.2913313235973781 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.65095986038395) Y11 1 0 100.0 Doubtful
|
|
|
2789 2788 P42704 GFTLNDAANSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25502 (Experiment 1) 25502 50.5 583.283386 2+ 2+ 1164.5523496662004 0 -0.11195228008288054 99.73753280839895 Confident
|
|
|
2790 2789 P09651, P22626, Q32P51 EDTEEHHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4783 (Experiment 1) 4783 17.617 583.264648 2+ 2+ 1164.5159641574803 0 -1.0467716760387797 100.0 Confident
|
|
|
2791 2790 P11388 TLAVSGLGVVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35910 (Experiment 1) 35910 62.596 564.840149 2+ 2+ 1127.66625721963 0 -0.4533610287488511 99.72972972972973 Confident
|
|
|
2792 2791 P07900, P08238, Q14568, Q58FF8, Q58FG1 TLTLVDTGIGMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40753 (Experiment 1) 40753 68.821 675.371643 2+ 2+ 1348.7272027936804 0 1.132912852439769 100.0 Confident
|
|
|
2793 2792 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38588 (Experiment 1) 38588 65.854 931.480774 2+ 2+ 1860.9498991094704 0 -1.5588290433275211 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.68411867364746) Y5 1 0 96.53333333333333 Confident
|
|
|
2794 2793 Q14204 IFTIESTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28864 (Experiment 1) 28864 54.422 483.766724 2+ 2+ 965.5181960036102 0 0.7225210378078053 97.6063829787234 Confident
|
|
|
2795 2794 Q96GX9 HGDEIYIAPSGVQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25472 (Experiment 1) 25472 50.463 797.369568 2+ 2+ 1592.7235875727504 0 0.624236418575965 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2796 2795 P61247 KTSYAQHQQVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4350 (Experiment 1) 4350 16.952 449.236847 3+ 3+ 1344.6898461985204 0 -0.8418706885884213 100.0 Confident
|
|
|
2797 2796 P04406 IISNASCTTNCLAPLAK Carbamidomethylation of C(7, 11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30442 (Experiment 1) 30442 56.24 917.463989 2+ 2+ 1832.9124544474003 0 0.5289687119101041 99.72826086956522 Confident
|
|
|
2798 2797 Q96RP9 EYGCPCITGKPK Phosphorylation of Y(2) Carbamidomethylation of C(4, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14469 (Experiment 1) 14469 36.007 745.314331 2+ 2+ 1488.61423744791 0 -0.08612575773181393 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2799 2798 P62913 YDGIILPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33496 (Experiment 1) 33496 59.769 488.280426 2+ 2+ 974.5436824754602 0 2.679400798629716 99.45799457994579 Confident
|
|
|
2800 2799 Q12906 LAAFGQLHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21157 (Experiment 1) 21157 44.931 492.788147 2+ 2+ 983.5552502186704 0 6.5858832980705015 99.7289972899729 Doubtful
|
|
|
2801 2800 Q92835 EKLYDFVK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31638 (Experiment 1) 31638 57.639 561.267395 2+ 2+ 1120.5205776799105 0 -0.3034324053016834 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 94.76439790575917) Y4 1 0 94.08602150537635 Confident
|
|
|
2802 2801 O94921, P06239, P06241, P06493, P07947, P07948, P08631, P09769, P11362, P11802, P20794, P21802, P22455, P22607, P24941, P50750, P51451, Q00526, Q00534, Q00535, Q00536, Q00537, Q07002, Q14004, Q8IZL9, Q96Q40, Q9NYV4, Q9UPZ9 LADFGLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31837 (Experiment 1) 31837 57.872 431.742371 2+ 2+ 861.4708518883701 0 -0.7676122727355855 99.73262032085562 Confident
|
|
|
2803 2802 P27824 APVPTGEVYFADSFDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43898 (Experiment 1) 43898 73.956 885.920898 2+ 2+ 1769.8260648878104 0 0.6649461320314585 92.8388746803069 Confident
|
|
|
2804 2803 Q02878 HLTDAYFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21352 (Experiment 1) 21352 45.227 497.75351 2+ 2+ 993.4919812557703 0 0.488003432563326 97.8319783197832 Confident
|
|
|
2805 2804 P18124 QIFNGTFVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33992 (Experiment 1) 33992 60.346 527.291199 2+ 2+ 1052.5654805492002 0 2.2421410425186443 96.19565217391303 Confident
|
|
|
2806 2805 P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1 AGLQFPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33920 (Experiment 1) 33920 60.255 472.769684 2+ 2+ 943.5239500903901 0 0.9147972114716041 100.0 Confident
|
|
|
2807 2806 P10809 GYISPYFINTSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41899 (Experiment 1) 41899 70.509 735.339172 2+ 2+ 1468.6639474383103 0 -0.1063263891251716 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.586359469818625) Phosphorylation of Y (2: 100.0) 0 Y2-{Y2 Y6} 1 100.0 Confident
|
|
|
2808 2807 P00338 SADTLWGIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35657 (Experiment 1) 35657 62.283 559.796143 2+ 2+ 1117.5767735088903 0 0.8570604853706306 100.0 Confident
|
|
|
2809 2808 P49189 VTIEYYSQLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36745 (Experiment 1) 36745 63.621 662.316162 2+ 2+ 1322.6159346167303 0 1.3863863641312764 Phosphorylation of Y (6: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (6: 5.846422338568935) 0 Y6-{Y5 Y6} 1 91.30434782608697 Confident
|
|
|
2810 2809 P04179 HHAAYVNNLNVTEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15982 (Experiment 1) 15982 38.318 580.289124 3+ 3+ 1737.8434462874504 0 1.2041782570910948 100.0 Confident
|
|
|
2811 2810 P19338 EVFEDAAEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30747 (Experiment 1) 30747 56.59 589.78717 2+ 2+ 1177.5615173675703 0 -1.4668839408910308 100.0 Confident
|
|
|
2812 2811 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29599 (Experiment 1) 29599 55.264 452.230652 3+ 3+ 1353.6693671719202 0 0.5597645550358735 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2813 2812 O00567 VVSLSEYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24416 (Experiment 1) 24416 49.23 476.757629 2+ 2+ 951.5025459394701 0 -1.9306136158298062 99.72972972972973 Confident
|
|
|
2814 2813 P07900 APFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44211 (Experiment 1) 44211 74.618 554.774719 2+ 2+ 1107.5349086969104 0 -0.021297414274561843 100.0 Confident
|
|
|
2815 2814 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGRPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29652 (Experiment 1) 29652 55.325 400.240173 3+ 3+ 1197.69822605425 0 0.3860561103065634 100.0 Confident
|
|
|
2816 2815 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 QLFHPEQLITGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36800 (Experiment 1) 36800 63.687 470.92926 3+ 3+ 1409.7666995368902 0 -0.5301128306560053 100.0 Confident
|
|
|
2817 2816 Q9P258 DGQILPVPNVVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43455 (Experiment 1) 43455 73.196 703.411133 2+ 2+ 1404.8088987020403 0 -0.8427750214079247 99.45799457994579 Confident
|
|
|
2818 2817 P26641 STFVLDEFKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35659 (Experiment 1) 35659 62.285 414.555634 3+ 3+ 1240.6451874218803 0 -0.09232561034247692 100.0 Confident
|
|
|
2819 2818 P62253 DYPLRPPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24085 (Experiment 1) 24085 48.818 533.763062 2+ 2+ 1064.5055963221103 1 2.4564997363863847 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 96.19565217391303 Confident
|
|
|
2820 2819 P23284 HYGPGWVSMANAGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29952 (Experiment 1) 29952 55.673 777.832092 2+ 2+ 1553.6486488106805 0 0.6314063958451226 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2821 2820 P78527 MYAALGDPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21780 (Experiment 1) 21780 45.926 523.224792 2+ 2+ 1044.4351338037902 0 -0.09817711803135486 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2822 2821 P62899 EYTINIHK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17213 (Experiment 1) 17213 39.888 549.254944 2+ 2+ 1096.4954255612304 0 -0.08237963809828817 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 99.45799457994579 Confident
|
|
|
2823 2822 P26038, Q8TAM6 QRIDEFESM ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32563 (Experiment 1) 32563 58.703 577.76062 2+ 2+ 1153.5073736197303 0 -0.5941500015032477 99.7340425531915 Confident
|
|
|
2824 2823 P33992 VAIHEAMEQQTISIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27461 (Experiment 1) 27461 52.766 590.312683 3+ 3+ 1767.9189197268304 0 -1.524685265571102 92.99363057324841 Doubtful
|
|
|
2825 2824 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43597 (Experiment 1) 43597 73.42 597.636597 3+ 3+ 1789.88464239309 0 1.851299287669163 97.76119402985076 Confident
|
|
|
2826 2825 P62888 KSEIEYYAMLAK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35238 (Experiment 1) 35238 61.796 763.35498 2+ 2+ 1524.6935333144304 0 1.2273151378747227 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (7: 0.0) 0 Y6-{Y6 Y7} 1 100.0 Confident
|
|
|
2827 2826 P08621 EFEVYGPIKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29639 (Experiment 1) 29639 55.311 659.315918 2+ 2+ 1316.6166033230702 0 0.5154916160265853 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2828 2827 P78527 SIGEYDVLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33124 (Experiment 1) 33124 59.338 566.255066 2+ 2+ 1130.5009048644902 0 -4.702627304137897 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 76.73667205169629) Y5 1 0 93.65079365079364 Doubtful
|
|
|
2829 2828 P10809 ISSIQSIVPALEIANAHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45119 (Experiment 1) 45119 76.835 640.362488 3+ 3+ 1918.0636098145703 0 1.0539796681702194 100.0 Confident
|
|
|
2830 2829 P33991 THIDVIHYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18907 (Experiment 1) 18907 42.179 411.864197 3+ 3+ 1232.5703218369902 0 0.35591240478155206 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
2831 2830 P10606 LVPQQLAH ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19971 (Experiment 1) 19971 43.512 453.263824 2+ 2+ 904.5130510535203 0 0.048551037641119725 99.45652173913044 Confident
|
|
|
2832 2831 Q15717 NVALLSQLYHSPAR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39754 (Experiment 1) 39754 67.404 824.91333 2+ 2+ 1647.8134056366603 0 -0.7870943620006273 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
2833 2832 Q15181 VIAINVDDPDAANYNDINDVKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35275 (Experiment 1) 35275 61.84 815.407959 3+ 3+ 2443.1979310109 0 1.6828368123039261 99.28057553956835 Confident
|
|
|
2834 2833 P61247 LFCVGFTK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37703 (Experiment 1) 37703 64.779 486.255341 2+ 2+ 970.4946241080602 0 1.547500374706018 100.0 Confident
|
|
|
2835 2834 P22314 AENYDIPSADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21072 (Experiment 1) 21072 44.819 625.785156 2+ 2+ 1249.5574946162901 0 -1.3866959697596737 99.7289972899729 Confident
|
|
|
2836 2835 P46781 SPYGGGRPGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5413 (Experiment 1) 5413 18.969 542.240051 2+ 2+ 1082.46585676845 0 -0.28373225691412607 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.30191972076788) Y3 1 0 99.72826086956522 Confident
|
|
|
2837 2836 P62805 RISGLIYEETR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28920 (Experiment 1) 28920 54.485 708.848206 2+ 2+ 1415.6809944847805 0 0.6098499758469271 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
2838 2837 Q9Y3A6 ECFYQPMPLK Phosphorylation of Y(4) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36586 (Experiment 1) 36586 63.43 696.789734 2+ 2+ 1391.5654963503403 0 -0.41711559001713977 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2839 2838 Q53H96 IAAQTLLGTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29455 (Experiment 1) 29455 55.098 543.829773 2+ 2+ 1085.64445914589 0 0.49088958940292465 100.0 Confident
|
|
|
2840 2839 P31146 DAGPLLISLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44028 (Experiment 1) 44028 74.196 513.813782 2+ 2+ 1025.6120963884503 0 0.8900877824614536 94.03794037940379 Confident
|
|
|
2841 2840 P27348, P31946, P31947, P61981, Q04917 VISSIEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12603 (Experiment 1) 12603 33.107 452.261627 2+ 2+ 902.5072969667403 0 1.5523114625116152 93.47258485639686 Confident
|
|
|
2842 2841 P10412, P16402, P16403, P22492, Q02539 ALAAAGYDVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21319 (Experiment 1) 21319 45.176 554.287903 2+ 2+ 1106.5607890915803 0 0.4185324876032731 100.0 Confident
|
|
|
2843 2842 P62993 ATADDELSFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27008 (Experiment 1) 27008 52.236 548.762451 2+ 2+ 1095.5084191655503 0 1.7584149714449318 92.3076923076923 Confident
|
|
|
2844 2843 Q96BZ4 TSTDLQVLAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30144 (Experiment 1) 30144 55.897 587.825073 2+ 2+ 1173.6353510141703 0 0.20588799838196337 100.0 Confident
|
|
|
2845 2844 Q06830 HGEVCPAGWKPGSDTIKPDVQK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20293 (Experiment 1) 20293 43.89 802.73468 3+ 3+ 2405.17977884896 0 1.0097786645446751 100.0 Confident
|
|
|
2846 2845 P62917 AVVGVVAGGGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17051 (Experiment 1) 17051 39.656 471.279907 2+ 2+ 940.5454138109601 0 -0.16205290851054596 99.74489795918367 Confident
|
|
|
2847 2846 P46776 TGAAPIIDVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34957 (Experiment 1) 34957 61.476 556.327026 2+ 2+ 1110.6397081186203 0 -0.18788607718500575 100.0 Confident
|
|
|
2848 2847 Q12906 AYAALAALEK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36743 (Experiment 1) 36743 63.617 550.773376 2+ 2+ 1099.5314767167804 0 0.6557597921388589 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2849 2848 P25685 DYYQTLGLAR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38318 (Experiment 1) 38318 65.528 640.288635 2+ 2+ 1278.5645677502102 0 -1.445192885389813 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 0.17452006980802792) 0 Y2-{Y2 Y3} 1 100.0 Confident
|
|
|
2850 2849 P60842 KGVAINMVTEEDKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18311 (Experiment 1) 18311 41.421 530.61554 3+ 3+ 1588.8242910660003 0 0.3138076961555334 99.26470588235294 Confident
|
|
|
2851 2850 P11940, Q4VXU2, Q5JQF8, Q9H361 FSPAGPILSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41365 (Experiment 1) 41365 69.711 579.338013 2+ 2+ 1156.6604435632 0 0.8885176421575061 100.0 Confident
|
|
|
2852 2851 P48556 ILFTEATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29036 (Experiment 1) 29036 54.619 475.769135 2+ 2+ 949.5232813840503 0 0.45787178407608053 99.73118279569893 Confident
|
|
|
2853 2852 P02786 GFVEPDHYVVVGAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31172 (Experiment 1) 31172 57.089 558.286804 3+ 3+ 1671.8369043550306 0 1.0020215434288324 100.0 Confident
|
|
|
2854 2853 P38919 EQIYDVYR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30643 (Experiment 1) 30643 56.47 583.249939 2+ 2+ 1164.4852548003503 0 0.06023663715452408 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 33.71425499502057) Phosphorylation of Y (4: 87.25103652405754) 0 Y4-{Y4 Y7} 1 100.0 Confident
|
|
|
2855 2854 Q15029 LGEFFQTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34166 (Experiment 1) 34166 60.552 485.255432 2+ 2+ 968.4967322830403 0 -0.43401521511196667 91.30434782608697 Confident
|
|
|
2856 2855 O14920 VIYTQLSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20518 (Experiment 1) 20518 44.15 516.266541 2+ 2+ 1030.5100129962102 0 8.24781360809604 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 99.72826086956522 Doubtful
|
|
|
2857 2856 P0DMV8 LLQDFFNGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43233 (Experiment 1) 43233 72.852 555.290283 2+ 2+ 1108.5665431783602 0 -0.47732847798834427 99.1869918699187 Confident
|
|
|
2858 2857 P30101 LSKDPNIVIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18048 (Experiment 1) 18048 41.048 399.911163 3+ 3+ 1196.7128730588804 0 -1.0114397074156964 92.66666666666666 Doubtful
|
|
|
2859 2858 P35232 EFTEAVEAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18338 (Experiment 1) 18338 41.456 512.254028 2+ 2+ 1022.4920408254204 0 1.4272635866560983 99.74811083123426 Confident
|
|
|
2860 2859 Q01469 KMGAMAKPDCIITCDGK Carbamidomethylation of C(10, 14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20200 (Experiment 1) 20200 43.786 632.633179 3+ 3+ 1894.8773318919798 0 0.1979597188312857 98.49624060150376 Confident
|
|
|
2861 2860 P49327 RPTPQDSPIFLPVDDTSFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43406 (Experiment 1) 43406 73.132 730.036804 3+ 3+ 2187.0960321416605 0 -3.4014343372522506 91.72932330827068 Doubtful
|
|
|
2862 2861 P07195 MVVESAYEVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35993 (Experiment 1) 35993 62.703 634.334229 2+ 2+ 1266.6529752242604 0 0.7329281272462104 99.72826086956522 Confident
|
|
|
2863 2862 P68104, Q5VTE0 MDSTEPPYSQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14525 (Experiment 1) 14525 36.09 641.785156 2+ 2+ 1281.5547177349702 0 0.8112779181884491 99.73118279569893 Confident
|
|
|
2864 2863 P52292 EKQPPIDNIIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25579 (Experiment 1) 25579 50.589 441.585388 3+ 3+ 1321.7353994086102 0 -0.8037767395416188 98.50746268656717 Confident
|
|
|
2865 2864 P17844, Q92841 GDGPICLVLAPTR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43115 (Experiment 1) 43115 72.627 684.868652 2+ 2+ 1367.72312047275 0 -0.26969132945658114 100.0 Confident
|
|
|
2866 2865 P46777 GAVDGGLSIPHSTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21194 (Experiment 1) 21194 44.989 446.905273 3+ 3+ 1337.69392851945 0 0.04555783996461426 100.0 Confident
|
|
|
2867 2866 HBA_HUMAN, P69905 VGAHAGEYGAEALER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20489 (Experiment 1) 20489 44.118 510.582947 3+ 3+ 1528.7270195528804 0 -0.0051923110468442175 100.0 Confident
|
|
|
2868 2867 P40926 TIIPLISQCTPK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40278 (Experiment 1) 40278 68.144 685.890686 2+ 2+ 1369.7639226555702 0 2.1114275060259544 99.46236559139786 Confident
|
|
|
2869 2868 P62241 LDVGNFSWGSECCTR Carbamidomethylation of C(12, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42540 (Experiment 1) 42540 71.587 894.379822 2+ 2+ 1786.7403037418603 0 2.6763446638050366 91.05691056910568 Doubtful
|
|
|
2870 2869 P00558 ALESPERPFLAILGGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45923 (Experiment 1) 45923 78.612 590.337585 3+ 3+ 1767.9883196159903 0 1.4714673290785454 100.0 Confident
|
|
|
2871 2870 P49327 VYATILNAGTNTDGFK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41224 (Experiment 1) 41224 69.496 882.913391 2+ 2+ 1763.8131308531401 0 -0.5106878618274198 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.03069466882067) Y2 1 0 99.45799457994579 Confident
|
|
|
2872 2871 O75832 GAQVNAVNQNGCTPLHYAASK Phosphorylation of Y(17) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23802 (Experiment 1) 23802 48.46 761.006714 3+ 3+ 2279.0154295533303 1 -8.970840193846927 Phosphorylation of Y (17: Very Confident) Phosphorylation of Y (17: 100.0) Phosphorylation of Y (17: 100.0) Y17 1 0 100.0 Doubtful
|
|
|
2873 2872 Q9Y230 GLGLDDALEPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37487 (Experiment 1) 37487 64.516 578.303223 2+ 2+ 1154.5931518490202 0 -1.088340185781599 100.0 Confident
|
|
|
2874 2873 Q6IA86 AVHLQGHEGPVYAVHAVYQR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26666 (Experiment 1) 26666 51.839 578.534424 4+ 4+ 2310.1058992402404 0 1.1628070553859973 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 3.6328551300071457) Phosphorylation of Y (12: 100.0) 0 Y12-{Y12 Y18} 1 100.0 Doubtful
|
|
|
2875 2874 P62805 TVTAMDVVYALKR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46377 (Experiment 1) 46377 79.381 516.261414 3+ 3+ 1545.7626159337606 0 -0.13128631130851606 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 100.0 Confident
|
|
|
2876 2875 P07900, P08238, Q14568, Q58FF7, Q58FF8 YESLTDPSKLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22477 (Experiment 1) 22477 46.827 770.379028 2+ 2+ 1538.7464175847801 0 -1.8916097046609868 91.44385026737967 Confident
|
|
|
2877 2876 O14745 EALAEAALESPRPALVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35157 (Experiment 1) 35157 61.703 598.337036 3+ 3+ 1791.9842968647104 0 2.7753302793263375 100.0 Confident
|
|
|
2878 2877 P26641 EYFSWEGAFQHVGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45974 (Experiment 1) 45974 78.705 588.919434 3+ 3+ 1763.7344866096205 0 1.1240882093329638 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2879 2878 P11388, Q02880 LCNIFSTK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32227 (Experiment 1) 32227 58.314 491.754608 2+ 2+ 981.4953523840502 0 -0.7008751720203152 99.72972972972973 Confident
|
|
|
2880 2879 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29532 (Experiment 1) 29532 55.187 677.842957 2+ 2+ 1353.6693671719202 0 1.4707664714748505 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
2881 2880 P51153, P59190, P61006, P61026, P62820, Q15286, Q92928, Q92930, Q9H0U4 LLLIGDSGVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38549 (Experiment 1) 38549 65.809 536.323608 2+ 2+ 1070.6335601090202 0 -0.8362879059549106 100.0 Confident
|
|
|
2882 2881 P61353 VYNYNHLMPTR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27230 (Experiment 1) 27230 52.494 496.555145 3+ 3+ 1486.64283515425 0 0.5171937901722866 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 4.835273877102008) Phosphorylation of Y (4: 0.8726003490401396) 0 Y2-{Y2 Y4} 1 99.24812030075188 Confident
|
|
|
2883 2882 Q96RP9 KGDTIYNTR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7685 (Experiment 1) 7685 23.834 574.262817 2+ 2+ 1146.5070528740903 0 3.5072847261122537 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
2884 2883 Q6PJG2 AGTFIAPPVYSNITPYQSHLRSPVR Phosphorylation of Y(16, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41143 (Experiment 1) 41143 69.388 977.805237 3+ 3+ 2930.38814414775 0 1.955898379480807 Phosphorylation of Y (10: Very Confident, 16: Very Confident) Phosphorylation of Y (10: 97.38219895287958, 16: 97.38219895287958) Y10, Y16 2 0 92.14285714285715 Doubtful
|
|
|
2885 2884 O60234 TTDDLTEAWLQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42260 (Experiment 1) 42260 71.13 775.373962 2+ 2+ 1548.7307675206405 0 1.6788996239692862 96.4769647696477 Confident
|
|
|
2886 2885 P53675, Q00610 AHIAQLCEK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10986 (Experiment 1) 10986 30.463 535.275757 2+ 2+ 1068.5386141783601 0 -1.544166170425898 99.7289972899729 Confident
|
|
|
2887 2886 P18754 SGQVYSFGCNDEGALGR Phosphorylation of Y(5) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32308 (Experiment 1) 32308 58.407 948.887695 2+ 2+ 1895.75094160274 0 5.214271027820049 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Doubtful
|
|
|
2888 2887 Q16666 LTCFELAPK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32721 (Experiment 1) 32721 58.881 539.784546 2+ 2+ 1077.5528672601702 0 1.5485889758970914 99.72972972972973 Confident
|
|
|
2889 2888 Q02878 VLATVTKPVGGDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13438 (Experiment 1) 13438 34.379 642.880554 2+ 2+ 1283.7449014631502 0 1.2860906602106024 100.0 Confident
|
|
|
2890 2889 Q9UII2 EQLAALKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10806 (Experiment 1) 10806 30.14 450.779236 2+ 2+ 899.5440168286302 0 -0.10843694171932183 99.73474801061008 Confident
|
|
|
2891 2890 P07900 RAPFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39636 (Experiment 1) 39636 67.238 422.218872 3+ 3+ 1263.6360197205104 0 -0.9735233136165509 98.49624060150376 Confident
|
|
|
2892 2891 Q92598 QDLPSLDEKPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20791 (Experiment 1) 20791 44.463 433.229614 3+ 3+ 1296.6673794184403 0 -0.28223584043816846 100.0 Confident
|
|
|
2893 2892 P60174 RHVFGESDELIGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20821 (Experiment 1) 20821 44.499 538.94635 3+ 3+ 1613.8161689104502 0 0.6504604140697441 100.0 Confident
|
|
|
2894 2893 P08559 EILAELTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38521 (Experiment 1) 38521 65.778 501.285492 2+ 2+ 1000.5553097883203 0 1.1184039112148572 99.45799457994579 Confident
|
|
|
2895 2894 Q8NBX0 SAIYGFGDQSNLRK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26311 (Experiment 1) 26311 51.432 545.922729 3+ 3+ 1634.7453856464901 0 0.5934622850113438 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.65095986038395) Y4 1 0 100.0 Confident
|
|
|
2896 2895 B2RPK0, P09429 IKGEHPGLSIGDVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19995 (Experiment 1) 19995 43.539 507.619598 3+ 3+ 1519.8358417258703 0 0.7373464474386182 100.0 Confident
|
|
|
2897 2896 Q9Y490 AVTQALNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11349 (Experiment 1) 11349 31.086 436.751129 2+ 2+ 871.4875645816703 0 0.16082926753802299 92.81914893617021 Confident
|
|
|
2898 2897 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32618 (Experiment 1) 32618 58.765 565.801208 2+ 2+ 1129.58800689893 0 -0.12710518627652317 100.0 Confident
|
|
|
2899 2898 P62266 VANVSLLALYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43661 (Experiment 1) 43661 73.532 595.86084 2+ 2+ 1189.7070594024503 0 0.05677829865585453 100.0 Confident
|
|
|
2900 2899 Q13630 ILVTGGSGLVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28156 (Experiment 1) 28156 53.589 550.837402 2+ 2+ 1099.6601092100302 0 0.12876428088074054 99.45652173913044 Confident
|
|
|
2901 2900 P22626 TLETVPLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26953 (Experiment 1) 26953 52.174 529.298889 2+ 2+ 1056.5815245361603 0 1.6064013950648468 99.45799457994579 Confident
|
|
|
2902 2901 P62851 LITPAVVSER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28702 (Experiment 1) 28702 54.23 542.821716 2+ 2+ 1083.6288090817504 0 0.06446373454311549 100.0 Confident
|
|
|
2903 2902 P46782 VNQAIWLLCTGAR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44939 (Experiment 1) 44939 76.427 751.402039 2+ 2+ 1500.78711771164 0 1.6019111389578975 99.73190348525469 Confident
|
|
|
2904 2903 Q9HBI0 VLYGLFCK Phosphorylation of Y(3) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43508 (Experiment 1) 43508 73.271 540.253845 2+ 2+ 1078.4922547570902 0 0.8165698533907092 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 94.06631762652705) Y3 1 0 93.65079365079364 Confident
|
|
|
2905 2904 Q99623 LGLDYEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26664 (Experiment 1) 26664 51.836 497.745422 2+ 2+ 993.4767251144503 0 -0.43601393984769377 100.0 Confident
|
|
|
2906 2905 P23284 VIKDFMIQGGDFTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37937 (Experiment 1) 37937 65.056 542.949341 3+ 3+ 1625.8235627900103 0 1.615137671326468 99.28057553956835 Confident
|
|
|
2907 2906 Q99497 DVVICPDASLEDAKK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28131 (Experiment 1) 28131 53.556 553.946106 3+ 3+ 1658.8185369792204 0 -1.2325971242555427 100.0 Confident
|
|
|
2908 2907 Q12905 VLQSALAAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33310 (Experiment 1) 33310 59.552 521.324585 2+ 2+ 1040.6342288153603 0 0.3723698931619986 100.0 Confident
|
|
|
2909 2908 P39656 SSLNPILFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40601 (Experiment 1) 40601 68.615 523.803589 2+ 2+ 1045.5920296502102 0 0.5683585570675744 97.289972899729 Confident
|
|
|
2910 2909 P31948 IGNSYFKEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16707 (Experiment 1) 16707 39.215 405.540222 3+ 3+ 1213.5979028762906 0 0.7674733925877941 94.8905109489051 Confident
|
|
|
2911 2910 P07900, P08238 SLTNDWEDHLAVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35632 (Experiment 1) 35632 62.253 510.249542 3+ 3+ 1526.7365216074204 1 -8.55026916358812 96.71052631578947 Doubtful
|
|
|
2912 2911 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20014 (Experiment 1) 20014 43.566 713.290344 2+ 2+ 1424.5666150733405 0 -0.3364736443834046 Phosphorylation of Y (4: Doubtfull, 9: Confident) Phosphorylation of Y (4: 49.188157445860725, 9: 96.68411867364746) Y9 1 Y4-{Y4} 1 99.48320413436691 Confident
|
|
|
2913 2912 P04899, P08754, P63096 EIYTHFTCATDTK Phosphorylation of Y(3) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23060 (Experiment 1) 23060 47.521 556.2323 3+ 3+ 1665.6745887750005 0 0.28874309200052956 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2914 2913 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21604 (Experiment 1) 21604 45.646 759.858459 2+ 2+ 1517.7014551458406 0 0.5987437985388199 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
2915 2914 P25705 STVAQLVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20202 (Experiment 1) 20202 43.788 423.258942 2+ 2+ 844.5018176634803 0 1.7878010967130942 97.56756756756756 Confident
|
|
|
2916 2915 P26038 ISQLEMAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20487 (Experiment 1) 20487 44.115 474.253204 2+ 2+ 946.4906013567802 0 1.3217741518713462 100.0 Confident
|
|
|
2917 2916 P0DMV8, P11021, P11142, P17066, P34931, P48741, P54652 VEIIANDQGNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17553 (Experiment 1) 17553 40.36 614.817078 2+ 2+ 1227.6207635791902 0 -0.9437861768526555 100.0 Confident
|
|
|
2918 2917 O43390 DYAFVHFEDR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37695 (Experiment 1) 37695 64.769 689.776245 2+ 2+ 1377.5390812783603 0 -0.8294073938372751 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
2919 2918 GSTP1_HUMAN, P09211 PPYTVVYFPVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46547 (Experiment 1) 46547 79.646 709.34967 2+ 2+ 1416.6842889600703 0 0.35110080503114904 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 46.35930292195819) Phosphorylation of Y (7: 68.12217015096597) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
2920 2919 O43809 TVEGVLIVHEHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19999 (Experiment 1) 19999 43.545 463.593262 3+ 3+ 1387.7571974823504 0 0.5458215855410086 92.14285714285715 Doubtful
|
|
|
2921 2920 Q9Y4B4 IQRDLYTQFMDRFR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42594 (Experiment 1) 42594 71.675 985.463806 2+ 2+ 1967.9077170276605 1 1.008771231998203 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 94.24083769633508) Y6 1 0 93.65079365079364 Doubtful
|
|
|
2922 2921 P13639 GEGQLGPAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11575 (Experiment 1) 11575 31.416 507.25412 2+ 2+ 1012.4937721609201 0 -0.08387762025062885 93.08510638297872 Confident
|
|
|
2923 2922 P33316 IAQLICER Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23301 (Experiment 1) 23301 47.814 501.774841 2+ 2+ 1001.5328005219301 0 2.3203134739391222 100.0 Confident
|
|
|
2924 2923 P63104 FLIPNASQAESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31756 (Experiment 1) 31756 57.776 652.845886 2+ 2+ 1303.6772158261506 0 0.0024816156818873777 100.0 Confident
|
|
|
2925 2924 P26373 TIGISVDPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26729 (Experiment 1) 26729 51.91 479.271851 2+ 2+ 956.5290950404801 0 0.056362478781407654 90.2439024390244 Doubtful
|
|
|
2926 2925 P41091 VGQEIEVRPGIVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22748 (Experiment 1) 22748 47.147 504.291504 3+ 3+ 1509.8514917900102 0 0.7871178221391457 100.0 Confident
|
|
|
2927 2926 P09874 TTNFAGILSQGLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45374 (Experiment 1) 45374 77.382 689.378479 2+ 2+ 1376.74121306504 0 0.8645485771755207 99.72826086956522 Confident
|
|
|
2928 2927 Q99798 DGYAQILR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28484 (Experiment 1) 28484 53.976 508.234283 2+ 2+ 1014.4535607492501 0 0.4449889966346893 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.12277867528272) Y3 1 0 99.45945945945947 Confident
|
|
|
2929 2928 P15880 TYSYLTPDLWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45403 (Experiment 1) 45403 77.444 693.852661 2+ 2+ 1385.6867178806901 0 2.9193499861551526 99.7289972899729 Confident
|
|
|
2930 2929 P00338 QVVESAYEVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31255 (Experiment 1) 31255 57.183 632.843323 2+ 2+ 1263.6710678165505 0 0.8100351372253913 100.0 Confident
|
|
|
2931 2930 Q08211 LAQFEPSQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18990 (Experiment 1) 18990 42.278 538.28125 2+ 2+ 1074.54580773378 0 1.9871924268719503 99.45799457994579 Confident
|
|
|
2932 2931 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29059 (Experiment 1) 29059 54.645 600.288269 3+ 3+ 1797.84107693648 0 1.0554179762053955 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.83844911147011) Y9 1 0 100.0 Confident
|
|
|
2933 2932 Q99832 ATISNDGATILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25090 (Experiment 1) 25090 50.014 602.333008 2+ 2+ 1202.6506667251404 0 0.6610477520267004 99.73045822102425 Confident
|
|
|
2934 2933 Q01469 KTQTVCNFTDGALVQHQEWDGK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31257 (Experiment 1) 31257 57.185 641.305176 4+ 4+ 2561.1968854650804 0 -2.0611565400973153 100.0 Doubtful
|
|
|
2935 2934 P10696 VQHASPAGAYAHTVNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10670 (Experiment 1) 10670 29.897 420.465942 4+ 4+ 1677.8335503100907 0 0.6610662631121536 100.0 Doubtful
|
|
|
2936 2935 O75347 RLEAAYLDLQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32700 (Experiment 1) 32700 58.857 476.572144 3+ 3+ 1426.6969789020902 0 -1.6620768450921781 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.30191972076788) Y6 1 0 100.0 Confident
|
|
|
2937 2936 P42224 TELISVSEVHPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26181 (Experiment 1) 26181 51.281 485.260193 3+ 3+ 1452.7572570520003 0 1.0252569072194908 98.57142857142858 Confident
|
|
|
2938 2937 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28342 (Experiment 1) 28342 53.808 528.262634 2+ 2+ 1054.5100129962104 0 0.6645090783086571 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
2939 2938 P16949 ASGQAFELILSPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44666 (Experiment 1) 44666 75.811 694.881958 2+ 2+ 1387.74596409231 0 2.4457264573932256 100.0 Confident
|
|
|
2940 2939 P40926 ANTFVAELK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30521 (Experiment 1) 30521 56.331 496.772797 2+ 2+ 991.5338460677503 0 -2.8232156350233866 100.0 Confident
|
|
|
2941 2940 P11021 ELEEIVQPIISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41249 (Experiment 1) 41249 69.528 699.39801 2+ 2+ 1396.7813465415202 0 0.0861632892401234 99.74226804123711 Confident
|
|
|
2942 2941 Q969Q0 GKDSLYAQGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8957 (Experiment 1) 8957 26.557 392.179993 3+ 3+ 1173.5179519109602 0 0.168025431063988 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 100.0 Confident
|
|
|
2943 2942 P15104 QVYMSLPQGEK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30664 (Experiment 1) 30664 56.496 680.30426 2+ 2+ 1358.5941536263304 0 -0.13711506739625434 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2944 2943 P28906 LGEDPYYTENGGGQGYSSGPGTSPEAQGK Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31424 (Experiment 1) 31424 57.381 995.408936 3+ 3+ 2982.2192697781206 1 -5.911085828733489 Phosphorylation of Y (16: Random) Phosphorylation of Y (7: 0.0, 16: 0.0) Phosphorylation of Y (16: 10.400437568898775) 0 Y16-{Y6 Y7 Y16} 1 100.0 Doubtful
|
|
|
2945 2944 P14625 DISTNYYASQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21572 (Experiment 1) 21572 45.598 645.304504 2+ 2+ 1288.5935457718404 0 0.7045473651654414 99.72972972972973 Confident
|
|
|
2946 2945 P47914 LAYIAHPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12389 (Experiment 1) 12389 32.775 456.768921 2+ 2+ 911.5228874612303 0 0.4396154201978206 99.73190348525469 Confident
|
|
|
2947 2946 P49321 EAQLYAAQAHLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21602 (Experiment 1) 21602 45.643 474.898682 3+ 3+ 1421.6704298010804 0 2.657976457072866 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.28057553956835 Confident
|
|
|
2948 2947 P40937 GPILSFASTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35960 (Experiment 1) 35960 62.662 524.792969 2+ 2+ 1047.5712942056302 0 0.08656818859189014 95.07772020725389 Confident
|
|
|
2949 2948 P63173 YLYTLVITDKEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36221 (Experiment 1) 36221 63.004 495.944366 3+ 3+ 1484.8126466698006 0 -0.9262255033968401 100.0 Confident
|
|
|
2950 2949 A3KN83, Q9Y2G9 VVYASATGASEPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14564 (Experiment 1) 14564 36.142 694.316589 2+ 2+ 1386.6180598750502 0 0.407012856002164 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
2951 2950 Q9Y4H4 EQLYSTILSHQCQR Phosphorylation of Y(4) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29848 (Experiment 1) 29848 55.551 614.945557 3+ 3+ 1841.8131479364804 0 0.9180566849257051 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
2952 2951 P12268 REDLVVAPAGITLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35465 (Experiment 1) 35465 62.059 494.627502 3+ 3+ 1480.8613281977202 0 -0.4391168893025382 100.0 Confident
|
|
|
2953 2952 P14174 LLCGLLAER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39921 (Experiment 1) 39921 67.634 522.79718 2+ 2+ 1043.5797507143502 0 0.053894732878750164 100.0 Confident
|
|
|
2954 2953 Q9BUQ8 IDRIEESDQGPYAIILAPTR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40101 (Experiment 1) 40101 67.864 779.723511 3+ 3+ 2336.1413412591005 0 3.1474249235086194 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 99.83844911147011) Y12 1 0 100.0 Confident
|
|
|
2955 2954 Q16630 GDYGPPGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10176 (Experiment 1) 10176 28.99 449.676361 2+ 2+ 897.3381966438401 0 -0.030663679019764706 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
2956 2955 P26599 DYGNSPLHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12740 (Experiment 1) 12740 33.332 569.738342 2+ 2+ 1137.4604370348402 0 1.486677242193758 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.45799457994579 Confident
|
|
|
2957 2956 P08238 NPDDITQEEYGEFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37452 (Experiment 1) 37452 64.469 924.403748 2+ 2+ 1846.7897389487405 0 1.7330756150589879 100.0 Confident
|
|
|
2958 2957 P23528, Q9Y281 YALYDATYETK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32511 (Experiment 1) 32511 58.642 709.299011 2+ 2+ 1416.5850284112705 0 -1.0992142640279572 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 7.859742557072435) Phosphorylation of Y (4: 0.5235602094240838) 0 Y4-{Y1 Y4 Y8} 1 100.0 Confident
|
|
|
2959 2958 P50502, Q8NFI4 LDYDEDASAMLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36034 (Experiment 1) 36034 62.757 685.811401 2+ 2+ 1369.6071472306503 0 0.8033087589070385 99.72826086956522 Confident
|
|
|
2960 2959 P31948 TYEEGLKHEANNPQLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16207 (Experiment 1) 16207 38.607 624.31543 3+ 3+ 1869.9220905309703 0 1.265424217106565 100.0 Confident
|
|
|
2961 2960 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 LLLPGELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38180 (Experiment 1) 38180 65.354 477.305237 2+ 2+ 952.5957180483204 0 0.21267114115266889 100.0 Confident
|
|
|
2962 2961 P62805 KTVTAMDVVYALKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37699 (Experiment 1) 37699 64.773 532.30542 3+ 3+ 1593.8912484270104 0 1.9927024192878886 100.0 Confident
|
|
|
2963 2962 P07900, Q58FG0 HIYYITGETK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21863 (Experiment 1) 21863 46.042 652.80011 2+ 2+ 1303.5849688416204 0 0.5347924412341175 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
2964 2963 P62805 DNIQGITKPAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21028 (Experiment 1) 21028 44.757 442.589569 3+ 3+ 1324.74629844548 0 0.43618616212724304 100.0 Confident
|
|
|
2965 2964 P07900 LGIHEDSQNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9224 (Experiment 1) 9224 27.11 584.790466 2+ 2+ 1167.5632487030703 0 2.676490013141233 99.73958333333334 Confident
|
|
|
2966 2965 P40121 YQEGGVESAFHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18852 (Experiment 1) 18852 42.112 451.214783 3+ 3+ 1350.6204292260206 0 1.5442584849473453 98.7012987012987 Confident
|
|
|
2967 2966 P02786 VEYHFLSPYVSPK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36475 (Experiment 1) 36475 63.304 549.259583 3+ 3+ 1644.7589104523104 0 -1.2082024616741713 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 5.977069681091233) Phosphorylation of Y (3: 67.2904560922729) 0 Y3-{Y3 Y9} 1 100.0 Confident
|
|
|
2968 2967 P25788 LYEEGSNKR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5452 (Experiment 1) 5452 19.034 588.26062 2+ 2+ 1174.5019674936502 0 4.011480199145987 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 85.68935427574172) Y2 1 0 92.78350515463917 Confident
|
|
|
2969 2968 P16401 KATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24462 (Experiment 1) 24462 49.283 447.597687 3+ 3+ 1339.7711162109902 0 0.08593176948956684 100.0 Confident
|
|
|
2970 2969 P04844 YIANTVELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25925 (Experiment 1) 25925 50.985 539.799255 2+ 2+ 1077.5818588893303 0 1.9434827891276754 99.45652173913044 Confident
|
|
|
2971 2970 O60506 GYAFVTFCTK Phosphorylation of Y(2) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41532 (Experiment 1) 41532 69.96 637.270569 2+ 2+ 1272.52501143735 0 1.2346647133286448 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.73474801061008 Confident
|
|
|
2972 2971 Q07864 GSTLEEVYGSVAK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31713 (Experiment 1) 31713 57.724 710.330017 2+ 2+ 1418.6330412328505 0 8.75645274483147 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 95.98603839441536) Y8 1 0 99.1869918699187 Doubtful
|
|
|
2973 2972 P19338 GFGFVDFNSEEDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44072 (Experiment 1) 44072 74.274 781.34491 2+ 2+ 1560.6732526445203 0 1.289075046486626 100.0 Confident
|
|
|
2974 2973 P61247 TTDGYLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25807 (Experiment 1) 25807 50.85 469.75116 2+ 2+ 937.48689587533 0 0.9272907958244769 100.0 Confident
|
|
|
2975 2974 P00558 ALMDEVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29180 (Experiment 1) 29180 54.782 452.743927 2+ 2+ 903.4735543103104 0 -0.27967670954571905 99.45945945945947 Confident
|
|
|
2976 2975 P52272 AFITNIPFDVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45822 (Experiment 1) 45822 78.385 632.850525 2+ 2+ 1263.6863239578704 0 0.13676889106360576 100.0 Confident
|
|
|
2977 2976 P21281 DHADVSNQLYACYAIGK Phosphorylation of Y(10) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33598 (Experiment 1) 33598 59.884 668.955505 3+ 3+ 2003.8448419875804 0 -0.07792646045559694 Phosphorylation of Y (10: Random) Phosphorylation of Y (10: 0.0, 13: 0.0) Phosphorylation of Y (10: 0.0) 0 Y10-{Y10 Y13} 1 100.0 Confident
|
|
|
2978 2977 Q9HB71 SKIETEIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9767 (Experiment 1) 9767 28.154 474.274231 2+ 2+ 946.5335117145803 0 0.41890528331012855 99.1869918699187 Confident
|
|
|
2979 2978 O00505 IEVLQQHENEDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24889 (Experiment 1) 24889 49.778 613.283875 3+ 3+ 1836.8295091932705 0 0.15566817133778368 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 96.12277867528272) Y13 1 0 98.49624060150376 Confident
|
|
|
2980 2979 P22234 EVYELLDSPGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35354 (Experiment 1) 35354 61.932 625.318237 2+ 2+ 1248.62378327096 0 -1.4890032796887251 99.7289972899729 Confident
|
|
|
2981 2980 P61313 RNPDTQWITKPVHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15721 (Experiment 1) 15721 37.93 430.737396 4+ 4+ 1718.9216370385004 0 -0.6726284853453187 100.0 Doubtful
|
|
|
2982 2981 P08134, P61586 LVIVGDGACGK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22997 (Experiment 1) 22997 47.443 544.793457 2+ 2+ 1087.56957995347 0 2.552453566255154 100.0 Confident
|
|
|
2983 2982 P61158 KDYEEIGPSICR Phosphorylation of Y(3) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23167 (Experiment 1) 23167 47.644 516.227173 3+ 3+ 1545.6534594076 0 4.022916882052952 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
2984 2983 Q96BF3 GQSIYSTSFPQPAPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31133 (Experiment 1) 31133 57.043 858.394348 2+ 2+ 1714.77160039433 0 1.481065094153404 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
2985 2984 P23246 YGEPGEVFINK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31366 (Experiment 1) 31366 57.313 626.814026 2+ 2+ 1251.6135529404303 0 -0.04297451066163006 100.0 Confident
|
|
|
2986 2985 Q14974 LQQVLQMESHIQSTSDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29718 (Experiment 1) 29718 55.4 667.334534 3+ 3+ 1998.9792881372605 0 1.240989468755219 100.0 Confident
|
|
|
2987 2986 P11021 IINEPTAAAIAYGLDKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38859 (Experiment 1) 38859 66.187 606.006531 3+ 3+ 1814.9890478919804 0 4.794089899355902 100.0 Doubtful
|
|
|
2988 2987 P49257 DIDNLVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27696 (Experiment 1) 27696 53.051 486.759308 2+ 2+ 971.5036085686302 0 0.4668610857369597 99.45799457994579 Confident
|
|
|
2989 2988 P35579, P35580 ADFCIIHYAGK Phosphorylation of Y(8) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34801 (Experiment 1) 34801 61.289 687.799561 2+ 2+ 1373.5839232958003 0 0.46944699835091835 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
2990 2989 P33993 TAIHEVMEQQTISIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29755 (Experiment 1) 29755 55.445 600.317627 3+ 3+ 1797.9294844105304 0 0.8702006664975682 99.40828402366864 Confident
|
|
|
2991 2990 P26373 LATQLTGPVMPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35317 (Experiment 1) 35317 61.888 691.893921 2+ 2+ 1381.7751560456102 0 -1.3491784353141365 92.40837696335078 Confident
|
|
|
2992 2991 P53618 LVTEMGTYATQSALSSSRPTK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31501 (Experiment 1) 31501 57.473 770.030945 3+ 3+ 2307.08177777765 0 -4.663071410766373 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Doubtful
|
|
|
2993 2992 P62829 ECADLWPR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32515 (Experiment 1) 32515 58.647 523.739746 2+ 2+ 1045.46511488493 0 -0.16784913314062166 99.45945945945947 Confident
|
|
|
2994 2993 Q99497 GAEEMETVIPVDVMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44873 (Experiment 1) 44873 76.281 838.406067 2+ 2+ 1674.7956933596602 0 1.1257724121612986 100.0 Confident
|
|
|
2995 2994 Q15393 IVILEYQPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35467 (Experiment 1) 35467 62.061 595.344238 2+ 2+ 1188.6754249210003 0 -1.2613313728395548 93.76693766937669 Confident
|
|
|
2996 2995 P14649, P60660 ALGQNPTNAEVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22729 (Experiment 1) 22729 47.124 677.869324 2+ 2+ 1353.7252286477305 0 -0.8361349058866667 99.73190348525469 Confident
|
|
|
2997 2996 P41250 LPFAAAQIGNSFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43008 (Experiment 1) 43008 72.453 696.375305 2+ 2+ 1390.7357337617802 0 0.2321339286418381 99.45652173913044 Confident
|
|
|
2998 2997 P00403 VVLPIEAPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40838 (Experiment 1) 40838 68.941 553.850769 2+ 2+ 1105.6859300350502 0 0.9524518061504065 100.0 Confident
|
|
|
2999 2998 P46777 YLMEEDEDAYKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21358 (Experiment 1) 21358 45.234 511.897156 3+ 3+ 1532.6704757632006 0 -0.5451376123258603 100.0 Confident
|
|
|
3000 2999 Q06830 KQGGLGPMNIPLVSDPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38529 (Experiment 1) 38529 65.786 584.322876 3+ 3+ 1749.9447405518504 0 1.1740370574549208 97.74436090225565 Confident
|
|
|
3001 3000 P19338 VTLDWAKPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26033 (Experiment 1) 26033 51.112 529.306091 2+ 2+ 1056.5967806774804 0 0.8014167887526269 93.08510638297872 Confident
|
|
|
3002 3001 P38159, Q96E39 DSYESYGNSR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11957 (Experiment 1) 11957 32.038 629.224915 2+ 2+ 1256.4346757794704 0 0.4777998919639178 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 12.466168617199592) Phosphorylation of Y (3: 99.65095986038395) 0 Y6-{Y3 Y6} 1 99.7289972899729 Confident
|
|
|
3003 3002 Q15052 GDIIYVTR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31052 (Experiment 1) 31052 56.947 508.744965 2+ 2+ 1015.4739618406604 0 1.3909009242549637 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
3004 3003 P61313 GATYGKPVHHGVNQLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7623 (Experiment 1) 7623 23.73 427.23349 4+ 4+ 1704.9059869743603 0 -0.6628932912907726 100.0 Doubtful
|
|
|
3005 3004 P06748 GPSSVEDIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14157 (Experiment 1) 14157 35.532 466.24057 2+ 2+ 930.4658260775802 0 0.8160909472855239 100.0 Confident
|
|
|
3006 3005 P05141, P12235, P12236 LLLQVQHASK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19274 (Experiment 1) 19274 42.636 568.843689 2+ 2+ 1135.6713426000704 0 1.303054130652784 98.91598915989161 Confident
|
|
|
3007 3006 TRYP_PIG LSSPATLNSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16818 (Experiment 1) 16818 39.354 523.28418 2+ 2+ 1044.5563724174804 0 -2.451196610168991 100.0 Confident
|
|
|
3008 3007 P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8 YESLTDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16489 (Experiment 1) 16489 38.945 520.251221 2+ 2+ 1038.4869554449801 0 0.8972801943779778 99.45799457994579 Confident
|
|
|
3009 3008 P28072 LAAIAESGVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20904 (Experiment 1) 20904 44.595 558.306885 2+ 2+ 1114.5982372294602 0 0.8775082322251635 99.72826086956522 Confident
|
|
|
3010 3009 P15954 NLPFSVENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32285 (Experiment 1) 32285 58.381 524.276489 2+ 2+ 1046.5396597241802 0 -1.1774859034321072 97.289972899729 Confident
|
|
|
3011 3010 P62937, PPIA_HUMAN SIYGEKFEDENFILK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40695 (Experiment 1) 40695 68.741 611.307556 3+ 3+ 1830.9039808553407 0 -1.7134039770349059 100.0 Confident
|
|
|
3012 3011 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10002 (Experiment 1) 10002 28.584 607.758179 2+ 2+ 1213.5016331404804 0 0.1414427035186971 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3013 3012 P78527 LACDVDQVTR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17994 (Experiment 1) 17994 40.947 588.787109 2+ 2+ 1175.5604718217503 0 -0.685098917274588 100.0 Confident
|
|
|
3014 3013 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26379 (Experiment 1) 26379 51.511 523.252625 2+ 2+ 1044.4892775516303 0 1.3564353078984328 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Confident
|
|
|
3015 3014 P31146 DGGLICTSCR Carbamidomethylation of C(6, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20643 (Experiment 1) 20643 44.293 569.753235 2+ 2+ 1137.4906780097701 0 1.0873636839112424 99.73045822102425 Confident
|
|
|
3016 3015 P62805 DNIQGITKPAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20823 (Experiment 1) 20823 44.501 442.590149 3+ 3+ 1324.74629844548 0 1.7466559373458808 100.0 Confident
|
|
|
3017 3016 Q07020 ILTFDQLALDSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45990 (Experiment 1) 45990 78.732 730.905273 2+ 2+ 1459.7922455783903 0 2.563600052556347 100.0 Confident
|
|
|
3018 3017 P08865 FAAATGATPIAGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21097 (Experiment 1) 21097 44.849 602.328613 2+ 2+ 1202.6407707477802 0 1.5791393258662285 100.0 Confident
|
|
|
3019 3018 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23041 (Experiment 1) 23041 47.499 449.208374 3+ 3+ 1344.6002845525904 0 2.232114583418055 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 19.937248578474765) Phosphorylation of Y (7: 58.63874345549738) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3020 3019 P00558 AHSSMVGVNLPQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20425 (Experiment 1) 20425 44.037 456.575256 3+ 3+ 1366.7027193813403 0 0.890119276093805 100.0 Confident
|
|
|
3021 3020 P30101 GFPTIYFSPANK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45508 (Experiment 1) 45508 77.677 711.332214 2+ 2+ 1420.6428180709106 0 4.960432222909802 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 94.4153577661431) Y6 1 0 93.6 Doubtful
|
|
|
3022 3021 Q1KMD3 FYGRDYEYNRYRDYYR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35717 (Experiment 1) 35717 62.364 1190.494019 2+ 2+ 2377.99059470448 1 -8.598500690008997 Phosphorylation of Y (2: Random) Phosphorylation of Y (11: 0.0, 14: 0.0, 15: 0.0) Phosphorylation of Y (11: 0.0) 0 Y2-{Y2 Y6 Y8 Y11 Y14 Y15} 1 93.21148825065274 Doubtful
|
|
|
3023 3022 P14317 RSPEAPQPVIAMEEPAVPAPLPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38381 (Experiment 1) 38381 65.608 808.772095 3+ 3+ 2423.2882666687806 0 2.5507583689416427 100.0 Confident
|
|
|
3024 3023 P62263 DESSPYAAMLAAQDVAQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42623 (Experiment 1) 42623 71.743 668.291443 3+ 3+ 2001.8503212908406 0 1.0865075473309553 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3025 3024 P78527 GYGLFAGPCK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34271 (Experiment 1) 34271 60.677 535.260254 2+ 2+ 1068.50625142092 0 -0.2768321203625199 100.0 Confident
|
|
|
3026 3025 P04350, P07437, P68371, Q13509 IMNTFSVVPSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36948 (Experiment 1) 36948 63.867 660.355042 2+ 2+ 1318.6955087425804 0 0.016902873815744054 100.0 Confident
|
|
|
3027 3026 P62805 KTVTAMDVVYALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41682 (Experiment 1) 41682 70.195 480.271545 3+ 3+ 1437.7901374034104 0 1.8518697894041187 100.0 Confident
|
|
|
3028 3027 O75608 TLVNPANVTFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34728 (Experiment 1) 34728 61.204 602.340332 2+ 2+ 1202.6659228664603 0 0.15622392770228138 96.19565217391303 Confident
|
|
|
3029 3028 Q16658 YLAPSGPSGTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21578 (Experiment 1) 21578 45.607 595.824402 2+ 2+ 1189.6342883850102 0 -0.03131680504061717 96.49595687331536 Confident
|
|
|
3030 3029 P11021 DAGTIAGLNVMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38908 (Experiment 1) 38908 66.243 609.316528 2+ 2+ 1216.6234064314801 0 -4.023643828506231 100.0 Confident
|
|
|
3031 3030 Q86UX7 ETTLSYYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21151 (Experiment 1) 21151 44.922 502.75061 2+ 2+ 1003.4862271689904 0 0.4374908447837511 91.08108108108108 Confident
|
|
|
3032 3031 P13693 DLISHDEMFSDIYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43297 (Experiment 1) 43297 72.967 571.59967 3+ 3+ 1711.7763378140703 0 0.49147795336690386 100.0 Confident
|
|
|
3033 3032 Q969H8 GAEIEYAMAYSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37475 (Experiment 1) 37475 64.498 706.793823 2+ 2+ 1411.5730838285804 0 0.006535000164531849 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 12.035847649825694) Phosphorylation of Y (6: 0.32310177705977383) 0 Y6-{Y6 Y10} 1 100.0 Confident
|
|
|
3034 3033 P40429 CEGINISGNFYR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36822 (Experiment 1) 36822 63.714 715.331604 2+ 2+ 1428.64559842804 0 2.136523011970012 99.72826086956522 Confident
|
|
|
3035 3034 Q9UGN4 EELHYASVVFDSNTNR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35914 (Experiment 1) 35914 62.602 981.429993 2+ 2+ 1959.8363854788604 1 2.901723879141828 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.55671902268762) Y5 1 0 98.91598915989161 Confident
|
|
|
3036 3035 P60900 HITIFSPEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26298 (Experiment 1) 26298 51.417 578.808716 2+ 2+ 1155.60365696307 0 -0.6719803537699409 99.45799457994579 Confident
|
|
|
3037 3036 P23246 FGQGGAGPVGGQGPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16462 (Experiment 1) 16462 38.912 671.336731 2+ 2+ 1340.65854607024 0 0.27035332439473847 100.0 Confident
|
|
|
3038 3037 Q9Y2W1 ASESSKPWPDATYGTGSASR Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21428 (Experiment 1) 21428 45.336 712.307922 3+ 3+ 2133.9004422874 0 0.6992824135898638 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 100.0) Y13 1 0 100.0 Confident
|
|
|
3039 3038 P31948 LDPHNHVLYSNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13562 (Experiment 1) 13562 34.584 515.572693 3+ 3+ 1543.6932905039803 0 1.9131484172654216 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3040 3039 P01911, P04229, P13760, P20039, Q29974, Q30154, Q30167, Q5Y7A7, Q95IE3 AAVDTYCR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11594 (Experiment 1) 11594 31.448 478.217499 2+ 2+ 954.4229157197801 0 -2.583183412468472 99.73474801061008 Confident
|
|
|
3041 3040 P10809 VGLQVVAVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28263 (Experiment 1) 28263 53.719 456.797943 2+ 2+ 911.5804023373505 0 1.0187545587425364 100.0 Confident
|
|
|
3042 3041 P0CG47, P0CG48, P62979, P62987 TITLEVEPSDTIENVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39217 (Experiment 1) 39217 66.642 894.468445 2+ 2+ 1786.9200248423003 0 1.2925146085230428 100.0 Confident
|
|
|
3043 3042 P04083 GDRSEDFGVNEDLADSDAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28441 (Experiment 1) 28441 53.926 689.965881 3+ 3+ 2066.87771908934 0 -0.9205711349107631 100.0 Confident
|
|
|
3044 3043 P25205 GGYTSGTFR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15366 (Experiment 1) 15366 37.436 513.208191 2+ 2+ 1024.4015251763901 0 0.2960690039105962 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 99.20424403183023 Confident
|
|
|
3045 3044 Q5VWZ2 ASAVYQALQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21766 (Experiment 1) 21766 45.905 579.781372 2+ 2+ 1157.5481894100803 0 0.0014283794401154042 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.50959860383944) Y5 1 0 98.92183288409704 Confident
|
|
|
3046 3045 P62750 LAPDYDALDVANK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34160 (Experiment 1) 34160 60.546 702.853394 2+ 2+ 1403.6932598131104 0 -0.7289898550301093 100.0 Confident
|
|
|
3047 3046 Q9Y3U8 YPMAVGLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26858 (Experiment 1) 26858 52.061 496.766022 2+ 2+ 991.5160878286301 0 1.4123749066392544 100.0 Confident
|
|
|
3048 3047 P25786 LVSLIGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28034 (Experiment 1) 28034 53.441 408.762512 2+ 2+ 815.5116540711902 0 -1.4470543010142878 95.4054054054054 Confident
|
|
|
3049 3048 Q99873, Q9NR22 EVDIYTVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26581 (Experiment 1) 26581 51.742 483.760193 2+ 2+ 965.5069626135703 0 -1.1674646775615045 99.73333333333333 Confident
|
|
|
3050 3049 Q07955 DAEDAVYGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13853 (Experiment 1) 13853 35.021 538.209412 2+ 2+ 1074.40191909921 0 2.1849973750483147 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3051 3050 P52272 FGSGMNMGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20245 (Experiment 1) 20245 43.836 478.707214 2+ 2+ 955.4004064533901 0 -0.5550226772593403 99.7340425531915 Confident
|
|
|
3052 3051 GSTP1_HUMAN, P09211 FQDGDLTLYQSNTILR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44341 (Experiment 1) 44341 74.998 982.462036 2+ 2+ 1962.9088221431302 0 0.35468214917748514 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 97.20767888307155) Y9 1 0 99.1869918699187 Confident
|
|
|
3053 3052 O95168 GLIENPALLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37588 (Experiment 1) 37588 64.638 548.328247 2+ 2+ 1094.6447934990601 0 -2.601019809387754 93.43832020997375 Confident
|
|
|
3054 3053 P04350, P07437, P68371, Q13509, Q13885, Q9BVA1 EIVHIQAGQCGNQIGAK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20564 (Experiment 1) 20564 44.202 608.313171 3+ 3+ 1821.91556568189 0 1.1605426463432955 100.0 Confident
|
|
|
3055 3054 P47756 DYLLCDYNR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35833 (Experiment 1) 35833 62.503 616.270264 2+ 2+ 1230.5339227207403 0 -6.448147493934294 99.45652173913044 Doubtful
|
|
|
3056 3055 P53675, Q00610 IVLDNSVFSEHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32685 (Experiment 1) 32685 58.84 472.581299 3+ 3+ 1414.7204776204605 0 1.1214866732814623 100.0 Confident
|
|
|
3057 3056 Q8NEY8 SFYSSHYAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16460 (Experiment 1) 16460 38.91 599.240295 2+ 2+ 1196.4651880621102 0 0.70840101547424 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 7: 0.0) Phosphorylation of Y (3: 96.16055846422339) 0 Y3-{Y3 Y7} 1 96.24664879356568 Confident
|
|
|
3058 3057 P32119, Q06830 QITVNDLPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32895 (Experiment 1) 32895 59.077 606.342041 2+ 2+ 1210.66698549562 0 2.097476274791937 100.0 Confident
|
|
|
3059 3058 Q07955 KEDMTYAVR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13890 (Experiment 1) 13890 35.092 596.75708 2+ 2+ 1191.4995249655003 0 0.06878919738662814 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
3060 3059 P62424 KVVNPLFEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23517 (Experiment 1) 23517 48.082 537.321411 2+ 2+ 1072.6280808057604 0 0.1751843911165431 100.0 Confident
|
|
|
3061 3060 Q7L2H7 YTVYCSLIK Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35985 (Experiment 1) 35985 62.693 613.78009 2+ 2+ 1225.5454125287602 0 0.17476752393672626 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 16.666495241286455) Phosphorylation of Y (4: 99.82547993019197) 0 Y4-{Y1 Y4} 1 99.72826086956522 Confident
|
|
|
3062 3061 O75368 VYIASSSGSTAIK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22054 (Experiment 1) 22054 46.297 682.329163 2+ 2+ 1362.6432119937303 0 0.4111453141703735 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 87.23747980613894) Y2 1 0 98.71134020618557 Confident
|
|
|
3063 3062 Q86UX7 LTQLYEQAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20688 (Experiment 1) 20688 44.342 561.302979 2+ 2+ 1120.5876725457604 0 3.3248826083448235 100.0 Confident
|
|
|
3064 3063 Q9HCC0 AFYGDTLVTGFAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45955 (Experiment 1) 45955 78.674 749.343201 2+ 2+ 1496.6700954479106 0 1.1701050432233628 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.12739965095986) Y3 1 0 99.7289972899729 Confident
|
|
|
3065 3064 Q9UBE0 AQNLNPMVDVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28605 (Experiment 1) 28605 54.116 614.822083 2+ 2+ 1227.6281574587504 0 1.183764692969912 99.45652173913044 Confident
|
|
|
3066 3065 Q9NWQ8 SPSSCNDLYATVK Phosphorylation of Y(9) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22871 (Experiment 1) 22871 47.29 761.316772 2+ 2+ 1520.6218249261506 0 -1.8611533363374064 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 99.45799457994579 Confident
|
|
|
3067 3066 P23526 FDNLYGCR Phosphorylation of Y(5) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23293 (Experiment 1) 23293 47.803 562.71698 2+ 2+ 1123.4157953415402 0 3.2091944573019915 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
3068 3067 P53041 TECYGYALGDATR Phosphorylation of Y(4) Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28216 (Experiment 1) 28216 53.666 778.809448 2+ 2+ 1555.6014238347402 0 1.8741664692244084 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 6: 0.0) Phosphorylation of Y (4: 0.6456824222210642) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
3069 3068 Q02790 GEHSIVYLKPSYAFGSVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38770 (Experiment 1) 38770 66.081 707.012817 3+ 3+ 2118.0187069452804 0 -0.983171080792197 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 9.229755610067862) Phosphorylation of Y (7: 24.694589877835956) 0 Y7-{Y7 Y12} 1 100.0 Confident
|
|
|
3070 3069 P49736 IFASIAPSIYGHEDIKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32897 (Experiment 1) 32897 59.08 480.263641 4+ 4+ 1916.0155969929904 1 3.388620041927087 100.0 Doubtful
|
|
|
3071 3070 P14618 LDIDSPPITAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32283 (Experiment 1) 32283 58.379 599.326538 2+ 2+ 1196.64010204144 0 -1.3172893940679544 99.73118279569893 Confident
|
|
|
3072 3071 P05388, Q8NHW5 IIQLLDDYPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42070 (Experiment 1) 42070 70.817 609.342896 2+ 2+ 1216.6703395405602 0 0.7381118951804666 100.0 Confident
|
|
|
3073 3072 P08238, P14625, Q58FF6, Q58FF7, Q58FF8 ELISNASDALDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28261 (Experiment 1) 28261 53.716 638.325989 2+ 2+ 1274.6354105838202 0 1.5779443177991739 100.0 Confident
|
|
|
3074 3073 P09622 ALLNNSHYYHMAHGK Phosphorylation of Y(8, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15685 (Experiment 1) 15685 37.881 639.261597 3+ 3+ 1914.7637688234406 0 -0.42091455755591667 Phosphorylation of Y (8: Very Confident, 9: Very Confident) Phosphorylation of Y (8: 99.47643979057592, 9: 99.47643979057592) Y8, Y9 2 0 99.24812030075188 Confident
|
|
|
3075 3074 P09429 KHPDASVNFSEFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23774 (Experiment 1) 23774 48.416 531.595276 3+ 3+ 1591.7630707084304 0 0.5818283916942686 100.0 Confident
|
|
|
3076 3075 Q9NR09 TAEIVYAATTSLR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43631 (Experiment 1) 43631 73.49 738.357117 2+ 2+ 1474.7068748794504 0 -4.871476054349768 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 98.86914378029078) Y6 1 0 99.45652173913044 Doubtful
|
|
|
3077 3076 Q15717 DANLYISGLPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42384 (Experiment 1) 42384 71.316 649.812195 2+ 2+ 1297.6067669153601 0 2.3623427599817806 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 99.73890339425587 Confident
|
|
|
3078 3077 P47756 STLNEIYFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37231 (Experiment 1) 37231 64.202 586.303467 2+ 2+ 1170.5920892198603 0 0.2488869710835305 99.73262032085562 Confident
|
|
|
3079 3078 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23203 (Experiment 1) 23203 47.684 673.307434 2+ 2+ 1344.6002845525904 0 0.022659623565177228 Phosphorylation of Y (7: Random) Phosphorylation of Y (4: 0.0, 7: 0.0) Phosphorylation of Y (7: 12.41014657245024) 0 Y9-{Y4 Y7 Y9} 1 95.32467532467533 Confident
|
|
|
3080 3079 P00519 QFDSSTFGGHKSEKPALPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19154 (Experiment 1) 19154 42.491 418.614777 5+ 5+ 2088.0388516187104 0 -0.6444836518075889 100.0 Doubtful
|
|
|
3081 3080 Q9Y230 TTEMETIYDLGTK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40276 (Experiment 1) 40276 68.142 791.341858 2+ 2+ 1580.6681064122301 0 0.6676348789658788 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 99.72826086956522 Confident
|
|
|
3082 3081 P20645 HTLADNFNPVSEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29305 (Experiment 1) 29305 54.926 543.593384 3+ 3+ 1627.7590479571504 0 -0.44479156982175744 100.0 Confident
|
|
|
3083 3082 P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8 YESLTDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16699 (Experiment 1) 16699 39.204 520.251099 2+ 2+ 1038.4869554449801 0 0.6627778913046249 100.0 Confident
|
|
|
3084 3083 P46940 LQQTYAALNSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17350 (Experiment 1) 17350 40.078 658.816772 2+ 2+ 1315.6173315990602 0 1.2594316630889386 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3085 3084 P63010 LLSTDPVTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20763 (Experiment 1) 20763 44.431 522.799622 2+ 2+ 1043.5862755634303 0 -1.5153938398145628 99.1891891891892 Confident
|
|
|
3086 3085 P0C7P4, P47985 VPDFSEYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27651 (Experiment 1) 27651 52.997 546.723938 2+ 2+ 1091.4324909515003 0 0.7610015319411136 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.33507853403141) Y7 1 0 96.19565217391303 Confident
|
|
|
3087 3086 P11142 GTLDPVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15519 (Experiment 1) 15519 37.641 429.731812 2+ 2+ 857.4494477374503 0 -0.43826277071495845 99.7340425531915 Confident
|
|
|
3088 3087 Q70E73, Q7Z5R6 ASGIYYVPK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29156 (Experiment 1) 29156 54.756 539.255005 2+ 2+ 1076.4943629320703 0 1.014487955925261 Phosphorylation of Y (6: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (6: 1.3979911885671052) 0 Y6-{Y5 Y6} 1 99.7289972899729 Confident
|
|
|
3089 3088 Q9Y5S9 GYTLVEYETYK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36610 (Experiment 1) 36610 63.458 723.317444 2+ 2+ 1444.6163285395505 0 2.7695570975910218 Phosphorylation of Y (2: Random) Phosphorylation of Y (7: 0.0, 10: 0.0) Phosphorylation of Y (10: 0.0) 0 Y2-{Y2 Y7 Y10} 1 96.4769647696477 Doubtful
|
|
|
3090 3089 P56545, Q13363 PLVALLDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41164 (Experiment 1) 41164 69.417 477.293091 2+ 2+ 952.57056592964 0 1.1137160166072253 97.289972899729 Confident
|
|
|
3091 3090 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29307 (Experiment 1) 29307 54.928 677.841492 2+ 2+ 1353.6693671719202 0 -0.6905042763926236 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.68411867364746) Y4 1 0 99.73045822102425 Confident
|
|
|
3092 3091 P63010, Q10567 NVEGQDMLYQSLK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39673 (Experiment 1) 39673 67.283 802.857422 2+ 2+ 1603.6953242195802 0 3.093240482833723 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 99.7340425531915 Confident
|
|
|
3093 3092 P17844, Q92841 APILIATDVASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34765 (Experiment 1) 34765 61.246 613.859497 2+ 2+ 1225.7030366511704 0 1.1439236657391982 100.0 Confident
|
|
|
3094 3093 Q9HCC0 KFEEEGNPYYSSAR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17474 (Experiment 1) 17474 40.256 586.244934 3+ 3+ 1755.7141450878605 0 -0.6666653288475677 Phosphorylation of Y (9: Random) Phosphorylation of Y (9: 0.0, 10: 0.0) Phosphorylation of Y (9: 2.2617124394184165) 0 Y9-{Y9 Y10} 1 100.0 Confident
|
|
|
3095 3094 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12965 (Experiment 1) 12965 33.683 600.786865 2+ 2+ 1199.5587540937802 0 0.35201563922002943 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 90.40139616055846) Y9 1 0 98.91891891891892 Confident
|
|
|
3096 3095 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21764 (Experiment 1) 21764 45.902 759.859253 2+ 2+ 1517.7014551458406 0 1.6436758723036196 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 96.33507853403141) Y11 1 0 99.1869918699187 Confident
|
|
|
3097 3096 P29401 ISSDLDGHPVPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16094 (Experiment 1) 16094 38.464 422.222839 3+ 3+ 1263.6459156978704 0 0.6093955551127416 99.24812030075188 Confident
|
|
|
3098 3097 P60174 DCGATWVVLGHSER Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34587 (Experiment 1) 34587 61.044 529.5849 3+ 3+ 1585.7307250343304 0 1.3504716184415986 100.0 Confident
|
|
|
3099 3098 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18216 (Experiment 1) 18216 41.289 506.239624 3+ 3+ 1515.6953850714303 0 1.0914001091539722 100.0 Confident
|
|
|
3100 3099 P06748 ADKDYHFK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6390 (Experiment 1) 6390 20.855 552.231262 2+ 2+ 1102.4484753688105 0 -0.4566041792883136 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.68411867364746) Y5 1 0 99.19137466307278 Confident
|
|
|
3101 3100 P29692 FYEQMNGPVAGASR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27020 (Experiment 1) 27020 52.251 536.229919 3+ 3+ 1605.6646927976403 0 2.0108342296844177 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
3102 3101 B2RPK0, P09429, P23497 FKDPNAPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7499 (Experiment 1) 7499 23.481 458.748474 2+ 2+ 915.4814165720702 0 1.066483492436492 99.74811083123426 Confident
|
|
|
3103 3102 P68363, P68366, Q71U36, Q9BQE3 EDMAALEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18382 (Experiment 1) 18382 41.51 453.715729 2+ 2+ 905.4164333570104 0 0.51982946671446 99.45945945945947 Confident
|
|
|
3104 3103 Q00688 AWTVEQLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34129 (Experiment 1) 34129 60.509 501.769989 2+ 2+ 1001.5294293936502 0 -3.9901861249510544 98.75311720698254 Confident
|
|
|
3105 3104 P60842, Q14240 GYDVIAQAQSGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24857 (Experiment 1) 24857 49.74 697.84845 2+ 2+ 1393.6837577585704 0 -1.0107429262188379 100.0 Confident
|
|
|
3106 3105 P62280 NMSVHLSPCFR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29158 (Experiment 1) 29158 54.758 449.881866 3+ 3+ 1346.62236088566 0 1.043025942766706 100.0 Confident
|
|
|
3107 3106 P27797 AKIDDPTDSKPEDWDKPEHIPDPDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24677 (Experiment 1) 24677 49.534 592.685486 5+ 5+ 2958.3883105313703 0 0.9236389830860128 100.0 Doubtful
|
|
|
3108 3107 P48643 HKLDVTSVEDYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20761 (Experiment 1) 20761 44.429 505.235229 3+ 3+ 1512.6861394348705 0 -1.5054584085036116 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3109 3108 P61158 QYTGINAISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21356 (Experiment 1) 21356 45.232 547.795532 2+ 2+ 1093.5767735088903 0 -0.23954416953316296 99.7289972899729 Confident
|
|
|
3110 3109 P55072 MDELQLFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43299 (Experiment 1) 43299 72.97 526.265869 2+ 2+ 1050.5168161046201 0 0.3505470397040076 100.0 Confident
|
|
|
3111 3110 P36542 SEVATLTAAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18822 (Experiment 1) 18822 42.076 524.288147 2+ 2+ 1046.5607890915803 0 0.9078744820182529 100.0 Confident
|
|
|
3112 3111 P62258 QMVETELK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19077 (Experiment 1) 19077 42.385 489.250305 2+ 2+ 976.4899326504403 0 -3.9607218171068843 92.34828496042216 Confident
|
|
|
3113 3112 P84090 ADTQTYQPYNKDWIK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30125 (Experiment 1) 30125 55.873 650.959595 3+ 3+ 1949.8560582942803 0 0.45947843917078646 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 9: 0.0) Phosphorylation of Y (6: 0.17452006980802792) 0 Y6-{Y6 Y9} 1 100.0 Confident
|
|
|
3114 3113 P38919 EQIYDVYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30190 (Experiment 1) 30190 55.951 583.250305 2+ 2+ 1164.4852548003503 0 0.6877549574471263 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 12.680432057035638) Phosphorylation of Y (4: 52.87842071249991) 0 Y7-{Y4 Y7} 1 100.0 Confident
|
|
|
3115 3114 O95185, Q8IZJ1 LSDTANYTCVAK Phosphorylation of Y(7) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31535 (Experiment 1) 31535 57.512 711.801331 2+ 2+ 1421.5897965218803 0 -1.1853402282015966 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.86914378029078) Y7 1 0 98.93048128342245 Confident
|
|
|
3116 3115 P07437, Q13509, Q13885, Q9BVA1 AILVDLEPGTMDSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44005 (Experiment 1) 44005 74.141 539.28363 3+ 3+ 1614.8287077401003 0 0.21810387032644507 98.7012987012987 Confident
|
|
|
3117 3116 Q9UK45 ESILDLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35356 (Experiment 1) 35356 61.935 452.752289 2+ 2+ 903.4913125494302 0 -1.4218384475841777 96.4769647696477 Confident
|
|
|
3118 3117 P35268 AGNLGGGVVTIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27572 (Experiment 1) 27572 52.898 621.843323 2+ 2+ 1241.6727991520504 0 -0.5677356718738885 100.0 Confident
|
|
|
3119 3118 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29459 (Experiment 1) 29459 55.102 609.259399 2+ 2+ 1216.5053215385904 0 -0.8834260622151218 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.33452891645359) Phosphorylation of Y (8: 0.0) 0 Y8-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
3120 3119 Q969Q0 DSLYAQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12800 (Experiment 1) 12800 33.438 495.208435 2+ 2+ 988.4015251763901 0 0.7995528379215701 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.38449111470113) Y4 1 0 99.74358974358975 Confident
|
|
|
3121 3120 P18085, P61204, P84077, P84085 HYFQNTQGLIFVVDSNDR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44388 (Experiment 1) 44388 75.111 745.007507 3+ 3+ 2232.0000967590204 0 0.2661452832014823 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 99.25373134328358 Doubtful
|
|
|
3122 3121 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 HQGVMVGMGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13295 (Experiment 1) 13295 34.147 586.289612 2+ 2+ 1170.56378338038 0 0.757037690666821 100.0 Confident
|
|
|
3123 3122 P23396 DEILPTTPISEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33739 (Experiment 1) 33739 60.045 735.886841 2+ 2+ 1469.7613393729305 0 -1.5017955968501482 99.73684210526315 Confident
|
|
|
3124 3123 P04083 SEIDMNDIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26067 (Experiment 1) 26067 51.15 532.750549 2+ 2+ 1063.4855755459903 0 0.90992047735168 96.22641509433963 Confident
|
|
|
3125 3124 O14979, Q14103, Q99729 FGEVVDCTIK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29757 (Experiment 1) 29757 55.448 584.289673 2+ 2+ 1166.5641602198602 0 0.5415523220446765 100.0 Confident
|
|
|
3126 3125 P60866 LIDLHSPSEIVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31572 (Experiment 1) 31572 57.562 675.885986 2+ 2+ 1349.7554661468505 0 1.4447128563287783 99.73333333333333 Confident
|
|
|
3127 3126 P54819 APSVPAAEPEYPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22270 (Experiment 1) 22270 46.571 678.346313 2+ 2+ 1354.6768814729803 0 0.8783083355146374 92.40837696335078 Confident
|
|
|
3128 3127 P04406 QASEGPLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8795 (Experiment 1) 8795 26.207 415.224152 2+ 2+ 828.4341320264803 0 -0.4587400896239156 99.74554707379136 Confident
|
|
|
3129 3128 P24666 SPIAEAVFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33947 (Experiment 1) 33947 60.288 495.274231 2+ 2+ 988.5341804209204 0 -0.2739436589046038 99.74811083123426 Confident
|
|
|
3130 3129 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 DLTDYLMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44127 (Experiment 1) 44127 74.4 499.747406 2+ 2+ 997.4790336135702 0 1.2260737061163844 98.92183288409704 Confident
|
|
|
3131 3130 Q96AE4 QQAAYYAQTSPQGMPQHPPAPQGQ Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25992 (Experiment 1) 25992 51.062 887.724792 3+ 3+ 2660.1479002748606 0 1.744659625461981 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 6: 0.0) Phosphorylation of Y (6: 0.0) 0 Y5-{Y5 Y6} 1 100.0 Confident
|
|
|
3132 3131 P61978 NLPLPPPPPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30206 (Experiment 1) 30206 55.97 597.853516 2+ 2+ 1193.6920780446499 0 0.3353847136333865 99.7289972899729 Confident
|
|
|
3133 3132 P0C7P4, P47985 VPDFSEYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27886 (Experiment 1) 27886 53.271 546.723145 2+ 2+ 1091.4324909515003 0 -0.6894573711493132 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3134 3133 Q5MCW4 HNLYEYDLFGK Phosphorylation of Y(4, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34604 (Experiment 1) 34604 61.063 780.301758 2+ 2+ 1557.5942268035103 1 -5.52611337318629 Phosphorylation of Y (4: Very Confident, 6: Very Confident) Phosphorylation of Y (4: 95.81151832460732, 6: 95.81151832460732) Y4, Y6 2 0 95.13513513513514 Doubtful
|
|
|
3135 3134 P06733 SCNCLLLK Carbamidomethylation of C(2, 4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25523 (Experiment 1) 25523 50.524 504.254517 2+ 2+ 1006.4939724850601 0 0.5042905470739877 100.0 Confident
|
|
|
3136 3135 P13639 RCLYASVLTAQPR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28915 (Experiment 1) 28915 54.479 512.277222 3+ 3+ 1533.80858143221 0 0.8167246986751229 100.0 Confident
|
|
|
3137 3136 P61224, P62834 LVVLGSGGVGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26730 (Experiment 1) 26730 51.911 493.305176 2+ 2+ 984.5967806774802 0 -0.9949319155635049 100.0 Confident
|
|
|
3138 3137 P62826 NLQYYDISAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30121 (Experiment 1) 30121 55.869 647.789429 2+ 2+ 1293.5642333970404 0 0.055318392264353644 Phosphorylation of Y (5: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 8.55148342059337) 0 Y5-{Y4 Y5} 1 99.45652173913044 Confident
|
|
|
3139 3138 A6NNZ2, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1, Q9H4B7 IREEYPDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9728 (Experiment 1) 9728 28.088 539.26947 2+ 2+ 1076.5250722892001 0 -0.6353246634004968 98.91891891891892 Confident
|
|
|
3140 3139 P50990 LVPGGGATEIELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31450 (Experiment 1) 31450 57.414 677.880127 2+ 2+ 1353.7503807664104 0 -3.4517045825830057 99.72972972972973 Confident
|
|
|
3141 3140 Q93084 SMSVYCTPTRPHPTGQGSK Phosphorylation of Y(5) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13299 (Experiment 1) 13299 34.152 724.317505 3+ 3+ 2169.9336740753206 0 -1.3753046263878865 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
3142 3141 Q7L576 ALNLAYSSIYGSYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42422 (Experiment 1) 42422 71.37 829.38501 2+ 2+ 1656.7548877010302 0 0.3492741856925842 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 2.118731618668638) Phosphorylation of Y (13: 0.0) 0 Y10-{Y6 Y10 Y13} 1 100.0 Confident
|
|
|
3143 3142 Q96RP9 EYGCPCITGKPK Phosphorylation of Y(2) Carbamidomethylation of C(4, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14313 (Experiment 1) 14313 35.756 745.312317 2+ 2+ 1488.61423744791 0 -2.788341108765726 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 91.97207678883072) Y2 1 0 98.91598915989161 Confident
|
|
|
3144 3143 P06744 EWFLQAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40644 (Experiment 1) 40644 68.668 496.763123 2+ 2+ 991.5127167003504 0 -1.0303028468645676 99.45652173913044 Confident
|
|
|
3145 3144 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36473 (Experiment 1) 36473 63.301 964.385315 2+ 2+ 1926.7560694694905 0 0.00393871891090448 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 25.214519957742368) Phosphorylation of Y (10: 0.16155088852988692) 0 Y10-{Y10 Y14} 1 100.0 Confident
|
|
|
3146 3145 P31948 LAYINPDLALEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41619 (Experiment 1) 41619 70.093 744.902161 2+ 2+ 1487.7871601979505 0 1.7511514467633778 98.93617021276596 Confident
|
|
|
3147 3146 Q02790 VLQLYPNNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27225 (Experiment 1) 27225 52.487 544.809143 2+ 2+ 1087.6025943339102 0 1.0450757574453953 99.73333333333333 Confident
|
|
|
3148 3147 Q06124 VYENVGLMQQQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27360 (Experiment 1) 27360 52.648 758.848877 2+ 2+ 1515.6792802326204 0 2.583415488564833 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 99.45799457994579 Confident
|
|
|
3149 3148 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21275 (Experiment 1) 21275 45.116 673.310364 2+ 2+ 1344.6002845525904 0 4.374312254358037 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.33452891645359) Phosphorylation of Y (9: 98.70759289176091) 0 Y9-{Y4 Y7 Y9} 1 99.47368421052632 Confident
|
|
|
3150 3149 P17096 KQPPVSPGTALVGSQKEPSEVPTPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22873 (Experiment 1) 22873 47.293 640.601746 4+ 4+ 2557.375167096881 1 -0.2513472534843654 100.0 Doubtful
|
|
|
3151 3150 P34932 LKKEDIYAVEIVGGATR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33278 (Experiment 1) 33278 59.514 648.006104 3+ 3+ 1940.9972432247105 0 -0.39126424067738497 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 100.0 Confident
|
|
|
3152 3151 O75431 NYSNLLAFCR Phosphorylation of Y(2) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43079 (Experiment 1) 43079 72.561 669.289185 2+ 2+ 1336.5635222043902 0 0.22028000538097164 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
3153 3152 Q86VP6 MLTGPVYSQSTALTHK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27882 (Experiment 1) 27882 53.267 605.290649 3+ 3+ 1812.8481364628706 0 1.0910124241602819 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.28057553956835 Confident
|
|
|
3154 3153 P02786 VEYHFLSPYVSPK Phosphorylation of Y(9, 3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36689 (Experiment 1) 36689 63.554 863.370789 2+ 2+ 1724.7252409730604 0 1.0332149184447368 Phosphorylation of Y (3: Very Confident, 9: Very Confident) Phosphorylation of Y (3: 94.58987783595113, 9: 94.58987783595113) Y3, Y9 2 0 99.22879177377892 Confident
|
|
|
3155 3154 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65 NLDIERPTYTNLNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28834 (Experiment 1) 28834 54.387 600.287964 3+ 3+ 1797.84107693648 0 0.5473282172028926 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3156 3155 P38159, Q96E39 DRDYSDHPSGGSYR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7968 (Experiment 1) 7968 24.383 564.552917 3+ 3+ 1690.6372917494903 0 -0.21855042822700096 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 15.102399024346495) Phosphorylation of Y (4: 99.03069466882067) 0 Y4-{Y4 Y13} 1 100.0 Confident
|
|
|
3157 3156 P53396 SAYDSTMETMNYAQIR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37790 (Experiment 1) 37790 64.879 980.894897 2+ 2+ 1959.7743794692603 0 0.4391895077569268 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 14.0602723289365) Phosphorylation of Y (12: 99.82547993019197) 0 Y12-{Y3 Y12} 1 99.45945945945947 Confident
|
|
|
3158 3157 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20906 (Experiment 1) 20906 44.597 673.308105 2+ 2+ 1344.6002845525904 0 1.0192326321676604 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 26.491151515825344) Phosphorylation of Y (4: 0.0) 0 Y4-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3159 3158 P35579 VIQYLAYVASSHK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34844 (Experiment 1) 34844 61.34 779.887573 2+ 2+ 1557.7592448054806 0 0.8643951431358696 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 7: 0.0) Phosphorylation of Y (4: 1.4539579967689822) 0 Y4-{Y4 Y7} 1 100.0 Confident
|
|
|
3160 3159 P41250 ELSEALTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19888 (Experiment 1) 19888 43.406 459.748535 2+ 2+ 917.4818104948902 0 0.7684331488667556 99.45652173913044 Confident
|
|
|
3161 3160 Q86VP6 VIRPLDQPSSFDATPYIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37806 (Experiment 1) 37806 64.898 683.033691 3+ 3+ 2046.0785911723704 0 0.3183968863357332 100.0 Confident
|
|
|
3162 3161 P67936 KIQALQQQADEAEDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17136 (Experiment 1) 17136 39.775 581.629761 3+ 3+ 1741.8594902744105 0 4.5638205095534525 100.0 Confident
|
|
|
3163 3162 P62273 GHQQLYWSHPR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18708 (Experiment 1) 18708 41.931 496.889282 3+ 3+ 1487.6459463887402 0 0.047100249272079155 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3164 3163 P08238, Q58FF7 DNSTMGYMMAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29977 (Experiment 1) 29977 55.703 624.754333 2+ 2+ 1247.4984658121502 0 -3.4835537598555786 100.0 Confident
|
|
|
3165 3164 Q06830 DISLSDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26296 (Experiment 1) 26296 51.415 510.718048 2+ 2+ 1019.4212575614604 0 0.27951332114050303 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 97.09208400646203) Y7 1 0 99.73614775725594 Confident
|
|
|
3166 3165 P63104 KGIVDQSQQAYQEAFEISKK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29370 (Experiment 1) 29370 55.001 793.052673 3+ 3+ 2376.1362558786604 0 -0.027858214585486003 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.03069466882067) Y11 1 0 99.27007299270073 Confident
|
|
|
3167 3166 P62269 VITIMQNPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26255 (Experiment 1) 26255 51.368 536.30304 2+ 2+ 1070.59064975122 0 0.8179292376916938 99.73614775725594 Confident
|
|
|
3168 3167 Q10570 VYAVATSTNTPCAR Phosphorylation of Y(2) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17992 (Experiment 1) 17992 40.944 795.853455 2+ 2+ 1589.6909075454803 0 0.910671560578584 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3169 3168 O60341 STSQTFIYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23269 (Experiment 1) 23269 47.771 577.76062 2+ 2+ 1153.5056558917604 0 0.8923899449057638 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 75.2827140549273) Y8 1 0 92.50645994832041 Confident
|
|
|
3170 3169 A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536 IIPGFMCQGGDFTR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42469 (Experiment 1) 42469 71.443 533.587036 3+ 3+ 1597.73811891389 0 0.7244594514113429 100.0 Confident
|
|
|
3171 3170 P49736 QLVAEQVTYQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24626 (Experiment 1) 24626 49.473 707.839233 2+ 2+ 1413.6653444206404 0 -1.0110719712440916 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3172 3171 P11216 HLEIIYAINQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41684 (Experiment 1) 41684 70.197 483.913422 3+ 3+ 1448.7177143466702 0 0.49750859028148975 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3173 3172 Q02790 KLYANMFER Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30724 (Experiment 1) 30724 56.564 626.284729 2+ 2+ 1250.5518948915303 0 2.4032057147243417 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.95287958115183) Y3 1 0 99.45799457994579 Confident
|
|
|
3174 3173 Q96PK6 RLPDAHSDYAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10526 (Experiment 1) 10526 29.644 434.218903 3+ 3+ 1299.6319969692302 0 2.2128905435885464 100.0 Confident
|
|
|
3175 3174 P27797 QIDNPDYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11138 (Experiment 1) 11138 30.764 536.721497 2+ 2+ 1071.4274055710603 0 0.9646495624538114 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73890339425587 Confident
|
|
|
3176 3175 P04406 VPTANVSVVDLTCR Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36424 (Experiment 1) 36424 63.246 510.936829 3+ 3+ 1529.7871772812903 0 0.9657552032319764 99.24812030075188 Confident
|
|
|
3177 3176 P40227 EMDRETLIDVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29908 (Experiment 1) 29908 55.622 483.244965 3+ 3+ 1446.7136779878604 0 -0.4224138080634427 100.0 Confident
|
|
|
3178 3177 P07910 GFAFVQYVNER Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44001 (Experiment 1) 44001 74.135 705.314575 2+ 2+ 1408.6176659522303 0 -2.175539317287096 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.03069466882067) Y7 1 0 99.7289972899729 Confident
|
|
|
3179 3178 Q86UX7 VVLAGGVAPALFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44347 (Experiment 1) 44347 75.013 635.386353 2+ 2+ 1268.7604919576402 0 -1.8405234457088246 100.0 Confident
|
|
|
3180 3179 P30050 IGPLGLSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30463 (Experiment 1) 30463 56.263 441.276154 2+ 2+ 880.5382031722002 0 -0.5077382863905501 100.0 Confident
|
|
|
3181 3180 P84095 EVFAEAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23222 (Experiment 1) 23222 47.709 460.746246 2+ 2+ 919.4763311916302 0 1.7448623460088033 99.45799457994579 Confident
|
|
|
3182 3181 P61158 NIVLSGGSTMFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38744 (Experiment 1) 38744 66.048 641.335938 2+ 2+ 1280.6547065597601 0 2.0398918867489204 92.7807486631016 Confident
|
|
|
3183 3182 P0DMV8, P11021, P11142, P17066, P34931, P48741, P54652 VEIIANDQGNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17752 (Experiment 1) 17752 40.619 614.817261 2+ 2+ 1227.6207635791902 0 -0.6461369510452905 100.0 Confident
|
|
|
3184 3183 Q96I51 KVVENEIYSESHR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13962 (Experiment 1) 13962 35.218 557.257324 3+ 3+ 1668.7508649497504 0 -0.4320863647270654 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3185 3184 P11021 TKPYIQVDIGGGQTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25923 (Experiment 1) 25923 50.983 535.626953 3+ 3+ 1603.85697109327 0 1.281058841144378 97.76119402985076 Confident
|
|
|
3186 3185 P25685 GKDYYQTLGLAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27963 (Experiment 1) 27963 53.359 732.847168 2+ 2+ 1463.6809944847803 0 -0.8265143511851014 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 0.0) 0 Y4-{Y4 Y5} 1 100.0 Confident
|
|
|
3187 3186 P10809 GYISPYFINTSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39816 (Experiment 1) 39816 67.479 695.355347 2+ 2+ 1388.6976169175603 0 -1.061219723455453 100.0 Confident
|
|
|
3188 3187 P36578 IEEVPELPLVVEDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45553 (Experiment 1) 45553 77.783 804.940125 2+ 2+ 1607.8658044414703 0 -0.06669756175732991 98.6449864498645 Confident
|
|
|
3189 3188 P06748 ADKDYHFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7820 (Experiment 1) 7820 24.1 512.25 2+ 2+ 1022.4821448480604 0 3.223259111317044 99.73190348525469 Confident
|
|
|
3190 3189 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30948 (Experiment 1) 30948 56.825 528.262573 2+ 2+ 1054.5100129962104 0 0.5490361360970805 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 95.81151832460732) Y7 1 0 95.13513513513514 Confident
|
|
|
3191 3190 Q92945 IGGGIDVPVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32768 (Experiment 1) 32768 58.935 540.314087 2+ 2+ 1078.6134933707801 0 0.11816794511506629 100.0 Confident
|
|
|
3192 3191 Q9GZR7 TSEIYVHR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12997 (Experiment 1) 12997 33.726 542.745056 2+ 2+ 1083.4750244698203 0 0.49249349480832566 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.60383944153578) Y5 1 0 99.45799457994579 Confident
|
|
|
3193 3192 P27635, Q96L21 MLSCAGADR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11393 (Experiment 1) 11393 31.158 490.717957 2+ 2+ 979.42153582079 0 -0.17805990215341602 100.0 Confident
|
|
|
3194 3193 P08238, Q58FF8 SIYYITGESK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30985 (Experiment 1) 30985 56.867 620.778809 2+ 2+ 1239.5424353233002 0 0.5072204350361477 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.17452006980802792) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
3195 3194 P33316 LSEHATAPTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7154 (Experiment 1) 7154 22.704 541.782349 2+ 2+ 1081.5516213902101 0 -1.362467627128385 92.63157894736842 Confident
|
|
|
3196 3195 P29401 TSRPENAIIYNNNEDFQVGQAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32041 (Experiment 1) 32041 58.104 863.397095 3+ 3+ 2587.17040954125 0 -0.3682899175561392 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3197 3196 P00390 LNAIYQNNLTK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25189 (Experiment 1) 25189 50.129 686.337585 2+ 2+ 1370.6595307642103 0 0.7913766118303291 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
3198 3197 P40429, Q6NVV1 MVVPAALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27841 (Experiment 1) 27841 53.22 414.753754 2+ 2+ 827.4938958320702 0 -1.1341243063331499 100.0 Confident
|
|
|
3199 3198 Q02878 AVDSQILPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23122 (Experiment 1) 23122 47.592 485.780884 2+ 2+ 969.5494961318902 0 -2.3478282428417043 99.45799457994579 Confident
|
|
|
3200 3199 Q96ST3 FQGQPDIYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22019 (Experiment 1) 22019 46.256 588.261719 2+ 2+ 1174.5059902449302 0 2.460493751990676 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 96.50959860383944) Y8 1 0 96.22641509433963 Confident
|
|
|
3201 3200 P27348, P31946, P63104 EMQPTHPIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9722 (Experiment 1) 9722 28.078 554.784973 2+ 2+ 1107.54951321523 0 5.2992443836973715 98.92761394101876 Doubtful
|
|
|
3202 3201 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21715 (Experiment 1) 21715 45.833 449.20755 3+ 3+ 1344.6002845525904 0 0.3977724675509548 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 7.577302748266) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3203 3202 P63104 VVSSIEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9362 (Experiment 1) 9362 27.408 445.253387 2+ 2+ 888.4916469026002 0 0.6447611211632298 99.7289972899729 Confident
|
|
|
3204 3203 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16490 (Experiment 1) 16490 38.946 514.76355 2+ 2+ 1027.5120650773501 0 0.4681656766297929 100.0 Confident
|
|
|
3205 3204 O15511 ALAAGGVGSIVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28161 (Experiment 1) 28161 53.596 535.818604 2+ 2+ 1069.6243924076502 0 -1.621200201658805 100.0 Confident
|
|
|
3206 3205 O94905 VAQVAEITYGQK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23436 (Experiment 1) 23436 47.98 693.837952 2+ 2+ 1385.6591964110405 0 1.5527103083896205 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3207 3206 Q7L5N7 AVQPVLVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20645 (Experiment 1) 20645 44.295 484.799072 2+ 2+ 967.5814649665101 0 2.1927687684018284 100.0 Confident
|
|
|
3208 3207 P62826 VCENIPIVLCGNK Carbamidomethylation of C(2, 10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37066 (Experiment 1) 37066 64.009 758.38678 2+ 2+ 1514.7585200053002 0 0.3211166419441482 99.74424552429667 Confident
|
|
|
3209 3208 O75083 AHDGGIYAISWSPDSTHLLSASGDK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42206 (Experiment 1) 42206 71.047 889.070435 3+ 3+ 2664.1857252522204 0 1.4060950512563803 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3210 3209 Q01469 FEETTADGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10269 (Experiment 1) 10269 29.141 513.230896 2+ 2+ 1024.4461532621601 0 1.0578137177942084 94.32432432432432 Confident
|
|
|
3211 3210 P06744 VFEGNRPTNSIVFTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26893 (Experiment 1) 26893 52.101 570.305725 3+ 3+ 1707.8944192311503 0 0.5414457982369396 100.0 Confident
|
|
|
3212 3211 O75964 TPALVNAAVTYSKPR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28785 (Experiment 1) 28785 54.332 556.624084 3+ 3+ 1666.8443714117707 0 3.6237560772849315 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3213 3212 P0DMV8, P11142, P17066, P34931, P48741, P54652 TTPSYVAFTDTER Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30946 (Experiment 1) 30946 56.822 784.336304 2+ 2+ 1566.6603186098505 0 -1.4429653433079364 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3214 3213 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 DLTDYLMK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46330 (Experiment 1) 46330 79.312 539.730408 2+ 2+ 1077.4453641343202 0 0.8327609403742857 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.73045822102425 Confident
|
|
|
3215 3214 Q9NX40 GILSSHPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9360 (Experiment 1) 9360 27.405 419.742493 2+ 2+ 837.4708518883701 0 -0.49890324667662983 96.2059620596206 Confident
|
|
|
3216 3215 P22695 YEDFSNLGTTHLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37875 (Experiment 1) 37875 64.979 555.946228 3+ 3+ 1664.8158345572804 0 0.6115956641679084 100.0 Confident
|
|
|
3217 3216 P78527 LLALNSLYSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42204 (Experiment 1) 42204 71.044 609.85791 2+ 2+ 1217.7019740220103 0 -0.5796065060345678 100.0 Confident
|
|
|
3218 3217 GSTP1_HUMAN, P09211 ALPGQLKPFETLLSQNQGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44537 (Experiment 1) 44537 75.504 709.392273 3+ 3+ 2125.15315309496 0 0.8629481217705463 100.0 Confident
|
|
|
3219 3218 ALDOA_RABIT, P04075 ADDGRPFPQVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26736 (Experiment 1) 26736 51.918 448.241791 3+ 3+ 1341.7040992803304 0 -0.41322975530980505 100.0 Confident
|
|
|
3220 3219 Q8WXF1 YGEPSEVFINR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32477 (Experiment 1) 32477 58.603 655.822754 2+ 2+ 1309.6302656337302 0 0.5256244952340963 100.0 Confident
|
|
|
3221 3220 O14979 DLTEYLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39288 (Experiment 1) 39288 66.747 498.752808 2+ 2+ 995.4923751785902 0 -1.3153915798921219 99.72972972972973 Confident
|
|
|
3222 3221 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 LLLPGELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37755 (Experiment 1) 37755 64.838 477.304932 2+ 2+ 952.5957180483204 0 -0.4263330875681895 99.7289972899729 Confident
|
|
|
3223 3222 Q9BZZ5 SLQTVSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9840 (Experiment 1) 9840 28.269 424.235291 2+ 2+ 846.45593010022 0 0.1166406587699839 99.7289972899729 Confident
|
|
|
3224 3223 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44260 (Experiment 1) 44260 74.745 624.291748 3+ 3+ 1869.85097291384 0 1.3037114538417127 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
3225 3224 ALDOA_RABIT, P04075 GILAADESTGSIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26031 (Experiment 1) 26031 51.108 666.854126 2+ 2+ 1331.6932598131104 0 0.3293474486050809 100.0 Confident
|
|
|
3226 3225 Q8IZQ5 NAAALSQALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23558 (Experiment 1) 23558 48.138 507.788483 2+ 2+ 1013.5617921510902 0 0.611392032540963 99.48717948717949 Confident
|
|
|
3227 3226 P12268 LVGIISSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25998 (Experiment 1) 25998 51.068 422.765503 2+ 2+ 843.5178020807903 0 -1.5954616120024068 99.46666666666667 Confident
|
|
|
3228 3227 P07900, Q58FG0 HIYYITGETK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22278 (Experiment 1) 22278 46.58 652.801758 2+ 2+ 1303.5849688416204 0 3.0593031697477344 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y4} 1 99.45652173913044 Confident
|
|
|
3229 3228 P04075 PYQYPALTPEQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28781 (Experiment 1) 28781 54.326 717.866272 2+ 2+ 1433.7190806381304 0 -0.7588954727685193 99.74811083123426 Confident
|
|
|
3230 3229 Q96S55 SIEVYSAYNNVK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30196 (Experiment 1) 30196 55.959 733.83374 2+ 2+ 1465.6490256501602 0 2.6582496647526557 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 11.577561945624158) Phosphorylation of Y (5: 99.82547993019197) 0 Y5-{Y5 Y8} 1 99.72826086956522 Confident
|
|
|
3231 3230 P11021 KKELEEIVQPIISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30518 (Experiment 1) 30518 56.327 551.998413 3+ 3+ 1652.9712725695204 0 1.290482455028896 96.35036496350365 Confident
|
|
|
3232 3231 P0DMV8, P34931 NALESYAFNMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39592 (Experiment 1) 39592 67.169 644.306335 2+ 2+ 1286.5965229773003 0 1.2370598897714264 100.0 Confident
|
|
|
3233 3232 P19338 ALELTGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32165 (Experiment 1) 32165 58.243 422.760162 2+ 2+ 843.5065686907501 0 -0.9433523937595516 99.72972972972973 Confident
|
|
|
3234 3233 HBA_HUMAN, P02008, P69905 LRVDPVNFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25996 (Experiment 1) 25996 51.066 544.317688 2+ 2+ 1086.6185787512202 0 2.0615899794894874 95.67567567567568 Confident
|
|
|
3235 3234 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1 NMMAACDPR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15766 (Experiment 1) 15766 38.001 533.218018 2+ 2+ 1064.4201559218 0 1.2444686626687462 100.0 Confident
|
|
|
3236 3235 P18077 DETEFYLGKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27845 (Experiment 1) 27845 53.224 419.874878 3+ 3+ 1256.6037165327202 0 -0.7239716271956694 99.42857142857143 Confident
|
|
|
3237 3236 Q9UHX1 GYGFIEYEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34516 (Experiment 1) 34516 60.962 553.264526 2+ 2+ 1104.5127762700004 0 1.5569397430323708 99.72826086956522 Confident
|
|
|
3238 3237 Q16658 KVTGTLDANR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7828 (Experiment 1) 7828 24.12 537.799255 2+ 2+ 1073.5829215184904 0 0.9627652631382592 95.22546419098144 Confident
|
|
|
3239 3238 P07900, P08238, Q14568, Q58FF8 ADLINNLGTIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39608 (Experiment 1) 39608 67.2 621.856567 2+ 2+ 1241.6979512707305 0 0.5063836242540678 100.0 Confident
|
|
|
3240 3239 Q9BUJ2 NYILDQTNVYGSAQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33398 (Experiment 1) 33398 59.653 911.414185 2+ 2+ 1820.8094424550304 0 2.3999087989023273 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 39.194839587790256) Phosphorylation of Y (10: 100.0) 0 Y10-{Y2 Y10} 1 100.0 Confident
|
|
|
3241 3240 O15143 ASSEGGTAAGAGLDSLHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18133 (Experiment 1) 18133 41.178 543.599304 3+ 3+ 1627.7801773245503 0 -2.5108658007193556 99.28057553956835 Confident
|
|
|
3242 3241 Q15393 LTISSPLEAHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26589 (Experiment 1) 26589 51.751 399.227295 3+ 3+ 1194.6608374860205 0 -0.652832739456334 99.28057553956835 Confident
|
|
|
3243 3242 P62805 TVTAMDVVYALKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42928 (Experiment 1) 42928 72.318 489.606354 3+ 3+ 1465.7962854130105 0 0.6448630663618967 100.0 Confident
|
|
|
3244 3243 P45880 LTFDTTFSPNTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37549 (Experiment 1) 37549 64.591 714.853943 2+ 2+ 1427.6932598131104 0 0.05123652866289748 100.0 Confident
|
|
|
3245 3244 Q86UE4 KREEAAAVPAAAPDDLALLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33239 (Experiment 1) 33239 59.469 513.039429 4+ 4+ 2048.1266039939505 0 0.9775763075357908 100.0 Doubtful
|
|
|
3246 3245 P39687 ELVLDNSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20372 (Experiment 1) 20372 43.978 473.255432 2+ 2+ 944.4927095317603 0 3.805078691511892 99.7340425531915 Confident
|
|
|
3247 3246 P16885 MYVDPSEINPSMPQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37751 (Experiment 1) 37751 64.834 922.387207 2+ 2+ 1842.7681718900103 0 -4.505041988220457 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Doubtful
|
|
|
3248 3247 P49411 LLDAVDTYIPVPAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44796 (Experiment 1) 44796 76.106 771.930115 2+ 2+ 1541.8453437804103 0 0.215878374885118 100.0 Confident
|
|
|
3249 3248 P35613 FFVSSSQGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20979 (Experiment 1) 20979 44.696 507.754211 2+ 2+ 1013.4930438849301 0 0.8125802786317027 96.7654986522911 Confident
|
|
|
3250 3249 Q10713 DTTMYAVSADSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20521 (Experiment 1) 20521 44.153 684.773743 2+ 2+ 1367.5316129394205 0 0.9639156300108629 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3251 3250 P21281 KDHADVSNQLYACYAIGK Phosphorylation of Y(11) Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27694 (Experiment 1) 27694 53.049 711.654602 3+ 3+ 2131.93980500158 0 1.0171601908097334 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 13.739487640234529) Phosphorylation of Y (11: 36.12565445026178) 0 Y11-{Y11 Y14} 1 100.0 Confident
|
|
|
3252 3251 P06733 IGAEVYHNLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18135 (Experiment 1) 18135 41.18 408.531708 3+ 3+ 1222.5747385110903 0 -1.1781295446276745 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.38219895287958) Y6 1 0 92.14285714285715 Doubtful
|
|
|
3253 3252 P26641 EYFSWEGAFQHVGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46124 (Experiment 1) 46124 78.962 588.91864 3+ 3+ 1763.7344866096205 0 -0.2241452615423477 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
3254 3253 Q9UFN0 LVGVFHTEYGALNR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34983 (Experiment 1) 34983 61.505 552.603638 3+ 3+ 1654.7868565356503 0 1.3439813247399972 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 91.59935379644588) Y9 1 0 97.79411764705883 Confident
|
|
|
3255 3254 Q8TA94 KRYECKECGKTFSSRR Phosphorylation of Y(3) Carbamidomethylation of C(5, 8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38968 (Experiment 1) 38968 66.317 1087.002075 2+ 2+ 2170.9765419468104 1 4.46402278797709 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.38219895287958) Y3 1 0 97.289972899729 Doubtful
|
|
|
3256 3255 P05141 DFLAGGVAAAISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43552 (Experiment 1) 43552 73.343 610.337158 2+ 2+ 1218.6608374860205 0 -0.8801845707243323 100.0 Confident
|
|
|
3257 3256 P00338, P07195, P07864, Q6ZMR3 VIGSGCNLDSAR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17407 (Experiment 1) 17407 40.163 624.803711 2+ 2+ 1247.5928345791901 0 0.027598416992770738 100.0 Confident
|
|
|
3258 3257 Q8NC51 EETQPPVALKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13034 (Experiment 1) 13034 33.777 413.902649 3+ 3+ 1238.6870522338604 0 -0.7527000170334832 100.0 Confident
|
|
|
3259 3258 O14744 YSQYQQAIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21548 (Experiment 1) 21548 45.552 686.302185 2+ 2+ 1370.5907824980504 0 -0.7033570755096783 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 22.008726686274073) Phosphorylation of Y (9: 98.95287958115183) 0 Y9-{Y1 Y4 Y9} 1 98.91304347826086 Confident
|
|
|
3260 3259 P49411 AEAGDNLGALVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31311 (Experiment 1) 31311 57.251 593.316895 2+ 2+ 1184.6149499227602 0 3.6128746213237606 100.0 Confident
|
|
|
3261 3260 P07900, Q58FG0 HIYYITGETK Phosphorylation of Y(3, 4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21123 (Experiment 1) 21123 44.886 692.783081 2+ 2+ 1383.5512993623704 0 0.22352167889939747 Phosphorylation of Y (3: Very Confident, 4: Very Confident) Phosphorylation of Y (3: 99.83844911147011, 4: 99.83844911147011) Y3, Y4 2 0 100.0 Confident
|
|
|
3262 3261 Q9Y624 KVIYSQPSAR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9129 (Experiment 1) 9129 26.904 614.808472 2+ 2+ 1227.6012876121004 0 0.897397576724566 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 97.73123909249564) Y4 1 0 99.72826086956522 Confident
|
|
|
3263 3262 P55854, P61956, Q6EEV6 VAGQDGSVVQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23927 (Experiment 1) 23927 48.623 617.825256 2+ 2+ 1233.6353510141705 0 0.4920910067950028 100.0 Confident
|
|
|
3264 3263 Q16891 VVSQYHELVVQAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23176 (Experiment 1) 23176 47.655 804.399658 2+ 2+ 1606.7868565356505 0 -1.30126021907947 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.72826086956522 Confident
|
|
|
3265 3264 P83731 VELCSFSGYK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32476 (Experiment 1) 32476 58.602 595.281982 2+ 2+ 1188.5485101557201 0 0.7567097313900182 100.0 Confident
|
|
|
3266 3265 P26639 IYGISFPDPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42494 (Experiment 1) 42494 71.483 568.804688 2+ 2+ 1135.59136094387 0 3.0433408121793466 96.22641509433963 Confident
|
|
|
3267 3266 Q9NYU1, Q9NYU2 NYLSPTFK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30356 (Experiment 1) 30356 56.142 525.238464 2+ 2+ 1048.4630628037903 0 -0.6546902133910405 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47643979057592) Y2 1 0 99.75247524752476 Confident
|
|
|
3268 3267 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32557 (Experiment 1) 32557 58.695 630.797241 2+ 2+ 1259.5798834611805 0 0.03614885573903541 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3269 3268 P31948 TLLSDPTYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29171 (Experiment 1) 29171 54.773 573.264526 2+ 2+ 1144.5165549286303 0 -1.7931151106495922 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 94.4153577661431) Y8 1 0 93.6 Confident
|
|
|
3270 3269 Q9UL46 DEAAYGELR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18910 (Experiment 1) 18910 42.182 552.223999 2+ 2+ 1102.43321922749 0 0.20448127249302475 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.86914378029078) Y5 1 0 99.72826086956522 Confident
|
|
|
3271 3270 P52272 GNFGGSFAGSFGGAGGHAPGVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33064 (Experiment 1) 33064 59.268 678.98877 3+ 3+ 2033.9456199402102 0 -0.55933178821597 100.0 Confident
|
|
|
3272 3271 Q96PK6 LSESQLSFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29501 (Experiment 1) 29501 55.151 533.779602 2+ 2+ 1065.5454733806102 0 -0.7702744709562164 100.0 Confident
|
|
|
3273 3272 P00519 QFDSSTFGGHKSEKPALPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19128 (Experiment 1) 19128 42.457 523.017029 4+ 4+ 2088.0388516187104 0 0.07576906890833976 100.0 Doubtful
|
|
|
3274 3273 P13796 EGESLEDLMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40002 (Experiment 1) 40002 67.739 575.768433 2+ 2+ 1149.5223549775303 0 -0.036395841289881666 100.0 Confident
|
|
|
3275 3274 O94903 DLPAIQPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25872 (Experiment 1) 25872 50.925 455.26123 2+ 2+ 908.5079656730802 0 -0.06436601281533902 93.76693766937669 Confident
|
|
|
3276 3275 P35579 KMEDSVGCLETAEEVKR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22810 (Experiment 1) 22810 47.22 660.982605 3+ 3+ 1979.9292267103506 0 -1.6344885449190156 96.75324675324676 Confident
|
|
|
3277 3276 P14866 IEYAKPTR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7930 (Experiment 1) 7930 24.299 529.257813 2+ 2+ 1056.5005109416702 0 0.531050265556102 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3278 3277 Q8TDN6 IFQGSFGGPTLYENPHYQSPNMHR Phosphorylation of Y(17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35430 (Experiment 1) 35430 62.019 715.069763 4+ 4+ 2856.2479486693005 0 0.6983461437393608 Phosphorylation of Y (17: Random) Phosphorylation of Y (12: 0.0, 17: 0.0) Phosphorylation of Y (17: 0.012969181278141003) 0 Y17-{Y12 Y17} 1 100.0 Doubtful
|
|
|
3279 3278 P26447 ELPSFLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38769 (Experiment 1) 38769 66.08 445.752258 2+ 2+ 889.4909186266102 0 -1.071850105965497 98.92761394101876 Confident
|
|
|
3280 3279 Q14240 DQIYEIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43092 (Experiment 1) 43092 72.587 632.28717 2+ 2+ 1262.5584197406104 0 1.081254933430066 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
3281 3280 P68104, Q05639, Q5VTE0 LPLQDVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30437 (Experiment 1) 30437 56.233 488.279297 2+ 2+ 974.5436824754604 0 0.36719870116347647 100.0 Confident
|
|
|
3282 3281 P09651, P51991, Q32P51 WGTLTDCVVMR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39761 (Experiment 1) 39761 67.411 669.320862 2+ 2+ 1336.6267775597603 0 0.29395970875355515 99.72826086956522 Confident
|
|
|
3283 3282 P22234 VVVLMGSTSDLGHCEK Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28583 (Experiment 1) 28583 54.09 577.952637 3+ 3+ 1730.8331414975403 0 1.6957023931681612 100.0 Confident
|
|
|
3284 3283 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40420 (Experiment 1) 40420 68.356 895.950073 2+ 2+ 1789.88464239309 0 0.5305394903474498 92.40837696335078 Confident
|
|
|
3285 3284 P08238, Q58FF7 IDIIPNPQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33145 (Experiment 1) 33145 59.363 597.827148 2+ 2+ 1193.6404363946103 0 -0.5798731580057984 100.0 Confident
|
|
|
3286 3285 P55060 VIVPNMEFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38334 (Experiment 1) 38334 65.552 552.797913 2+ 2+ 1103.5797507143502 0 1.3769535720365451 100.0 Confident
|
|
|
3287 3286 Q15233 VELDNMPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32860 (Experiment 1) 32860 59.039 543.783752 2+ 2+ 1085.55392988933 0 -0.9000104080787374 99.45799457994579 Confident
|
|
|
3288 3287 P49458 VTDDLVCLVYK Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43503 (Experiment 1) 43503 73.265 662.843689 2+ 2+ 1323.6744389448304 0 -1.2173884405398079 99.18478260869566 Confident
|
|
|
3289 3288 P62995 RPHTPTPGIYMGRPTYGSSR Phosphorylation of Y(10, 16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20434 (Experiment 1) 20434 44.054 797.688843 3+ 3+ 2390.03921538055 0 2.291717140192494 Phosphorylation of Y (10: Very Confident, 16: Very Confident) Phosphorylation of Y (10: 100.0, 16: 100.0) Y10, Y16 2 0 100.0 Confident
|
|
|
3290 3289 P19338 SISLYYTGEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31261 (Experiment 1) 31261 57.189 580.7948 2+ 2+ 1159.5761048025502 0 -0.9105928730094743 100.0 Confident
|
|
|
3291 3290 O43776 YGTCPHGGYGLGLER Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24771 (Experiment 1) 24771 49.642 546.256531 3+ 3+ 1635.74637509847 0 0.8472833986189915 99.28057553956835 Confident
|
|
|
3292 3291 Q9UGN4 EELHYASVVFDSNTNR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35875 (Experiment 1) 35875 62.555 980.924377 2+ 2+ 1959.8363854788604 0 -1.1134446769981647 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.30191972076788) Y5 1 0 99.7289972899729 Confident
|
|
|
3293 3292 P46781 KQVVNIPSFIVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39289 (Experiment 1) 39289 66.749 467.285645 3+ 3+ 1398.8347195270603 0 0.27540086324172314 98.49624060150376 Confident
|
|
|
3294 3293 P41240, P42685 WTAPEALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29185 (Experiment 1) 29185 54.788 472.253998 2+ 2+ 942.4923156089401 0 1.1936995628005425 93.21148825065274 Confident
|
|
|
3295 3294 Q13310 FSPAGPVLSIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37813 (Experiment 1) 37813 64.908 572.331787 2+ 2+ 1142.6447934990601 0 3.6932973367258852 99.46949602122017 Confident
|
|
|
3296 3295 GSTP1_HUMAN, P09211 PPYTVVYFPVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46385 (Experiment 1) 46385 79.393 709.350342 2+ 2+ 1416.6842889600703 0 1.2984477403562993 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 30.544134551967666) Phosphorylation of Y (7: 100.0) 0 Y7-{Y3 Y7} 1 100.0 Confident
|
|
|
3297 3296 Q96IX5 AGPESDAQYQFTGIKK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25615 (Experiment 1) 25615 50.629 607.280334 3+ 3+ 1818.8189445095704 0 0.1251975457812369 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3298 3297 Q15126 EAYGAVTQTVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17672 (Experiment 1) 17672 40.523 637.791748 3+ 2+ 1273.5703814066403 0 -1.1275927033657056 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.86914378029078) Y3 1 0 98.93048128342245 Confident
|
|
|
3299 3298 P46013 NIYAFMGTPVQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40866 (Experiment 1) 40866 68.98 724.835083 2+ 2+ 1447.6570882360604 0 -1.0175888405072893 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3300 3299 P22626 NMGGPYGGGNYGPGGSGGSGGYGGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22575 (Experiment 1) 22575 46.942 757.295959 3+ 3+ 2268.8644082151895 0 0.7215961553565376 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 2.345442983988523) Phosphorylation of Y (11: 0.0) 0 Y6-{Y6 Y11 Y22} 1 97.79411764705883 Confident
|
|
|
3301 3300 P51659 IIMTSSASGIYGNFGQANYSAAK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40340 (Experiment 1) 40340 68.249 811.039124 3+ 3+ 2430.092676814521 0 1.1778258012379161 Phosphorylation of Y (11: Random) Phosphorylation of Y (11: 0.0, 19: 0.0) Phosphorylation of Y (11: 77.55464430857101) 0 Y11-{Y11 Y19} 1 100.0 Confident
|
|
|
3302 3301 P55072 KGDIFLVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26972 (Experiment 1) 26972 52.194 474.287537 2+ 2+ 946.5600012459402 0 0.548001665875594 99.73333333333333 Confident
|
|
|
3303 3302 P22234 TKEVYELLDSPGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31941 (Experiment 1) 31941 57.99 779.87561 2+ 2+ 1557.73275527412 0 2.5079653834080586 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.72826086956522 Confident
|
|
|
3304 3303 P27797 KIKDPDASKPEDWDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14592 (Experiment 1) 14592 36.179 482.988434 4+ 4+ 1927.9275698342303 0 -1.5216187378457586 100.0 Doubtful
|
|
|
3305 3304 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26622 (Experiment 1) 26622 51.788 523.251343 2+ 2+ 1044.4892775516303 0 -1.0936273915415506 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.65095986038395) Y7 1 0 99.73333333333333 Confident
|
|
|
3306 3305 P39019 IAGQVAAANK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7863 (Experiment 1) 7863 24.171 471.772339 2+ 2+ 941.5294293936502 0 0.7372976129642235 100.0 Confident
|
|
|
3307 3306 Q9BXS5, Q9Y6Q5 SGYQALPWVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43786 (Experiment 1) 43786 73.744 628.794556 2+ 2+ 1255.5750728642602 0 -0.40855766768686735 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3308 3307 B2RXH8, B7ZW38, O60812, P07910 VDSLLENLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40785 (Experiment 1) 40785 68.873 580.314636 2+ 2+ 1158.6132185872605 0 1.2928168290571307 99.1891891891892 Confident
|
|
|
3309 3308 P26641 VLSAPPHFHFGQTNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26319 (Experiment 1) 26319 51.442 427.722931 4+ 4+ 1706.8641221623802 0 -0.879090292475121 100.0 Doubtful
|
|
|
3310 3309 P0DMV8 FGDPVVQSDMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26210 (Experiment 1) 26210 51.316 611.79248 2+ 2+ 1221.5699738762903 0 0.3540336412956268 100.0 Confident
|
|
|
3311 3310 P29401 SVPTSTVFYPSDGVATEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34843 (Experiment 1) 34843 61.339 942.96698 2+ 2+ 1883.9152738150308 0 2.19162520604688 99.45799457994579 Confident
|
|
|
3312 3311 Q92540 AVPALGKSPPHHSGFQQYQQADASK Phosphorylation of Y(18) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20103 (Experiment 1) 20103 43.674 683.077271 4+ 4+ 2728.2758776693004 0 1.5007341698785936 Phosphorylation of Y (18: Very Confident) Phosphorylation of Y (18: 100.0) Phosphorylation of Y (18: 99.82547993019197) Y18 1 0 100.0 Doubtful
|
|
|
3313 3312 Q04446 KGNNESYHYAR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5575 (Experiment 1) 5575 19.226 473.532715 3+ 3+ 1417.5775920454003 0 -0.8985262255689255 Phosphorylation of Y (9: Random) Phosphorylation of Y (7: 0.0, 9: 0.0) Phosphorylation of Y (9: 87.06324216795421) 0 Y9-{Y7 Y9} 1 99.28057553956835 Confident
|
|
|
3314 3313 Q07955 KEDMTYAVRK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13065 (Experiment 1) 13065 33.823 660.802368 2+ 2+ 1319.5944879795004 0 -3.2573272361758083 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 97.90575916230367) Y6 1 0 99.22680412371135 Confident
|
|
|
3315 3314 P14625 GVVDSDDLPLNVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36882 (Experiment 1) 36882 63.788 743.380554 2+ 2+ 1484.7470862911202 0 -0.35730323573625733 96.24664879356568 Confident
|
|
|
3316 3315 P16989, P67809, Q9Y2T7 SVGDGETVEFDVVEGEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38268 (Experiment 1) 38268 65.461 898.418091 2+ 2+ 1794.8159536965807 0 3.1585448790284913 99.7340425531915 Confident
|
|
|
3317 3316 Q8NC51 SKSEEAHAEDSVMDHHFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15546 (Experiment 1) 15546 37.675 528.735718 4+ 4+ 2110.912665129421 0 0.5205832831702668 100.0 Doubtful
|
|
|
3318 3317 P13796, P13797 YAFVNWINK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43867 (Experiment 1) 43867 73.904 577.802612 2+ 2+ 1153.5920296502102 0 -1.1756456348486097 99.73890339425587 Confident
|
|
|
3319 3318 P17174 HIYLLPSGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31617 (Experiment 1) 31617 57.615 568.286804 2+ 2+ 1134.55869452413 0 0.3172186628098521 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 99.1891891891892 Confident
|
|
|
3320 3319 P62158 VFDKDGNGYISAAELR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31342 (Experiment 1) 31342 57.287 612.282959 3+ 3+ 1833.8298435464403 0 -1.5221408006727608 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 97.38219895287958) Y9 1 0 96.99248120300751 Confident
|
|
|
3321 3320 P02786 GFVEPDHYVVVGAQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33505 (Experiment 1) 33505 59.778 584.944397 3+ 3+ 1751.8032348757806 0 4.631073460631622 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3322 3321 Q8WUM4 HCIMQANAEYHQSILAK Phosphorylation of Y(10) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22494 (Experiment 1) 22494 46.847 698.648804 3+ 3+ 2092.9223811156303 0 1.0503542616669168 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.03069466882067) Y10 1 0 100.0 Confident
|
|
|
3323 3322 P23526 VAVVAGYGDVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21488 (Experiment 1) 21488 45.443 607.792969 2+ 2+ 1213.5744041579203 0 -2.4836450898052194 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.86914378029078) Y7 1 0 99.46091644204851 Confident
|
|
|
3324 3323 Q14151, Q15424 ADSLLAVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35546 (Experiment 1) 35546 62.151 458.279419 2+ 2+ 914.5436824754604 0 0.6574496768880596 97.58713136729223 Confident
|
|
|
3325 3324 P50402 DSAYQSITHYRPVSASR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24528 (Experiment 1) 24528 49.361 673.308777 3+ 3+ 2016.9054680981903 0 -0.4784818877010529 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 0.9985174595713977) Phosphorylation of Y (4: 85.77661431064573) 0 Y4-{Y4 Y10} 1 100.0 Confident
|
|
|
3326 3325 P08865 YVDIAIPCNNK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31011 (Experiment 1) 31011 56.898 653.826477 2+ 2+ 1305.6387221424502 0 -0.24553609168580096 99.73333333333333 Confident
|
|
|
3327 3326 O60506 VTEGLTDVILYHQPDDKKK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31511 (Experiment 1) 31511 57.485 570.538391 4+ 4+ 2278.1246285658003 0 -0.07468079203121558 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.47643979057592) Y11 1 0 100.0 Doubtful
|
|
|
3328 3327 Q9UPN3 AENMYAQIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20010 (Experiment 1) 20010 43.559 574.245972 2+ 2+ 1146.4780612449304 0 -0.5835288325997011 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.38219895287958) Y5 1 0 99.45799457994579 Confident
|
|
|
3329 3328 Q8TD57 KTMQIGESLPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38754 (Experiment 1) 38754 66.059 616.33429 2+ 2+ 1230.6642086143002 0 -8.259692826613291 96.4769647696477 Doubtful
|
|
|
3330 3329 A6NHL2, P68363, P68366, Q71U36, Q9BQE3 YMACCLLYR Carbamidomethylation of C(4, 5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36564 (Experiment 1) 36564 63.407 625.279358 2+ 2+ 1248.54535643492 0 -0.9542673927064376 100.0 Confident
|
|
|
3331 3330 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32558 (Experiment 1) 32558 58.698 932.894592 2+ 2+ 1863.7750310922602 0 -0.21440032025638553 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 0.34904013961605584) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
3332 3331 Q15181 GISCMNTTLSESPFK Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39039 (Experiment 1) 39039 66.404 836.388733 2+ 2+ 1670.7643932313804 0 -0.8848539180363733 99.75247524752476 Confident
|
|
|
3333 3332 P46779 NCSSFLIK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28429 (Experiment 1) 28429 53.912 484.748047 2+ 2+ 967.4797023199101 0 1.896603776674565 92.40837696335078 Confident
|
|
|
3334 3333 P07339 VGFAEAAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17267 (Experiment 1) 17267 39.969 410.719391 2+ 2+ 819.4239016959502 0 0.3985331146217005 100.0 Confident
|
|
|
3335 3334 P14314 ESLQQMAEVTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31889 (Experiment 1) 31889 57.931 646.31842 2+ 2+ 1290.6238003543003 0 -1.1706970636698193 100.0 Confident
|
|
|
3336 3335 Q14974 VLANPGNSQVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13301 (Experiment 1) 13301 34.156 613.335815 2+ 2+ 1224.65748344108 0 -0.33128227606723526 99.72972972972973 Confident
|
|
|
3337 3336 P19623 VLIIGGGDGGVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39457 (Experiment 1) 39457 66.987 613.366699 2+ 2+ 1224.71902106848 0 -0.14347215064163615 99.46666666666667 Confident
|
|
|
3338 3337 P07900, P08238, Q58FF7, Q58FG0 EGLELPEDEEEKKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18869 (Experiment 1) 18869 42.132 558.281067 3+ 3+ 1671.8203108010307 0 0.633372249094212 100.0 Confident
|
|
|
3339 3338 Q15393 TVLDPVTGDLSDTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35706 (Experiment 1) 35706 62.341 744.881714 2+ 2+ 1487.7467519379502 0 1.42514671222472 100.0 Confident
|
|
|
3340 3339 P11310 IYQIYEGTSQIQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32389 (Experiment 1) 32389 58.499 560.265686 3+ 3+ 1677.7763514216003 0 -0.6680290646284678 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.94303226579954) Phosphorylation of Y (5: 0.17452006980802792) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
3341 3340 P62424 VAPAPAVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13234 (Experiment 1) 13234 34.054 426.27121 2+ 2+ 850.5276384885003 0 0.2681132711781609 100.0 Confident
|
|
|
3342 3341 Q9NY33 GDYAPILQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27742 (Experiment 1) 27742 53.106 542.757935 2+ 2+ 1083.5001765885002 0 1.0506332568637604 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
3343 3342 P15531 NIIHGSDSVESAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14004 (Experiment 1) 14004 35.293 495.911011 3+ 3+ 1484.7107007824006 0 0.3379755118276643 100.0 Confident
|
|
|
3344 3343 P45880 VNNSSLIGVGYTQTLRPGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33741 (Experiment 1) 33741 60.047 702.05658 3+ 3+ 2102.1484020676903 1 -1.8270759622429968 100.0 Confident
|
|
|
3345 3344 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43772 (Experiment 1) 43772 73.722 586.326355 3+ 3+ 1755.9559568585505 0 0.7269796261685519 100.0 Confident
|
|
|
3346 3345 P39023 AGMTHIVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9944 (Experiment 1) 9944 28.448 442.742065 2+ 2+ 883.4698063425501 0 -0.25892741251307033 98.9556135770235 Confident
|
|
|
3347 3346 P11586 VLLSALER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34342 (Experiment 1) 34342 60.759 450.779297 2+ 2+ 899.5440168286302 0 0.02688427202226053 92.66304347826086 Confident
|
|
|
3348 3347 P14550, Q96JD6 SPAQILLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30752 (Experiment 1) 30752 56.595 449.278839 2+ 2+ 896.5443511818 0 -1.3645353892005883 99.45945945945947 Confident
|
|
|
3349 3348 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20772 (Experiment 1) 20772 44.442 449.208649 3+ 3+ 1344.6002845525904 0 2.844304003153412 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 13.492309544630924) Phosphorylation of Y (4: 62.47818499127399) 0 Y4-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3350 3349 P30086 NRPTSISWDGLDSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30699 (Experiment 1) 30699 56.535 544.936951 3+ 3+ 1631.79034808543 0 -0.8101761683988672 100.0 Confident
|
|
|
3351 3350 P22102 VLAVTAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27157 (Experiment 1) 27157 52.409 421.776428 2+ 2+ 841.5385375253702 0 -0.27794219089728744 99.7340425531915 Confident
|
|
|
3352 3351 P61313 GATYGKPVHHGVNQLK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7272 (Experiment 1) 7272 22.995 447.22522 4+ 4+ 1784.8723174951103 0 -0.3037408050487601 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Doubtful
|
|
|
3353 3352 P62995 AAQDRDQIYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9128 (Experiment 1) 9128 26.902 658.292847 2+ 2+ 1314.5717783889702 0 -0.4840720118896733 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.86914378029078) Y9 1 0 99.7289972899729 Confident
|
|
|
3354 3353 P41212 LQPIYWSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40015 (Experiment 1) 40015 67.757 571.77356 2+ 2+ 1141.5321454231203 0 0.3687153801024402 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 99.7289972899729 Confident
|
|
|
3355 3354 P32322 EGATVYATGTHAQVEDGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15378 (Experiment 1) 15378 37.452 647.950317 3+ 3+ 1940.8265490711506 0 1.3234203048227282 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 99.37888198757764 Confident
|
|
|
3356 3355 ALDOA_RABIT, P04075 QLLLTADDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28584 (Experiment 1) 28584 54.092 522.788452 2+ 2+ 1043.5611234447501 0 1.1741107348467827 99.72826086956522 Confident
|
|
|
3357 3356 P27348, P31946, P31947, P61981, P62258, P63104, Q04917 NLLSVAYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33159 (Experiment 1) 33159 59.379 454.266266 2+ 2+ 906.5174677276202 0 0.5628186395035745 100.0 Confident
|
|
|
3358 3357 P35579 IAEFTTNLTEEEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33519 (Experiment 1) 33519 59.795 827.396729 2+ 2+ 1652.7781116358806 0 0.4794742642784467 94.90616621983914 Confident
|
|
|
3359 3358 Q12906 VLQDMGLPTGAEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32875 (Experiment 1) 32875 59.055 722.363403 2+ 2+ 1442.7187633683002 0 -4.50623090848387 100.0 Doubtful
|
|
|
3360 3359 A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7 SYELPDGQVITIGNER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43609 (Experiment 1) 43609 73.44 896.451416 2+ 2+ 1789.88464239309 1 0.1572831142112595 100.0 Confident
|
|
|
3361 3360 P78527 ILDVMYSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33200 (Experiment 1) 33200 59.425 498.763275 2+ 2+ 995.5110024481903 0 0.9970854184616174 99.49367088607595 Confident
|
|
|
3362 3361 P60900 AINQGGLTSVAVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26056 (Experiment 1) 26056 51.138 643.364929 2+ 2+ 1284.7149983172003 0 0.23839444363497883 94.3089430894309 Confident
|
|
|
3363 3362 P09651 SSGPYGGGGQYFAKPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20548 (Experiment 1) 20548 44.184 814.894531 2+ 2+ 1627.7743040984703 0 0.12576347217620767 100.0 Confident
|
|
|
3364 3363 P42704 EKDIQEESTFSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15705 (Experiment 1) 15705 37.907 519.245972 3+ 3+ 1554.7161800856604 0 -0.060014004724984006 99.37888198757764 Confident
|
|
|
3365 3364 P68104, Q05639, Q5VTE0 EHALLAYTLGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36307 (Experiment 1) 36307 63.106 438.917694 3+ 3+ 1313.7343367794504 0 -2.3422558904013595 100.0 Confident
|
|
|
3366 3365 ALDOA_RABIT, P04075 ALQASALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14331 (Experiment 1) 14331 35.785 401.244873 2+ 2+ 800.4756029156401 0 -0.5107218588296415 99.20424403183023 Confident
|
|
|
3367 3366 P23526 ALDIAENEMPGLMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43437 (Experiment 1) 43437 73.169 780.381653 2+ 2+ 1558.74834924442 0 0.2587336970137477 100.0 Confident
|
|
|
3368 3367 P78527 HSSLITPLQAVAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34000 (Experiment 1) 34000 60.356 507.623444 3+ 3+ 1519.8470751159105 0 0.937364765539112 100.0 Confident
|
|
|
3369 3368 P61088, Q5JXB2 LLAEPVPGIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32112 (Experiment 1) 32112 58.185 518.826477 2+ 2+ 1035.6328318330302 0 5.367173306971273 93.08510638297872 Doubtful
|
|
|
3370 3369 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20932 (Experiment 1) 20932 44.629 759.859863 2+ 2+ 1517.7014551458406 0 2.446457440449893 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.47643979057592) Y11 1 0 99.72972972972973 Confident
|
|
|
3371 3370 P35579 KQELEEICHDLEAR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30592 (Experiment 1) 30592 56.412 590.621094 3+ 3+ 1768.8413976821203 0 0.030994177731724238 100.0 Confident
|
|
|
3372 3371 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17929 (Experiment 1) 17929 40.851 798.83905 2+ 2+ 1595.6617155921804 0 1.1463362332214493 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3373 3372 P23396 ELTAVVQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16078 (Experiment 1) 16078 38.445 444.263855 2+ 2+ 886.5123823471804 0 0.8719141366288796 99.72826086956522 Confident
|
|
|
3374 3373 P13073 VNPIQGLASK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27256 (Experiment 1) 27256 52.524 513.801025 2+ 2+ 1025.5869442697704 0 0.5379484235532065 100.0 Confident
|
|
|
3375 3374 P19338 GLSEDTTEETLKESFDGSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38253 (Experiment 1) 38253 65.443 734.012939 3+ 3+ 2199.0179009602607 0 -0.41477939047217866 100.0 Confident
|
|
|
3376 3375 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35046 (Experiment 1) 35046 61.575 630.797974 2+ 2+ 1259.5798834611805 0 1.1981704671579947 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3377 3376 P37837 TIVMGASFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31024 (Experiment 1) 31024 56.915 491.263062 2+ 2+ 980.5113368013601 0 0.238431392374481 93.45549738219894 Confident
|
|
|
3378 3377 P07437, Q13509, Q13885, Q9BVA1 AILVDLEPGTMDSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44030 (Experiment 1) 44030 74.199 808.423096 2+ 2+ 1614.8287077401003 0 1.8129934711841158 100.0 Confident
|
|
|
3379 3378 P08621 REFEVYGPIKR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22836 (Experiment 1) 22836 47.25 491.91394 3+ 3+ 1472.7177143466702 0 1.5424489392515153 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3380 3379 P38919 EQIYDVYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30867 (Experiment 1) 30867 56.729 583.250671 2+ 2+ 1164.4852548003503 0 1.3152732777397285 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 12.680432057035638) Phosphorylation of Y (4: 46.0047423002762) 0 Y7-{Y4 Y7} 1 100.0 Confident
|
|
|
3381 3380 O00148, Q13838 DFLLKPELLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43933 (Experiment 1) 43933 74.023 622.373901 2+ 2+ 1242.7336085034601 0 -0.28876289622802126 99.7289972899729 Confident
|
|
|
3382 3381 P53041 GNHETDNMNQIYGFEGEVK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34938 (Experiment 1) 34938 61.454 754.642639 3+ 3+ 2260.90962707211 0 -1.5634185992320653 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 97.38219895287958) Y12 1 0 92.14285714285715 Doubtful
|
|
|
3383 3382 Q9Y230 TTEMETIYDLGTK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40446 (Experiment 1) 40446 68.396 791.343201 2+ 2+ 1580.6681064122301 0 2.3647533658455386 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3384 3383 P49327 AQVADVVVSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20604 (Experiment 1) 20604 44.249 522.29657 2+ 2+ 1042.5771078620603 0 1.41605985479001 100.0 Confident
|
|
|
3385 3384 P14866 NPNGPYPYTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27259 (Experiment 1) 27259 52.529 632.321594 2+ 2+ 1262.6295373577404 0 -0.7134745431612431 98.91891891891892 Confident
|
|
|
3386 3385 P25705 VVDALGNAIDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29502 (Experiment 1) 29502 55.152 586.319214 2+ 2+ 1170.6244519773002 0 -0.4919765775497542 100.0 Confident
|
|
|
3387 3386 P18669, Q8N0Y7 SYDVPPPPMEPDHPFYSNISK Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38254 (Experiment 1) 38254 65.445 833.031006 3+ 3+ 2496.0708787407802 0 0.12398851102424215 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 11.910990120317246) Phosphorylation of Y (16: 91.97207678883072) 0 Y16-{Y2 Y16} 1 97.74436090225565 Confident
|
|
|
3388 3387 P00558, P07205 LGDVYVNDAFGTAHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32113 (Experiment 1) 32113 58.186 545.931824 3+ 3+ 1633.7848687821704 1 -8.908211594285019 98.7012987012987 Doubtful
|
|
|
3389 3388 P00519, P42684 LMTGDTYTAHAGAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12478 (Experiment 1) 12478 32.917 758.829468 2+ 2+ 1515.6428947239006 0 0.9806840651939707 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3390 3389 P13010 TLFPLIEAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45005 (Experiment 1) 45005 76.564 516.310852 2+ 2+ 1030.6062827320204 0 0.8409033842378173 100.0 Confident
|
|
|
3391 3390 P49327 QEPLLIGSTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28189 (Experiment 1) 28189 53.633 543.312195 2+ 2+ 1084.61282466444 0 -2.749422778985428 97.8319783197832 Confident
|
|
|
3392 3391 P37108 FQMAYSNLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42811 (Experiment 1) 42811 72.095 621.818604 2+ 2+ 1241.6226781554901 0 -0.018565795224115528 99.22077922077922 Confident
|
|
|
3393 3392 P35232 DLQNVNITLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35797 (Experiment 1) 35797 62.462 593.334717 2+ 2+ 1184.6513354314802 0 2.9878965345754014 100.0 Confident
|
|
|
3394 3393 P62913 VLEQLTGQTPVFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38002 (Experiment 1) 38002 65.138 773.929016 2+ 2+ 1545.8402583999705 0 2.080729007582769 99.7289972899729 Confident
|
|
|
3395 3394 Q07666 KDDEENYLDLFSHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39341 (Experiment 1) 39341 66.825 584.941162 3+ 3+ 1751.8002440627904 0 0.804945865943432 100.0 Confident
|
|
|
3396 3395 P39023 NNASTDYDLSDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17573 (Experiment 1) 17573 40.387 671.792114 2+ 2+ 1341.5684532228101 0 0.9093919467918389 100.0 Confident
|
|
|
3397 3396 P62736, P63267, P68032, P68133 YPIEHGIITNWDDMEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38838 (Experiment 1) 38838 66.161 654.308044 3+ 3+ 1959.90366358551 0 -0.6933456979172203 100.0 Confident
|
|
|
3398 3397 P04083 TPAQFDADELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29000 (Experiment 1) 29000 54.577 631.804688 2+ 2+ 1261.5938801250102 0 0.7462290857858609 100.0 Confident
|
|
|
3399 3398 P05543, P50991 FSNISAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12559 (Experiment 1) 12559 33.038 419.225891 2+ 2+ 836.4392174069203 0 -2.3714372987274643 99.45799457994579 Confident
|
|
|
3400 3399 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29369 (Experiment 1) 29369 55.0 452.230438 3+ 3+ 1353.6693671719202 0 0.08655443787258378 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
3401 3400 Q04446 IYESHVGISSHEGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11775 (Experiment 1) 11775 31.746 541.57843 3+ 3+ 1621.7137511650403 0 -0.1788386243952857 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3402 3401 P51991 EDSVKPGAHLTVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11161 (Experiment 1) 11161 30.808 460.92099 3+ 3+ 1379.7408787118702 0 0.18939453050992097 100.0 Confident
|
|
|
3403 3402 P07910 VPPPPPIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19139 (Experiment 1) 19139 42.471 472.289154 2+ 2+ 942.5650866263802 0 -1.409685269897016 98.91598915989161 Confident
|
|
|
3404 3403 P60842 LQMEAPHIIVGTPGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33744 (Experiment 1) 33744 60.05 540.294861 3+ 3+ 1617.86609630833 0 -2.0622701379337913 100.0 Confident
|
|
|
3405 3404 P62826 FNVWDTAGQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35035 (Experiment 1) 35035 61.564 647.807373 2+ 2+ 1293.5989655054502 0 0.9474746196522623 100.0 Confident
|
|
|
3406 3405 P50995 DAQELYAAGENR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19615 (Experiment 1) 19615 43.049 708.79364 2+ 2+ 1415.5718379586206 0 0.6271982864455807 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3407 3406 Q16666 TTIYEIQDDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26880 (Experiment 1) 26880 52.086 627.302429 2+ 2+ 1252.5935457718401 0 -2.5830420413305144 99.2248062015504 Confident
|
|
|
3408 3407 P50990 IAVYSCPFDGMITETK Phosphorylation of Y(4) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45251 (Experiment 1) 45251 77.098 956.417786 2+ 2+ 1910.8195387565304 0 0.7738830313879902 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3409 3408 P25705 HALIIYDDLSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34854 (Experiment 1) 34854 61.352 684.334656 2+ 2+ 1366.6533827546102 0 1.005584868131861 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3410 3409 P12268 HGFCGIPITDTGR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29342 (Experiment 1) 29342 54.969 477.901093 3+ 3+ 1429.6772329094902 1 0.6015584825978569 100.0 Confident
|
|
|
3411 3410 P27105 YLQTLTTIAAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35543 (Experiment 1) 35543 62.148 676.378052 2+ 2+ 1350.7394817295406 0 1.5297214292640988 99.21465968586386 Confident
|
|
|
3412 3411 P49736 TSIHEAMEQQSISISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25888 (Experiment 1) 25888 50.942 596.966614 3+ 3+ 1787.8723634572304 0 3.1543696754127217 100.0 Confident
|
|
|
3413 3412 P13796 QFVTATDVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28255 (Experiment 1) 28255 53.71 568.309448 2+ 2+ 1134.6033226099003 0 0.8978008330689633 100.0 Confident
|
|
|
3414 3413 P62328 TETQEKNPLPSKETIEQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16630 (Experiment 1) 16630 39.12 558.03656 4+ 4+ 2228.1172210787104 0 -0.03895172891613629 100.0 Doubtful
|
|
|
3415 3414 P13639 CLYASVLTAQPR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35941 (Experiment 1) 35941 62.637 689.860474 2+ 2+ 1377.70747040861 0 -0.7793904976157652 99.73333333333333 Confident
|
|
|
3416 3415 P26038 EALLQASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17823 (Experiment 1) 17823 40.714 444.250793 2+ 2+ 886.4872302285003 0 -0.2219040275951764 99.7289972899729 Confident
|
|
|
3417 3416 P62280 CPFTGNVSIR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27599 (Experiment 1) 27599 52.937 575.787964 2+ 2+ 1149.56007789893 0 1.1264293351007533 100.0 Confident
|
|
|
3418 3417 Q9GIY3 YFHNQEEFVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20614 (Experiment 1) 20614 44.261 456.881989 3+ 3+ 1367.6258489596305 0 -1.2485776568146474 100.0 Confident
|
|
|
3419 3418 Q8IY18 ENTSQYFFITPK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43188 (Experiment 1) 43188 72.772 777.847839 2+ 2+ 1553.6803257784404 0 0.5137819417008722 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 89.17975567190227) Y6 1 0 91.44385026737967 Confident
|
|
|
3420 3419 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29762 (Experiment 1) 29762 55.453 677.842529 2+ 2+ 1353.6693671719202 0 0.8393508537263353 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
3421 3420 P31040 IDEYDYSKPIQGQQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20369 (Experiment 1) 20369 43.974 946.428833 2+ 2+ 1890.8400738769703 0 1.605611631542712 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 8.987596469669938) Phosphorylation of Y (4: 0.6980802792321117) 0 Y4-{Y4 Y6} 1 100.0 Confident
|
|
|
3422 3421 P26885 KGDVLHMHYTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25884 (Experiment 1) 25884 50.938 693.357849 2+ 2+ 1384.6921546976403 0 6.483251783590457 98.94459102902374 Doubtful
|
|
|
3423 3422 P09651, P22626, Q32P51 IFVGGIKEDTEEHHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20261 (Experiment 1) 20261 43.855 470.745972 4+ 4+ 1878.9588103928604 0 -2.1392915343285552 100.0 Doubtful
|
|
|
3424 3423 P26038 ERQEAEEAKEALLQASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25729 (Experiment 1) 25729 50.762 490.254303 4+ 4+ 1956.9864816926806 0 0.828366730783321 100.0 Doubtful
|
|
|
3425 3424 Q16629 VYVGNLGTGAGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24796 (Experiment 1) 24796 49.67 608.292236 2+ 2+ 1214.56965313065 0 0.2185921241349222 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
3426 3425 Q9BRG1 LIYQWVSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38503 (Experiment 1) 38503 65.757 572.781982 2+ 2+ 1143.5477954872601 0 1.4102934841370318 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 93.01919720767889) Y3 1 0 99.45799457994579 Confident
|
|
|
3427 3426 P0DME0, Q01105 VEVTEFEDIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35874 (Experiment 1) 35874 62.554 604.806519 2+ 2+ 1207.5972341699503 0 1.0341304862057015 100.0 Confident
|
|
|
3428 3427 O00571, O15523 DKDAYSSFGSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13508 (Experiment 1) 13508 34.505 656.764465 2+ 2+ 1311.5132604533403 0 0.8500870892204784 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.55671902268762) Y5 1 0 99.1869918699187 Confident
|
|
|
3429 3428 Q92918 DHYDLLQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24270 (Experiment 1) 24270 49.057 570.248596 2+ 2+ 1138.48083812625 0 1.5790858428024734 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 82.89703315881326) Y3 1 0 92.67676767676768 Confident
|
|
|
3430 3429 P62917 GVAMNPVEHPFGGGNHQHIGKPSTIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19946 (Experiment 1) 19946 43.481 457.068573 6+ 6+ 2736.3666851851904 0 0.39892423106718367 100.0 Doubtful
|
|
|
3431 3430 P45880 LTLSALVDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41456 (Experiment 1) 41456 69.835 508.802673 2+ 2+ 1015.5913609438703 0 -0.5580524704433343 100.0 Confident
|
|
|
3432 3431 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44471 (Experiment 1) 44471 75.34 918.96936 2+ 2+ 1835.9222873793005 0 1.0227158160102097 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
3433 3432 Q06830 TIAQDYGVLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28679 (Experiment 1) 28679 54.203 594.28949 2+ 2+ 1186.5635051210502 0 0.775670827358908 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
3434 3433 P38159, Q96E39 GGHMDDGGYSMNFNMSSSR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30082 (Experiment 1) 30082 55.826 710.589966 3+ 3+ 2128.74382470031 0 1.9907907069841537 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.65095986038395) Y9 1 0 100.0 Confident
|
|
|
3435 3434 P62328 TETQEKNPLPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9718 (Experiment 1) 9718 28.073 457.908295 3+ 3+ 1370.7041588499803 0 -0.8031080621090759 92.66666666666666 Doubtful
|
|
|
3436 3435 P39023 HGSLGFLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26975 (Experiment 1) 26975 52.198 492.274414 2+ 2+ 982.53484912726 0 -0.5830696588610379 99.72972972972973 Confident
|
|
|
3437 3436 P06753, P07951, P09493, P67936 IQLVEEELDRAQER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33699 (Experiment 1) 33699 60.0 576.635864 3+ 3+ 1726.8849767462605 0 0.45427493588831014 100.0 Confident
|
|
|
3438 3437 B2RXH8, B7ZW38, O60812, P07910 AAVAGEDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5785 (Experiment 1) 5785 19.585 423.209412 3+ 2+ 844.4038945273601 0 0.4448615423065761 98.91598915989161 Confident
|
|
|
3439 3438 Q7L5N7 HLDEYASIASSSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18103 (Experiment 1) 18103 41.14 744.327454 2+ 2+ 1486.6341038620105 0 4.19924764433981 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 91.2739965095986) Y5 1 0 92.44791666666666 Confident
|
|
|
3440 3439 P23396 ELAEDGYSGVEVR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25100 (Experiment 1) 25100 50.025 752.321411 2+ 2+ 1502.6290184815703 0 -0.4980682525846109 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.7289972899729 Confident
|
|
|
3441 3440 P12235, P12236 AAYFGVYDTAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33664 (Experiment 1) 33664 59.959 603.295654 2+ 2+ 1204.5764391557202 0 0.2618208305411225 99.73118279569893 Confident
|
|
|
3442 3441 Q13547, Q92769 YGEYFPGTGDLR Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40369 (Experiment 1) 40369 68.286 727.803284 2+ 2+ 1453.5915107740402 0 0.3464483613640877 Phosphorylation of Y (1: Doubtfull) Phosphorylation of Y (1: 9.808129952130962) Phosphorylation of Y (1: 7.431340872374798) 0 Y1-{Y1 Y4} 1 93.76693766937669 Confident
|
|
|
3443 3442 P36578 AAAAAAALQAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13167 (Experiment 1) 13167 33.959 478.779938 2+ 2+ 955.5450794577903 0 0.2544056553690654 100.0 Confident
|
|
|
3444 3443 P07237 VDATEESDLAQQYGVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34025 (Experiment 1) 34025 60.385 890.922485 2+ 2+ 1779.8275214397904 0 1.6250747623408603 99.7289972899729 Confident
|
|
|
3445 3444 P07900, Q58FG0 HIYYITGETK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22060 (Experiment 1) 22060 46.303 652.799683 2+ 2+ 1303.5849688416204 0 -0.11931319060342839 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 4: 0.0) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y4} 1 100.0 Confident
|
|
|
3446 3445 P45880 NNFAVGYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21984 (Experiment 1) 21984 46.21 470.735718 2+ 2+ 939.4562644533901 0 0.6570708030676731 99.73045822102425 Confident
|
|
|
3447 3446 P0DMV8, P34931 DAGVIAGLNVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44811 (Experiment 1) 44811 76.147 599.351624 2+ 2+ 1196.6877209402 0 0.8126506448390423 99.73190348525469 Confident
|
|
|
3448 3447 P23284 HYGPGWVSMANAGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29931 (Experiment 1) 29931 55.649 518.890137 3+ 3+ 1553.6486488106805 0 -0.043176200467801 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3449 3448 P48643 FSELTAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17916 (Experiment 1) 17916 40.833 462.737244 2+ 2+ 923.4600124211504 0 -0.08358390090638469 100.0 Confident
|
|
|
3450 3449 P30101 FLQDYFDGNLKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38359 (Experiment 1) 38359 65.581 505.924377 3+ 3+ 1514.7517777487403 0 -0.3137155462688523 99.24812030075188 Confident
|
|
|
3451 3450 P50552 VQIYHNPTANSFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22740 (Experiment 1) 22740 47.138 542.919678 3+ 3+ 1625.7351553159604 0 1.258188681875904 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.28057553956835 Confident
|
|
|
3452 3451 P0C0S5, Q71UI9 ATIAGGGVIPHIHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21053 (Experiment 1) 21053 44.794 457.60202 3+ 3+ 1369.7830183073702 0 0.8830768595679285 100.0 Confident
|
|
|
3453 3452 O60361, P22392 NIIHGSDSVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9874 (Experiment 1) 9874 28.333 535.285645 2+ 2+ 1068.5563724174804 0 0.3406116184821206 99.73474801061008 Confident
|
|
|
3454 3453 P31146 QVALWDTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31776 (Experiment 1) 31776 57.801 480.76181 2+ 2+ 959.5076313199102 0 1.4932016020899892 99.73544973544973 Confident
|
|
|
3455 3454 Q13838 NCPHIVVGTPGR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16589 (Experiment 1) 16589 39.067 436.227692 3+ 3+ 1305.66118892253 0 0.0440725776657329 100.0 Confident
|
|
|
3456 3455 P49458 PQYQTWEEFSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37317 (Experiment 1) 37317 64.304 735.837769 2+ 2+ 1469.6575430107305 0 2.338874029631053 99.73958333333334 Confident
|
|
|
3457 3456 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28174 (Experiment 1) 28174 53.614 523.251831 2+ 2+ 1044.4892775516303 0 -0.16099822038564102 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3458 3457 Q02878 YYPTEDVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22666 (Experiment 1) 22666 47.05 570.272949 2+ 2+ 1138.5294889633 0 1.6273839568395005 100.0 Confident
|
|
|
3459 3458 P22626 GFGFVTFDDHDPVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42141 (Experiment 1) 42141 70.952 848.884766 2+ 2+ 1694.75765097482 1 -3.5518888336369763 99.72972972972973 Confident
|
|
|
3460 3459 P60709, P62736, P63261, P63267, P68032, P68133 EITALAPSTMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27903 (Experiment 1) 27903 53.289 581.3125 2+ 2+ 1160.6111104122804 0 -0.570558456970837 100.0 Confident
|
|
|
3461 3460 P31689 VKETTYYDVLGVKPNATQEELKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29590 (Experiment 1) 29590 55.255 684.09906 4+ 4+ 2732.3673780123004 0 -0.08912434658897758 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 7: 0.0) Phosphorylation of Y (7: 0.0) 0 Y6-{Y6 Y7} 1 100.0 Doubtful
|
|
|
3462 3461 P04908, Q7L7L0, Q93077 NDEELNKLLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34423 (Experiment 1) 34423 60.854 434.233307 3+ 3+ 1299.67827845531 0 -0.14343726910795315 99.40476190476191 Confident
|
|
|
3463 3462 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21124 (Experiment 1) 21124 44.888 759.857422 2+ 2+ 1517.7014551458406 0 -0.7659848671901524 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3464 3463 P62263 VKADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33597 (Experiment 1) 33597 59.882 643.802612 4+ 4+ 2571.1788660499706 0 0.9615078890561434 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Doubtful
|
|
|
3465 3464 P38117 EIDGGLETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30685 (Experiment 1) 30685 56.519 551.791809 2+ 2+ 1101.5666027480104 0 2.231207331407714 99.73890339425587 Confident
|
|
|
3466 3465 Q9NR30 STYEQVDLIGKK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24514 (Experiment 1) 24514 49.346 487.57254 3+ 3+ 1459.6959758425803 0 -0.12664303091753246 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
3467 3466 O43665 EIYMTFLSSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46790 (Experiment 1) 46790 80.004 649.788757 2+ 2+ 1297.5665418961603 0 -2.7553723262169307 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.65095986038395) Y3 1 0 99.45799457994579 Confident
|
|
|
3468 3467 Q16698 SLAAEWGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25700 (Experiment 1) 25700 50.729 431.226471 2+ 2+ 860.4392174069201 0 -0.9604463131544441 99.45799457994579 Confident
|
|
|
3469 3468 Q9HCS7 AAEIYGVTHTR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17570 (Experiment 1) 17570 40.381 649.302124 2+ 2+ 1296.58636582395 0 2.5637148240427696 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 100.0 Confident
|
|
|
3470 3469 O75746, Q9UJS0 IYSTLAGTR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19942 (Experiment 1) 19942 43.477 531.254456 2+ 2+ 1060.4954255612304 0 -1.0037504363239036 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 99.7340425531915 Confident
|
|
|
3471 3470 Q86VH4 QMNSPLQEYYVDYK Phosphorylation of Y(9, 13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35117 (Experiment 1) 35117 61.657 969.883057 2+ 2+ 1936.7355479565806 1 6.52908901944929 Phosphorylation of Y (9: Doubtfull, 13: Doubtfull) Phosphorylation of Y (9: 63.994862031511246, 13: 63.994862031511246) 0 Y9-{Y9}, Y13-{Y13} 2 94.02173913043478 Doubtful
|
|
|
3472 3471 P68104, Q05639, Q5VTE0 LPLQDVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30660 (Experiment 1) 30660 56.49 488.279297 2+ 2+ 974.5436824754604 0 0.36719870116347647 100.0 Confident
|
|
|
3473 3472 P12955 EASFDGISK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20864 (Experiment 1) 20864 44.548 477.233582 2+ 2+ 952.4501760134401 0 2.5512235938564527 94.08602150537635 Confident
|
|
|
3474 3473 O75390 AYAQGISR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10651 (Experiment 1) 10651 29.862 473.214264 2+ 2+ 944.4116959372702 0 2.4081423234040855 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
3475 3474 Q15631 TKFPAEQYYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21389 (Experiment 1) 21389 45.278 691.811096 2+ 2+ 1381.6067669153604 0 0.6303393876754367 Phosphorylation of Y (8: Random) Phosphorylation of Y (8: 0.0, 9: 0.0) Phosphorylation of Y (9: 0.0) 0 Y8-{Y8 Y9} 1 99.45799457994579 Confident
|
|
|
3476 3475 P23246 ISDSEGFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13816 (Experiment 1) 13816 34.961 441.713806 2+ 2+ 881.4130622287303 0 -0.0035796415896717886 92.75 Confident
|
|
|
3477 3476 P52209 AGQAVDDFIEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29431 (Experiment 1) 29431 55.071 596.796082 2+ 2+ 1191.5771674317102 0 0.37168041464637563 100.0 Confident
|
|
|
3478 3477 P49321 EAQLYAAQAHLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21621 (Experiment 1) 21621 45.68 711.843811 2+ 2+ 1421.6704298010804 0 1.8538267435113545 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3479 3478 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32364 (Experiment 1) 32364 58.47 616.268311 2+ 2+ 1230.5209716027305 0 0.8904113703965235 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 43.16022828057617) Phosphorylation of Y (3: 87.41258741258741) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
3480 3479 P27797 QIDNPDYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11866 (Experiment 1) 11866 31.893 496.738159 2+ 2+ 991.4610750503102 0 0.6945475524611711 98.74371859296483 Confident
|
|
|
3481 3480 O60488, O95573 LQAGEYVSLGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27838 (Experiment 1) 27838 53.217 622.798645 2+ 2+ 1243.5849688416204 0 -1.7917277628693677 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 96.33507853403141) Y6 1 0 99.2 Confident
|
|
|
3482 3481 GSTP1_HUMAN, P09211 ASCLYGQLPK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27404 (Experiment 1) 27404 52.697 568.792908 2+ 2+ 1135.56957995347 0 1.4795502654338117 99.73890339425587 Confident
|
|
|
3483 3482 P04179 HHAAYVNNLNVTEEK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16982 (Experiment 1) 16982 39.569 606.943909 3+ 3+ 1817.8097768082005 0 0.06633856915545348 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.30191972076788) Y5 1 0 100.0 Confident
|
|
|
3484 3483 Q16881 KVVYENAYGQFIGPHR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28720 (Experiment 1) 28720 54.252 653.315857 3+ 3+ 1956.9247469907903 0 0.5074672880246358 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 5.927251481515231) Phosphorylation of Y (4: 0.3490401396160559) 0 Y4-{Y4 Y8} 1 100.0 Confident
|
|
|
3485 3484 P63244 LTRDETNYGIPQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17073 (Experiment 1) 17073 39.694 548.257874 3+ 3+ 1641.7511993029202 0 0.36071642310201096 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3486 3485 P62318 VAQLEQVYIR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34853 (Experiment 1) 34853 61.349 649.829468 2+ 2+ 1297.6431524240802 0 0.9468972411906348 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.30191972076788) Y8 1 0 99.73045822102425 Confident
|
|
|
3487 3486 P61604 KFLPLFDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39549 (Experiment 1) 39549 67.11 518.303955 2+ 2+ 1034.5913013742202 0 1.9830991182361137 98.9501312335958 Confident
|
|
|
3488 3487 P19338 AVTTPGKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4051 (Experiment 1) 4051 16.616 401.245087 2+ 2+ 800.4756029156401 0 0.022618016976468376 99.45799457994579 Confident
|
|
|
3489 3488 P33991 DYIAYAHSTIMPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34920 (Experiment 1) 34920 61.429 809.36084 2+ 2+ 1616.7058293336302 0 0.8017028512236382 Phosphorylation of Y (5: Random) Phosphorylation of Y (2: 0.0, 5: 0.0) Phosphorylation of Y (5: 2.6178010471204187) 0 Y5-{Y2 Y5} 1 100.0 Confident
|
|
|
3490 3489 P27797 VHVIFNYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25229 (Experiment 1) 25229 50.175 510.287842 2+ 2+ 1018.5600012459402 0 1.1070435092881303 99.73474801061008 Confident
|
|
|
3491 3490 Q02790 FQIPPNAELK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32701 (Experiment 1) 32701 58.858 578.82019 2+ 2+ 1155.6288090817502 0 -2.575936140737543 96.22641509433963 Confident
|
|
|
3492 3491 P40926 SQETECTYFSTPLLLGKK Phosphorylation of Y(8) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42269 (Experiment 1) 42269 71.148 728.009949 3+ 3+ 2181.00648757907 0 0.7005497511085245 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 99.28057553956835 Confident
|
|
|
3493 3492 Q9Y3I0 GMAAAGNYAWVNR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31875 (Experiment 1) 31875 57.916 730.811157 2+ 2+ 1459.6067839987004 0 0.668482082693306 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3494 3493 P08621 EFEVYGPIKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29864 (Experiment 1) 29864 55.571 659.315796 2+ 2+ 1316.6166033230702 0 0.33045124373723117 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3495 3494 O43933, P55072, Q8IYT4 GILLYGPPGTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36700 (Experiment 1) 36700 63.568 586.83667 2+ 2+ 1171.6601092100302 0 -1.1264992735648298 99.73544973544973 Confident
|
|
|
3496 3495 Q14152 ITTMQLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22313 (Experiment 1) 22313 46.626 496.266022 2+ 2+ 990.5168161046201 0 0.6800407292217764 97.83783783783784 Confident
|
|
|
3497 3496 P08575 NSNVIPYDYNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27495 (Experiment 1) 27495 52.806 677.822388 2+ 2+ 1353.6313282628903 0 -0.8152545806207803 91.32791327913279 Confident
|
|
|
3498 3497 P55072 LGDVISIQPCPDVK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36486 (Experiment 1) 36486 63.316 770.906067 2+ 2+ 1539.7966793358303 0 0.5848514569876582 100.0 Confident
|
|
|
3499 3498 P16401 NGLSLAALKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25228 (Experiment 1) 25228 50.173 507.819 2+ 2+ 1013.6233297784904 0 0.11548199185652078 100.0 Confident
|
|
|
3500 3499 P30520 ELPVNAQNYVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29865 (Experiment 1) 29865 55.572 651.843567 2+ 2+ 1301.6727991520504 0 -0.16728372349684267 99.45652173913044 Confident
|
|
|
3501 3500 P26038 ERQEAEEAKEALLQASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25704 (Experiment 1) 25704 50.734 653.335938 3+ 3+ 1956.9864816926806 0 -0.25361786153524424 100.0 Confident
|
|
|
3502 3501 P16150 RPTLTTFFGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36052 (Experiment 1) 36052 62.781 399.224182 3+ 3+ 1194.6509415086603 0 -0.18778843578582613 100.0 Confident
|
|
|
3503 3502 Q9Y3Q3 TVIDSQTHYR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12129 (Experiment 1) 12129 32.319 650.289124 2+ 2+ 1298.5656303793703 0 -1.4880381996052172 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3504 3503 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13812 (Experiment 1) 13812 34.957 400.860077 3+ 3+ 1199.5587540937802 0 -0.2931148407820501 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3505 3504 P13639 STLTDSLVCK Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27732 (Experiment 1) 27732 53.094 562.286743 2+ 2+ 1122.5590748394202 0 -0.12606826341317684 100.0 Confident
|
|
|
3506 3505 P50990 HFSGLEEAVYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29430 (Experiment 1) 29430 55.07 694.306763 2+ 2+ 1386.5969305076505 0 1.4709360751826794 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3507 3506 P62491, Q15907 NEFNLESK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22642 (Experiment 1) 22642 47.021 490.737732 2+ 2+ 979.4610750503102 0 -0.16707896710047 99.45799457994579 Confident
|
|
|
3508 3507 P62937, PPIA_HUMAN EGMNIVEAMER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41280 (Experiment 1) 41280 69.57 639.794861 2+ 2+ 1277.5744076337305 0 0.5950603426112062 100.0 Confident
|
|
|
3509 3508 P14625 LIINSLYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36381 (Experiment 1) 36381 63.196 482.29657 2+ 2+ 962.5800679841802 0 -1.5352747901417614 99.7289972899729 Confident
|
|
|
3510 3509 P60174 IIYGGSVTGATCK Phosphorylation of Y(3) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20639 (Experiment 1) 20639 44.289 703.820007 2+ 2+ 1405.63126741104 0 -4.124861936243329 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3511 3510 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26147 (Experiment 1) 26147 51.243 523.252502 2+ 2+ 1044.4892775516303 0 1.1213668899265758 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.60383944153578) Y7 1 0 99.73118279569893 Confident
|
|
|
3512 3511 P49327 SLYQSAGVAPESFEYIEAHGTGTK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41887 (Experiment 1) 41887 70.489 874.730896 3+ 3+ 2621.168678205751 0 0.8308824403784737 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 4.331398227279771) Phosphorylation of Y (3: 83.24607329842932) 0 Y3-{Y3 Y15} 1 99.28057553956835 Confident
|
|
|
3513 3512 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13811 (Experiment 1) 13811 34.954 600.786926 2+ 2+ 1199.5587540937802 0 0.45354918628356355 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3514 3513 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21554 (Experiment 1) 21554 45.562 506.908051 3+ 3+ 1517.7014551458406 0 0.5710793884885212 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3515 3514 P29401 ILATPPQEDAPSVDIANIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40365 (Experiment 1) 40365 68.28 674.029724 3+ 3+ 2019.0636693842202 0 1.8165479877313004 100.0 Confident
|
|
|
3516 3515 P62263 TKTPGPGAQSALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10221 (Experiment 1) 10221 29.06 428.574158 3+ 3+ 1282.6993482530602 0 1.008264098264944 100.0 Confident
|
|
|
3517 3516 P62273 GHQQLYWSHPR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18502 (Experiment 1) 18502 41.67 496.88916 3+ 3+ 1487.6459463887402 0 -0.19842729608243528 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3518 3517 P62805 ISGLIYEETR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31378 (Experiment 1) 31378 57.327 591.319885 2+ 2+ 1179.6135529404305 1 7.032067114813054 100.0 Doubtful
|
|
|
3519 3518 P62851 LNNLVLFDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40798 (Experiment 1) 40798 68.889 538.30957 2+ 2+ 1074.6073453611803 0 -2.5619902481537404 100.0 Confident
|
|
|
3520 3519 P62829 LPAAGVGDMVMATVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43253 (Experiment 1) 43253 72.886 730.389099 2+ 2+ 1458.7574573761403 0 4.2359041601436145 96.7479674796748 Confident
|
|
|
3521 3520 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35569 (Experiment 1) 35569 62.178 630.797607 2+ 2+ 1259.5798834611805 0 0.616367013693716 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
3522 3521 P13796, P13797, Q14651 LSPEELLLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44496 (Experiment 1) 44496 75.396 535.316345 2+ 2+ 1068.61791004488 0 0.21204428552786658 99.73333333333333 Confident
|
|
|
3523 3522 Q92945 VQISPDSGGLPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24340 (Experiment 1) 24340 49.141 677.851685 2+ 2+ 1353.68884313901 0 -0.019231813022769835 99.7289972899729 Confident
|
|
|
3524 3523 P04406 LVINGNPITIFQERDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44495 (Experiment 1) 44495 75.394 681.369324 3+ 3+ 2040.1003892461104 1 -8.614993359562455 100.0 Doubtful
|
|
|
3525 3524 P11142 EIAEAYLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26471 (Experiment 1) 26471 51.617 497.265686 2+ 2+ 992.5178616504402 0 -1.0483158203571112 99.73333333333333 Confident
|
|
|
3526 3525 P27216, P50995 SELSGNFEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18788 (Experiment 1) 18788 42.034 505.743805 2+ 2+ 1009.4716397340103 0 1.4012374821115694 99.7289972899729 Confident
|
|
|
3527 3526 Q12934 RSYVFQTR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12284 (Experiment 1) 12284 32.609 568.761597 2+ 2+ 1135.5175579881404 0 -7.838830815282324 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 90.57591623036649) Y3 1 0 92.3076923076923 Doubtful
|
|
|
3528 3527 O14910, Q9HAP6, Q9NUP9 EQNSPIYISR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27993 (Experiment 1) 27993 53.392 643.792664 2+ 2+ 1285.57038140664 0 0.3057349656439489 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3529 3528 P29401 TSRPENAIIYNNNEDFQVGQAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32031 (Experiment 1) 32031 58.092 863.730408 3+ 3+ 2587.17040954125 1 -1.6870483281071853 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3530 3529 O00160, Q12965 HQVEYLGLK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24039 (Experiment 1) 24039 48.762 583.784058 2+ 2+ 1165.5532747905202 0 0.24690287687326015 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.50959860383944) Y5 1 0 96.22641509433963 Confident
|
|
|
3531 3530 P10412, P16402, P16403, P22492, Q02539 KALAAAGYDVEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15716 (Experiment 1) 15716 37.925 412.559723 3+ 3+ 1234.6557521055804 0 1.2826393620825025 100.0 Confident
|
|
|
3532 3531 P07900 ELISNSSDALDKIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30250 (Experiment 1) 30250 56.02 520.946167 3+ 3+ 1559.8155002041103 0 0.7495312733126129 100.0 Confident
|
|
|
3533 3532 P11021 KSDIDEIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34685 (Experiment 1) 34685 61.155 530.289551 3+ 3+ 1587.84680033239 0 0.014625452631844255 100.0 Confident
|
|
|
3534 3533 O14950, P19105 FTDEEVDELYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36392 (Experiment 1) 36392 63.209 708.319702 2+ 2+ 1414.6252398229403 0 -0.27442160417175626 100.0 Confident
|
|
|
3535 3534 P78527 VVQMLGSLGGQINK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37737 (Experiment 1) 37737 64.817 722.404663 2+ 2+ 1442.79153438574 0 2.241602291308648 99.73190348525469 Confident
|
|
|
3536 3535 B2RPK0, P09429, P26583 MSSYAFFVQTCR Phosphorylation of Y(4) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43359 (Experiment 1) 43359 73.063 526.215942 3+ 3+ 1575.6251364847806 0 0.5448430219275865 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.83844911147011) Y4 1 0 100.0 Confident
|
|
|
3537 3536 P61978 TDYNASVSVPDSSGPER Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23091 (Experiment 1) 23091 47.558 930.890747 2+ 2+ 1859.7574664518204 0 5.089030481109393 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Doubtful
|
|
|
3538 3537 HBB_HUMAN, P02042, P02100, P68871, P69891, P69892 LLVVYPWTQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45244 (Experiment 1) 45244 77.085 637.866699 2+ 2+ 1273.71829279249 0 0.43290716213616726 99.73190348525469 Confident
|
|
|
3539 3538 O75477, O94905 ISEIEDAAFLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40942 (Experiment 1) 40942 69.09 667.852295 2+ 2+ 1333.6877805098504 0 1.689415724582427 99.73333333333333 Confident
|
|
|
3540 3539 P48643 HKLDVTSVEDYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20512 (Experiment 1) 20512 44.143 478.580536 3+ 3+ 1432.7198089141204 0 -0.021114214177141682 100.0 Confident
|
|
|
3541 3540 P62191 SKENVLYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10099 (Experiment 1) 10099 28.814 530.757141 2+ 2+ 1059.5001765885004 0 -0.42158823800161954 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.33507853403141) Y7 1 0 98.91598915989161 Confident
|
|
|
3542 3541 P43243 SQAFIEMETR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30663 (Experiment 1) 30663 56.495 606.290466 2+ 2+ 1210.5652228490203 0 0.9535185879892113 100.0 Confident
|
|
|
3543 3542 P19784 VYAEVNSLR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23419 (Experiment 1) 23419 47.96 565.766602 2+ 2+ 1129.5168892818003 0 1.556991268526111 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
3544 3543 O60711 EEIGSSPFFER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38411 (Experiment 1) 38411 65.646 649.308838 2+ 2+ 1296.5986311522804 0 3.4590085412433815 99.73045822102425 Confident
|
|
|
3545 3544 P35232 FDAGELITQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36542 (Experiment 1) 36542 63.381 575.297974 2+ 2+ 1148.5825871653203 0 -1.0360697962925238 100.0 Confident
|
|
|
3546 3545 Q13564 TYGLVGYMR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39320 (Experiment 1) 39320 66.793 570.251709 2+ 2+ 1138.4882320058102 0 0.5550714772403447 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 18.51042067382668) Phosphorylation of Y (2: 99.83844911147011) 0 Y2-{Y2 Y7} 1 100.0 Confident
|
|
|
3547 3546 O75391 TYGCVPVANKR Phosphorylation of Y(2) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12121 (Experiment 1) 12121 32.305 672.805847 2+ 2+ 1343.60572136954 0 -6.376466918760929 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.47826086956522) Y2 1 0 99.74619289340102 Doubtful
|
|
|
3548 3547 P12955 AFTPFSGPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30776 (Experiment 1) 30776 56.622 476.251404 2+ 2+ 950.4861675993402 0 2.1915647839796524 99.45652173913044 Confident
|
|
|
3549 3548 P25789 TTIFSPEGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26132 (Experiment 1) 26132 51.227 504.261627 2+ 2+ 1006.5083595959002 0 0.3385847476715156 99.73190348525469 Confident
|
|
|
3550 3549 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17682 (Experiment 1) 17682 40.534 514.763184 2+ 2+ 1027.5120650773501 0 -0.24284070937805705 100.0 Confident
|
|
|
3551 3550 Q15428 FMSAYEQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19872 (Experiment 1) 19872 43.381 516.234558 2+ 2+ 1030.4542158480601 0 0.33629909805385216 99.72826086956522 Confident
|
|
|
3552 3551 P12956 IMLFTNEDNPHGNDSAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28749 (Experiment 1) 28749 54.287 634.959167 3+ 3+ 1901.8577760222504 0 -1.1047536444502144 100.0 Confident
|
|
|
3553 3552 O75083 YEYQPFAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24524 (Experiment 1) 24524 49.357 591.749573 2+ 2+ 1181.4794411439204 0 4.353146261245343 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 12.252901686149535) Phosphorylation of Y (3: 10.55846422338569) 0 Y3-{Y1 Y3} 1 100.0 Confident
|
|
|
3554 3553 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10335 (Experiment 1) 10335 29.255 405.50769 3+ 3+ 1213.5016331404804 0 -0.3226743490503415 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3555 3554 P62995 RPHTPTPGIYMGRPTYGSSR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20276 (Experiment 1) 20276 43.871 578.524353 4+ 4+ 2310.0728848598 0 -1.9786193809222619 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 1.5763197007060767) Phosphorylation of Y (10: 0.9693053311793215) 0 Y10-{Y10 Y16} 1 100.0 Doubtful
|
|
|
3556 3555 P50990 GSTDNLMDDIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36967 (Experiment 1) 36967 63.888 683.301514 2+ 2+ 1364.5878087684002 0 0.48755804488956866 100.0 Confident
|
|
|
3557 3556 P50552 VQIYHNPTANSFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22983 (Experiment 1) 22983 47.426 813.874878 2+ 2+ 1625.7351553159604 0 0.029335232063782867 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.4458804523425) Y4 1 0 99.46091644204851 Confident
|
|
|
3558 3557 P16401 ATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32229 (Experiment 1) 32229 58.316 606.845703 2+ 2+ 1211.6761531969903 0 0.5766455835378674 100.0 Confident
|
|
|
3559 3558 P68431, P84243, Q16695, Q6NXT2, Q71DI3 YRPGTVALR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 15035 (Experiment 1) 15035 36.892 516.801575 2+ 2+ 1031.5876129761102 0 0.9520977199972823 100.0 Confident
|
|
|
3560 3559 Q8TEM1 VGQALELPLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 37994 (Experiment 1) 37994 65.129 548.329956 2+ 2+ 1094.64479349906 0 0.5157183202386807 100.0 Confident
|
|
|
3561 3560 P25205 CSVLAAANPVYGR Phosphorylation of Y(11) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34784 (Experiment 1) 34784 61.269 729.336304 2+ 2+ 1456.6533998379502 0 3.191424351817128 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 99.82547993019197) Y11 1 0 99.73190348525469 Confident
|
|
|
3562 3561 GSTP1_HUMAN, P09211 MLLADQGQSWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33221 (Experiment 1) 33221 59.448 638.822021 2+ 2+ 1275.6281574587501 0 1.042237876665119 92.51336898395722 Confident
|
|
|
3563 3562 Q13813 LQIASDENYKDPTNLQGK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24344 (Experiment 1) 24344 49.145 705.332092 3+ 3+ 2112.9728789516703 0 0.7408562446612608 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3564 3563 P07900 DQVANSAFVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22302 (Experiment 1) 22302 46.612 618.304443 2+ 2+ 1234.5942144781804 0 0.09589790927956088 100.0 Confident
|
|
|
3565 3564 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30878 (Experiment 1) 30878 56.741 630.796204 2+ 2+ 1259.5798834611805 0 -1.6078025918593022 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
3566 3565 Q9Y2R9 FYQVPVPLPDR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42215 (Experiment 1) 42215 71.059 705.845825 2+ 2+ 1409.67445255236 0 1.8732978762169752 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
3567 3566 P20700 DAALATALGDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21046 (Experiment 1) 21046 44.781 587.327942 2+ 2+ 1172.6401020414403 0 1.0462861832433177 100.0 Confident
|
|
|
3568 3567 P62750 LDHYAIIK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20910 (Experiment 1) 20910 44.603 526.763428 2+ 2+ 1051.5103473493803 0 1.8563557396962767 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.03069466882067) Y4 1 0 98.91304347826086 Confident
|
|
|
3569 3568 P36969 TEVNYTQLVDLHAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33590 (Experiment 1) 33590 59.874 580.27655 3+ 3+ 1737.8087141790404 0 -0.5133064097277704 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3570 3569 P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3 TIGGGDDSFNTFFSETGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45427 (Experiment 1) 45427 77.49 1004.448792 2+ 2+ 2006.8857645919009 0 -1.3607073985196394 100.0 Confident
|
|
|
3571 3570 Q08211 SSVNCPFSSQDMK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24444 (Experiment 1) 24444 49.262 743.820984 2+ 2+ 1485.6228143781302 0 3.092614064850718 99.7289972899729 Confident
|
|
|
3572 3571 P61353 KVTAAMGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4828 (Experiment 1) 4828 17.716 403.233978 2+ 2+ 804.4527592960801 0 0.7982596271106717 100.0 Confident
|
|
|
3573 3572 Q15056 AYSSFGGGR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13836 (Experiment 1) 13836 34.997 491.195007 2+ 2+ 980.3753104285499 0 0.1533381315438663 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.03069466882067) Y2 1 0 99.74293059125964 Confident
|
|
|
3574 3573 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 DLTDYLMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44228 (Experiment 1) 44228 74.654 499.746979 2+ 2+ 997.4790336135702 0 0.37164100990059645 100.0 Confident
|
|
|
3575 3574 P51571 VQNMALYADVGGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31279 (Experiment 1) 31279 57.212 723.830078 2+ 2+ 1444.6421664479103 1 0.05653080255524038 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.72972972972973 Confident
|
|
|
3576 3575 Q13435 LAEIGAPIQGNREELVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30015 (Experiment 1) 30015 55.748 665.360657 3+ 3+ 1993.0592527101205 0 0.44531730263749686 100.0 Confident
|
|
|
3577 3576 P11586 YVVVTGITPTPLGEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39271 (Experiment 1) 39271 66.72 815.957825 2+ 2+ 1629.8977732760904 0 2.0367456216483393 100.0 Confident
|
|
|
3578 3577 P60228 VLVPATDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16838 (Experiment 1) 16838 39.38 435.7565 2+ 2+ 869.4970666362101 0 1.5839492383409899 99.7289972899729 Confident
|
|
|
3579 3578 Q06830 KQGGLGPMNIPLVSDPKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33515 (Experiment 1) 33515 59.79 477.518005 4+ 4+ 1906.0458515754503 0 -1.537867761102057 100.0 Doubtful
|
|
|
3580 3579 Q08211 AAECNIVVTQPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20430 (Experiment 1) 20430 44.046 679.349182 2+ 2+ 1356.6819839367602 0 1.3447665215846945 100.0 Confident
|
|
|
3581 3580 P06576 IMNVIGEPIDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36441 (Experiment 1) 36441 63.266 693.358093 2+ 2+ 1384.702050675 0 -0.30114922036772457 100.0 Confident
|
|
|
3582 3581 P27105, Q8TAV4 LLAQTTLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21227 (Experiment 1) 21227 45.039 458.284973 2+ 2+ 914.5549158655001 0 0.5206379790937562 99.23273657289002 Confident
|
|
|
3583 3582 P07900 YYTSASGDEMVSLKDYCTR Carbamidomethylation of C(17) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32579 (Experiment 1) 32579 58.72 749.663818 3+ 3+ 2244.96673441788 1 -0.2066986121979626 92.80575539568345 Doubtful
|
|
|
3584 3583 Q92841 VLEEANQAINPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19974 (Experiment 1) 19974 43.515 663.355774 2+ 2+ 1324.69867954672 0 -1.269664237153177 100.0 Confident
|
|
|
3585 3584 P09651, P22626, Q32P51 KIFVGGIKEDTEEHHLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17588 (Experiment 1) 17588 40.407 502.770874 4+ 4+ 2007.0537734068607 0 0.30666358782783887 100.0 Doubtful
|
|
|
3586 3585 P48735 YFDLGLPNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41712 (Experiment 1) 41712 70.24 547.7854 2+ 2+ 1093.5556441414901 0 0.5503297618967978 99.45652173913044 Confident
|
|
|
3587 3586 P29350 GQESEYGNITYPPAMK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33490 (Experiment 1) 33490 59.761 932.895752 2+ 2+ 1863.7750310922602 0 1.0290410730910504 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 39.26701570680628) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
3588 3587 P30050 IGPLGLSPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30696 (Experiment 1) 30696 56.532 441.276428 2+ 2+ 880.5382031722002 0 0.11318776725260019 100.0 Confident
|
|
|
3589 3588 P60174 VPADTEVVCAPPTAYIDFAR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45298 (Experiment 1) 45298 77.216 731.362 3+ 3+ 2191.0619551320606 0 1.0097460811316021 94.73684210526316 Confident
|
|
|
3590 3589 P08238, P14625, Q58FF6, Q58FF7, Q58FF8 ELISNASDALDKIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35966 (Experiment 1) 35966 62.669 515.61377 3+ 3+ 1543.8205855845501 0 -0.7143487761967675 100.0 Confident
|
|
|
3591 3590 P11142, P54652 VQVEYKGETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9948 (Experiment 1) 9948 28.454 394.212006 3+ 3+ 1179.6135529404303 0 0.5374937560143204 100.0 Confident
|
|
|
3592 3591 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32384 (Experiment 1) 32384 58.494 565.800171 2+ 2+ 1129.58800689893 0 -1.95990415087072 100.0 Confident
|
|
|
3593 3592 P04843 VTAEVVLAHLGGGSTSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36589 (Experiment 1) 36589 63.434 551.968384 3+ 3+ 1652.8845828234403 0 -0.7610477662257749 100.0 Confident
|
|
|
3594 3593 Q9Y224 KLTALDYHNPAGFNCKDETEFR Phosphorylation of Y(7) Carbamidomethylation of C(15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30320 (Experiment 1) 30320 56.1 677.30719 4+ 4+ 2705.1945161141102 0 1.8964911570085243 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Doubtful
|
|
|
3595 3594 P23396 TEIIILATR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38150 (Experiment 1) 38150 65.319 515.319397 2+ 2+ 1028.6229954253204 0 1.20861214248518 99.73262032085562 Confident
|
|
|
3596 3595 P27695 EGYSGVGLLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33491 (Experiment 1) 33491 59.762 569.298218 2+ 2+ 1136.58258716532 0 -0.6183916324753402 100.0 Confident
|
|
|
3597 3596 P61604 VLLPEYGGTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29773 (Experiment 1) 29773 55.465 538.803345 2+ 2+ 1075.59136094387 0 0.7202285138242857 100.0 Confident
|
|
|
3598 3597 P61158 DYEEIGPSICR Phosphorylation of Y(2) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31251 (Experiment 1) 31251 57.178 709.786865 2+ 2+ 1417.5584963936 0 0.4794911936132063 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3599 3598 P23284 DKPLKDVIIADCGK Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22913 (Experiment 1) 22913 47.338 524.620544 3+ 3+ 1570.8388785009802 0 0.5871539833846736 100.0 Confident
|
|
|
3600 3599 P26373 VATWFNQPAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33671 (Experiment 1) 33671 59.967 595.309937 2+ 2+ 1188.6039913162404 0 1.1168565632585106 100.0 Confident
|
|
|
3601 3600 P07437 ISVYYNEATGGK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26478 (Experiment 1) 26478 51.624 691.30603 2+ 2+ 1380.5962618013102 0 0.9006620317822058 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (4: 0.0) 0 Y4-{Y4 Y5} 1 100.0 Confident
|
|
|
3602 3601 P98179 YYDSRPGGYGYGYGR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22677 (Experiment 1) 22677 47.064 604.24469 3+ 3+ 1809.7148137942 0 -1.4195082588068222 Phosphorylation of Y (2: Random) Phosphorylation of Y (9: 0.0, 11: 0.0) Phosphorylation of Y (2: 34.26939552594003) 0 Y2-{Y1 Y2 Y9 Y11 Y13} 1 91.7910447761194 Doubtful
|
|
|
3603 3602 Q7L1Q6 DINAVAASLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35798 (Experiment 1) 35798 62.463 515.288757 2+ 2+ 1028.5614577979202 0 1.4586682011629313 100.0 Confident
|
|
|
3604 3603 P30626 LSPQAVNSIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21212 (Experiment 1) 21212 45.019 564.324158 2+ 2+ 1126.6346227381805 0 -0.7616820382715553 99.46949602122017 Confident
|
|
|
3605 3604 Q16181 DVTNNVHYENYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18590 (Experiment 1) 18590 41.782 535.224365 3+ 3+ 1602.6463998812103 0 3.0303385625952726 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 7.329830238079078) Phosphorylation of Y (11: 0.0) 0 Y8-{Y8 Y11} 1 99.28057553956835 Confident
|
|
|
3606 3605 P60709, P62736, P63261, P63267, P68032, P68133, Q562R1 HQGVMVGMGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13241 (Experiment 1) 13241 34.065 586.790894 2+ 2+ 1170.56378338038 1 0.0825942221973903 100.0 Confident
|
|
|
3607 3606 O75347 QAEILQESR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17507 (Experiment 1) 17507 40.299 537.284729 2+ 2+ 1072.5512870370403 0 3.366968501049111 99.7289972899729 Confident
|
|
|
3608 3607 Q9BZK7 HQEPVYSVAFSPDGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29174 (Experiment 1) 29174 54.776 590.26178 3+ 3+ 1767.7617639866203 0 0.9863503085699935 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3609 3608 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36952 (Experiment 1) 36952 63.872 630.796997 2+ 2+ 1259.5798834611805 0 -0.3506632495040093 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
3610 3609 P35232 IFTSIGEDYDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33925 (Experiment 1) 33925 60.263 722.840027 2+ 2+ 1443.65178892395 0 9.484998044608044 100.0 Doubtful
|
|
|
3611 3610 P11142 NSLESYAFNMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39016 (Experiment 1) 39016 66.377 652.30365 2+ 2+ 1302.5914375968603 0 1.003727964607942 100.0 Confident
|
|
|
3612 3611 A8MTJ3, P04899, P08754, P11488, P19087, P38405, P63092, P63096, Q5JWF2 MFDVGGQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23494 (Experiment 1) 23494 48.053 455.217041 2+ 2+ 908.4174364165201 0 2.2985240857597447 98.91598915989161 Confident
|
|
|
3613 3612 P16298, Q08209 LFEVGGSPANTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27040 (Experiment 1) 27040 52.273 624.321777 2+ 2+ 1246.6305999869003 0 -1.2805243512856765 99.7289972899729 Confident
|
|
|
3614 3613 P36578 KLDELYGTWR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34093 (Experiment 1) 34093 60.467 454.215027 3+ 3+ 1359.6224169795003 0 0.6125003397110091 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
3615 3614 Q08211 YTQVGPDHNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7068 (Experiment 1) 7068 22.46 396.190582 3+ 3+ 1185.5526840193702 0 -2.3283519668804282 99.28057553956835 Confident
|
|
|
3616 3615 P07948, P08631 VIEDNEYTAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16123 (Experiment 1) 16123 38.499 605.29071 2+ 2+ 1208.5673310240002 0 -0.38325174899918557 99.73753280839895 Confident
|
|
|
3617 3616 P11310 IYQIYEGTSQIQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31035 (Experiment 1) 31035 56.927 839.897034 2+ 2+ 1677.7763514216003 0 1.8833562958570642 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 26.63435965086682) Phosphorylation of Y (2: 67.07428696957494) 0 Y2-{Y2 Y5} 1 100.0 Confident
|
|
|
3618 3617 P41252 APLKPYPVSPSDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17330 (Experiment 1) 17330 40.054 466.92569 3+ 3+ 1397.7554661468503 0 -0.16101580671964277 98.7012987012987 Confident
|
|
|
3619 3618 P23193 IGMSVNAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27301 (Experiment 1) 27301 52.575 480.768463 2+ 2+ 959.5222358382302 0 0.14271751994730408 100.0 Confident
|
|
|
3620 3619 B2RPK0, P09429, P26583 MSSYAFFVQTCR Phosphorylation of Y(4) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43271 (Experiment 1) 43271 72.92 788.82019 2+ 2+ 1575.6251364847806 0 0.4377308709763462 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
3621 3620 P07237 LITLEEEMTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37006 (Experiment 1) 37006 63.937 603.818237 2+ 2+ 1205.6213407428106 0 0.4805451445956097 96.7479674796748 Confident
|
|
|
3622 3621 P00558 AHSSMVGVNLPQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20442 (Experiment 1) 20442 44.064 684.3573 2+ 2+ 1366.7027193813403 0 -1.9524229134165567 100.0 Confident
|
|
|
3623 3622 P62942 GWEEGVAQMSVGQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36144 (Experiment 1) 36144 62.907 767.35553 2+ 2+ 1532.7041759333201 0 -4.9969201521690145 100.0 Doubtful
|
|
|
3624 3623 P62263 ADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38070 (Experiment 1) 38070 65.223 782.346191 3+ 3+ 2344.0154891229804 0 0.5344936671003672 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3625 3624 P06744 SNTPILVDGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21050 (Experiment 1) 21050 44.789 522.291382 2+ 2+ 1042.5658744720201 0 2.236873575655856 96.19565217391303 Confident
|
|
|
3626 3625 P15880 SPYQEFTDHLVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35978 (Experiment 1) 35978 62.683 488.576874 3+ 3+ 1462.7092442304206 0 -0.3081266848617317 100.0 Confident
|
|
|
3627 3626 Q16881 KVVYENAYGQFIGPHR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26235 (Experiment 1) 26235 51.346 490.239075 4+ 4+ 1956.9247469907903 0 1.2479344978831644 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 5.742056009221643) Phosphorylation of Y (8: 0.17512709613779498) 0 Y8-{Y4 Y8} 1 100.0 Doubtful
|
|
|
3628 3627 Q02790 MEKGEHSIVYLKPSYAFGSVGK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35191 (Experiment 1) 35191 61.741 627.558228 4+ 4+ 2506.1967479602404 0 2.8117679134396676 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 7.9188738538873675) Phosphorylation of Y (10: 68.760907504363) 0 Y10-{Y10 Y15} 1 100.0 Doubtful
|
|
|
3629 3628 P30101 GFPTIYFSPANK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45617 (Experiment 1) 45617 77.932 711.328918 2+ 2+ 1420.6428180709106 0 0.32684993225573905 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3630 3629 P62318 VLHEAEGHIVTCETNTGEVYR Phosphorylation of Y(20) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20262 (Experiment 1) 20262 43.856 832.038208 3+ 3+ 2493.0995531001104 0 -2.7076009179363076 Phosphorylation of Y (20: Very Confident) Phosphorylation of Y (20: 100.0) Phosphorylation of Y (20: 100.0) Y20 1 0 100.0 Confident
|
|
|
3631 3630 Q9UI08 INIYHNTASNTFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23173 (Experiment 1) 23173 47.651 815.871399 2+ 2+ 1629.7300699355208 0 -1.1183546244527673 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.73045822102425 Confident
|
|
|
3632 3631 P30101 YGVSGYPTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29019 (Experiment 1) 29019 54.599 542.787048 2+ 2+ 1083.5600608155903 0 -0.47693563191165755 100.0 Confident
|
|
|
3633 3632 P07910 VPPPPPIAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19355 (Experiment 1) 19355 42.731 472.290314 2+ 2+ 942.5650866263802 0 1.0464337304394309 99.1869918699187 Confident
|
|
|
3634 3633 Q02790 RGEAHLAVNDFELAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29439 (Experiment 1) 29439 55.08 425.223297 4+ 4+ 1696.8645160852006 0 -0.2551320335978008 100.0 Doubtful
|
|
|
3635 3634 P42704 TVLDQQQTPSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13723 (Experiment 1) 13723 34.83 636.831055 2+ 2+ 1271.6469783270302 0 0.45439022177496996 100.0 Confident
|
|
|
3636 3635 P62826 HLTGEFEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11457 (Experiment 1) 11457 31.261 480.742859 2+ 2+ 959.4712458111903 0 -0.08397920627868666 99.73045822102425 Confident
|
|
|
3637 3636 Q16851 LVEIAQVPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27644 (Experiment 1) 27644 52.989 498.808411 2+ 2+ 995.6015317047502 0 0.7391236340372399 99.7289972899729 Confident
|
|
|
3638 3637 P31943, P55795 DLNYCFSGMSDHR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31899 (Experiment 1) 31899 57.943 841.310913 2+ 2+ 1680.6061919453502 0 0.642522106632615 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
3639 3638 P31943, P55795 DLNYCFSGMSDHR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31846 (Experiment 1) 31846 57.881 561.210266 3+ 3+ 1680.6061919453502 0 1.6492088387100508 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3640 3639 P13639 KEDLYLKPIQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23099 (Experiment 1) 23099 47.566 494.928253 3+ 3+ 1481.7643301859202 0 -0.9432916296958698 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3641 3640 Q92979 TYELLNCDK Phosphorylation of Y(2) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26234 (Experiment 1) 26234 51.345 618.254272 2+ 2+ 1234.4941052318902 0 -0.09232892432975728 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82578397212544) Y2 1 0 99.73118279569893 Confident
|
|
|
3642 3641 P84103 AFGYYGPLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43878 (Experiment 1) 43878 73.925 562.25116 2+ 2+ 1122.4899462579701 0 -1.9379127391572948 Phosphorylation of Y (5: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (5: 26.375718522315385) 0 Y5-{Y4 Y5} 1 99.72826086956522 Confident
|
|
|
3643 3642 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23768 (Experiment 1) 23768 48.409 420.234863 3+ 3+ 1257.68296991293 0 -0.1668220555314557 99.28057553956835 Confident
|
|
|
3644 3643 P84098 LLADQAEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14011 (Experiment 1) 14011 35.304 493.767609 2+ 2+ 985.5192586327703 0 1.4241877992502625 99.73190348525469 Confident
|
|
|
3645 3644 Q14204 EYQTQLIQR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21962 (Experiment 1) 21962 46.179 629.794373 2+ 2+ 1257.5754667870801 0 -1.0112184793731698 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 99.73118279569893 Confident
|
|
|
3646 3645 E9PAV3, Q13765 SPASDTYIVFGEAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40283 (Experiment 1) 40283 68.152 782.850342 2+ 2+ 1563.6858050817007 0 0.2082037430929094 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3647 3646 Q96AE4 IQIAPDSGGLPER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28425 (Experiment 1) 28425 53.907 676.862427 2+ 2+ 1351.70957858359 0 0.533700160254993 99.7289972899729 Confident
|
|
|
3648 3647 Q01518 LSDLLAPISEQIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44640 (Experiment 1) 44640 75.758 713.910706 2+ 2+ 1425.8078956425304 0 -0.7259839313921059 100.0 Confident
|
|
|
3649 3648 Q9BVL2 TPPGLQHEYAAPADYFR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37007 (Experiment 1) 37007 63.938 671.968689 3+ 3+ 2011.8829417484606 1 -1.0218779199857786 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.269214828136036) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y9 Y15} 1 100.0 Confident
|
|
|
3650 3649 P01111, P01112, P01116, P61224, P62834 YDPTIEDSYRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18753 (Experiment 1) 18753 41.989 462.889069 3+ 3+ 1385.6463096206903 0 -0.6711618853750756 100.0 Confident
|
|
|
3651 3650 P62899 EMGTPDVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14269 (Experiment 1) 14269 35.694 452.714111 2+ 2+ 903.4120166829102 0 1.8249778847915326 96.24664879356568 Confident
|
|
|
3652 3651 P23246 AELDDTPMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19960 (Experiment 1) 19960 43.5 524.241577 2+ 2+ 1046.4702598350202 0 -1.5820626337610466 100.0 Confident
|
|
|
3653 3652 P28340 VSANSVYGFTGAQVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32546 (Experiment 1) 32546 58.683 832.887573 2+ 2+ 1663.7607013574602 0 -0.06500942077099682 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3654 3653 P62081 VETFSGVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24911 (Experiment 1) 24911 49.803 555.249695 2+ 2+ 1108.4841921711902 0 0.5807257220506211 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 98.86914378029078) Y8 1 0 99.7289972899729 Confident
|
|
|
3655 3654 O94903 DLPAIQPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25637 (Experiment 1) 25637 50.656 455.261536 2+ 2+ 908.5079656730802 0 0.6077755184773406 99.46380697050938 Confident
|
|
|
3656 3655 P37840 TKEQVTNVGGAVVTGVTAVAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35043 (Experiment 1) 35043 61.572 719.733276 3+ 3+ 2156.1800961187905 0 -0.9714326399049845 100.0 Confident
|
|
|
3657 3656 P11142, P54652 VQVEYKGETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9950 (Experiment 1) 9950 28.459 590.813599 2+ 2+ 1179.6135529404303 0 -0.76832469539783 100.0 Confident
|
|
|
3658 3657 P18615 SLYESFVSSSDR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37818 (Experiment 1) 37818 64.913 728.805542 2+ 2+ 1455.5919046968604 0 3.173949656381466 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.03069466882067) Y3 1 0 99.72826086956522 Confident
|
|
|
3659 3658 P63244 DVLSVAFSSDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41489 (Experiment 1) 41489 69.885 655.323242 2+ 2+ 1308.6309939097205 0 0.7150344025041726 92.73182957393485 Confident
|
|
|
3660 3659 P29401 TSRPENAIIYNNNEDFQVGQAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32271 (Experiment 1) 32271 58.364 863.730408 3+ 3+ 2587.17040954125 1 -1.6870483281071853 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3661 3660 P51610 LVIYGGMSGCR Phosphorylation of Y(4) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30314 (Experiment 1) 30314 56.094 646.780273 2+ 2+ 1291.5454296121 0 0.4355841889337802 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 70.92084006462036) Y4 1 0 91.37466307277629 Confident
|
|
|
3662 3661 P60709, P63261 VAPEEHPVLLTEAPLNPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33678 (Experiment 1) 33678 59.975 652.027283 3+ 3+ 1953.0571274518006 0 1.4785434673654096 100.0 Confident
|
|
|
3663 3662 P68104, Q5VTE0 YYVTIIDAPGHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31521 (Experiment 1) 31521 57.495 468.913727 3+ 3+ 1403.71974934447 0 -0.28274198476401585 100.0 Confident
|
|
|
3664 3663 P07900 DNSTMGYMAAK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20439 (Experiment 1) 20439 44.061 634.739197 2+ 2+ 1267.4614252046204 0 1.9030385742496339 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3665 3664 P04406 VVDLMAHMASK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27633 (Experiment 1) 27633 52.976 401.20694 3+ 3+ 1200.5995001827605 0 -0.42337501336910593 100.0 Confident
|
|
|
3666 3665 P33991 DYIAYAHSTIMPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35036 (Experiment 1) 35036 61.566 539.908569 3+ 3+ 1616.7058293336302 0 -1.2049766857857163 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 10.453282433761643) Phosphorylation of Y (5: 0.17452006980802792) 0 Y5-{Y2 Y5} 1 100.0 Confident
|
|
|
3667 3666 ALDOA_RABIT, P04075 ALQASALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14490 (Experiment 1) 14490 36.041 401.244232 2+ 2+ 800.4756029156401 0 -2.1082492435609472 98.94179894179894 Confident
|
|
|
3668 3667 P23284 VIFGLFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46656 (Experiment 1) 46656 79.811 440.767914 2+ 2+ 879.5218248320703 0 -0.6236449317326858 99.21875 Confident
|
|
|
3669 3668 P09874 KPPLLNNADSVQAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17155 (Experiment 1) 17155 39.8 498.946198 3+ 3+ 1493.8201916617304 0 -2.289528299103212 100.0 Confident
|
|
|
3670 3669 Q02543 DLTTAGAVTQCYR Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27745 (Experiment 1) 27745 53.109 728.3479 2+ 2+ 1454.6823778595804 0 -0.7762721130486676 99.45945945945947 Confident
|
|
|
3671 3670 P07900, P08238, Q58FF6, Q58FF7 EDQTEYLEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21737 (Experiment 1) 21737 45.866 656.287781 2+ 2+ 1310.5626395663803 0 -1.2422126590217542 100.0 Confident
|
|
|
3672 3671 P16401 ATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32451 (Experiment 1) 32451 58.572 606.845642 2+ 2+ 1211.6761531969903 0 0.47612573997055263 100.0 Confident
|
|
|
3673 3672 P60709, P63261 KDLYANTVLSGGTTMYPGIADR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41442 (Experiment 1) 41442 69.814 808.382446 3+ 3+ 2422.1239769428003 0 0.6315730622869278 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 17.042304452848985) Phosphorylation of Y (4: 80.87342413258644) 0 Y4-{Y4 Y16} 1 100.0 Confident
|
|
|
3674 3673 Q14240 DQIYEIFQK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43281 (Experiment 1) 43281 72.94 632.287476 2+ 2+ 1262.5584197406104 0 1.5652127700049279 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 86.59127625201938) Y4 1 0 97.86096256684492 Confident
|
|
|
3675 3674 P67809 RPQYSNPPVQGEVMEGADNQGAGEQGRPVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20445 (Experiment 1) 20445 44.067 826.878662 4+ 4+ 3302.4888006228407 1 -2.000088333483961 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Doubtful
|
|
|
3676 3675 P62277 GLSQSALPYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25461 (Experiment 1) 25461 50.45 546.295715 2+ 2+ 1090.57710786206 0 -0.2112369081291732 100.0 Confident
|
|
|
3677 3676 Q13263 IVAERPGTNSTGPAPMAPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19054 (Experiment 1) 19054 42.356 673.687073 3+ 3+ 2018.0367434437303 0 1.309292006334516 100.0 Confident
|
|
|
3678 3677 P63104 GIVDQSQQAYQEAFEISKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40939 (Experiment 1) 40939 69.086 723.700012 3+ 3+ 2168.0749623439106 0 1.4942934214145345 100.0 Confident
|
|
|
3679 3678 P33316 TDIQIALPSGCYGR Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39105 (Experiment 1) 39105 66.491 775.885071 2+ 2+ 1549.75587715301 0 -0.18565029241090664 99.7289972899729 Confident
|
|
|
3680 3679 P11142 SFYPEEVSSMVLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45071 (Experiment 1) 45071 76.73 808.898499 2+ 2+ 1615.7803605653505 0 1.2884828651468572 100.0 Confident
|
|
|
3681 3680 P04406 RVIISAPSADAPMFVMGVNHEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38517 (Experiment 1) 38517 65.773 790.410828 3+ 3+ 2368.20315714583 0 3.161848317352973 97.76119402985076 Confident
|
|
|
3682 3681 P04406 VPTANVSVVDLTCR Carbamidomethylation of C(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36149 (Experiment 1) 36149 62.914 765.901123 2+ 2+ 1529.7871772812903 0 0.3367179154978354 100.0 Confident
|
|
|
3683 3682 P05204, Q15651 LSAKPAPPKPEPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7634 (Experiment 1) 7634 23.748 453.937927 3+ 3+ 1358.7921860087404 0 -0.17213009537656954 100.0 Confident
|
|
|
3684 3683 P61978 VVLIGGKPDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16041 (Experiment 1) 16041 38.396 527.324585 2+ 2+ 1052.63422881536 0 0.3681329959428505 96.48648648648648 Confident
|
|
|
3685 3684 Q9BZZ5 PTVEELYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27073 (Experiment 1) 27073 52.311 503.762665 2+ 2+ 1005.5131106231702 0 -2.3161218083125936 99.73753280839895 Confident
|
|
|
3686 3685 Q13283 FYVHNDIFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33214 (Experiment 1) 33214 59.44 404.204895 3+ 3+ 1209.5930922793702 0 -0.1951813406984206 100.0 Confident
|
|
|
3687 3686 Q9Y2W1 WEGLVYAPPGK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40182 (Experiment 1) 40182 67.989 648.803894 2+ 2+ 1295.5951396025002 0 -1.4677264938077796 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 96.50959860383944) Y6 1 0 99.21052631578947 Confident
|
|
|
3688 3687 Q13200 LNILDTLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43366 (Experiment 1) 43366 73.078 508.803314 2+ 2+ 1015.5913609438703 0 0.7017672519691946 96.2059620596206 Confident
|
|
|
3689 3688 P31939 TLTPISAAYAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29730 (Experiment 1) 29730 55.416 582.324951 2+ 2+ 1162.6346227381803 0 0.6236454812906694 100.0 Confident
|
|
|
3690 3689 P36578 KLDELYGTWR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33924 (Experiment 1) 33924 60.261 680.81842 2+ 2+ 1359.6224169795003 0 -0.09540951617873837 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3691 3690 GSTP1_HUMAN, P09211 PPYTVVYFPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43842 (Experiment 1) 43842 73.858 669.366638 2+ 2+ 1336.7179584393202 0 0.571157456074267 97.289972899729 Confident
|
|
|
3692 3691 P23284 TVDNFVALATGEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42487 (Experiment 1) 42487 71.467 682.857178 2+ 2+ 1363.6983451935505 0 1.067481186794047 100.0 Confident
|
|
|
3693 3692 Q9NRZ9 EVVVYAPLSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31863 (Experiment 1) 31863 57.902 592.802307 2+ 2+ 1183.5889915929004 0 0.9020498298263064 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3694 3693 P16989, P67809, Q9Y2T7 NGYGFINR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26326 (Experiment 1) 26326 51.45 470.735382 2+ 2+ 939.4562644533903 0 -0.056705968156238136 99.73474801061008 Confident
|
|
|
3695 3694 P38919 GFKEQIYDVYR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34777 (Experiment 1) 34777 61.26 499.89679 3+ 3+ 1496.6700954479102 0 -1.0367785011791733 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 5.668272110935822) Phosphorylation of Y (7: 99.82547993019197) 0 Y10-{Y7 Y10} 1 99.28057553956835 Confident
|
|
|
3696 3695 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13321 (Experiment 1) 13321 34.19 600.786926 2+ 2+ 1199.5587540937802 0 0.45354918628356355 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3697 3696 P61604 GKGGEIQPVSVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12114 (Experiment 1) 12114 32.297 599.843201 2+ 2+ 1197.6717365228903 0 0.0938107624849624 96.7479674796748 Confident
|
|
|
3698 3697 Q01130 VDNLTYRTSPDTLRR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20501 (Experiment 1) 20501 44.131 629.6427 3+ 3+ 1885.9047398222 0 0.8103953794237182 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.47643979057592) Y6 1 0 99.24812030075188 Confident
|
|
|
3699 3698 Q15233 AGEVFIHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14178 (Experiment 1) 14178 35.57 450.750793 2+ 2+ 899.4865019525103 0 0.5891439204932306 92.41192411924119 Confident
|
|
|
3700 3699 Q9NUU7, Q9UMR2 QYYVLCSSR Phosphorylation of Y(2) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27981 (Experiment 1) 27981 53.38 628.262817 2+ 2+ 1254.5104240023702 0 0.5229215636750882 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 2.4432809773123907) 0 Y2-{Y2 Y3} 1 100.0 Confident
|
|
|
3701 3700 Q15631 KVEEVVYDLSIR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39708 (Experiment 1) 39708 67.334 765.385132 2+ 2+ 1528.75382507187 0 1.2320573986594936 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3702 3701 P07437 ISVYYNEATGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24388 (Experiment 1) 24388 49.196 651.321777 2+ 2+ 1300.6299312805602 0 -0.7140967436694845 100.0 Confident
|
|
|
3703 3702 P39748 LIADVAPSAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31000 (Experiment 1) 31000 56.885 563.335266 2+ 2+ 1124.6553581827602 0 0.5510785453773286 99.73333333333333 Confident
|
|
|
3704 3703 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13480 (Experiment 1) 13480 34.445 600.786621 2+ 2+ 1199.5587540937802 0 -0.05411854941256697 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3705 3704 Q00839 MCLFAGFQR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44051 (Experiment 1) 44051 74.245 565.267456 2+ 2+ 1128.5208559392402 0 -0.4395022573666039 99.7289972899729 Confident
|
|
|
3706 3705 Q9UKY7 LQLDNQYAVLENQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34537 (Experiment 1) 34537 60.986 878.419434 2+ 2+ 1754.8240298900107 0 0.16232360103211707 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3707 3706 P46781 IGVLDEGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21215 (Experiment 1) 21215 45.022 415.734558 2+ 2+ 829.4545331178902 0 0.03601876055211476 100.0 Confident
|
|
|
3708 3707 P23528 KAVLFCLSEDKK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23331 (Experiment 1) 23331 47.852 479.930511 3+ 3+ 1436.7697363120003 0 -0.02272025830599559 100.0 Confident
|
|
|
3709 3708 P62081 HVVFIAQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17256 (Experiment 1) 17256 39.949 485.285126 2+ 2+ 968.5555845718402 0 0.11796626687786012 94.87870619946092 Confident
|
|
|
3710 3709 O15143 NAYVWTLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38193 (Experiment 1) 38193 65.372 497.770813 2+ 2+ 993.5283667644903 0 -1.299490045781242 96.24664879356568 Confident
|
|
|
3711 3710 P18077 NNTVTPGGKPNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4664 (Experiment 1) 4664 17.41 613.829224 2+ 2+ 1225.6414990237702 0 1.951721413971088 99.45652173913044 Confident
|
|
|
3712 3711 P78527 SIGEYDVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33219 (Experiment 1) 33219 59.447 526.273621 2+ 2+ 1050.5345743437401 0 -1.7911537954126209 99.7289972899729 Confident
|
|
|
3713 3712 P51571 VQNMALYADVGGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31286 (Experiment 1) 31286 57.22 723.327942 2+ 2+ 1444.6421664479103 0 -0.5774566441723994 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3714 3713 P62191, P62195, Q8NB90 GVLLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34106 (Experiment 1) 34106 60.482 619.812744 2+ 2+ 1237.6107896666401 0 0.11729329066823704 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.86914378029078) Y5 1 0 99.73190348525469 Confident
|
|
|
3715 3714 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29686 (Experiment 1) 29686 55.365 609.260315 2+ 2+ 1216.5053215385904 0 0.6200373102765451 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.33452891645359) Phosphorylation of Y (8: 3.4904013961605584) 0 Y8-{Y3 Y6 Y8} 1 99.7289972899729 Confident
|
|
|
3716 3715 P07900 RAPFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39830 (Experiment 1) 39830 67.498 422.218933 3+ 3+ 1263.6360197205104 0 -0.8290486236467527 100.0 Confident
|
|
|
3717 3716 P00519 AGSGAPGGTSKGPAEESR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6072 (Experiment 1) 6072 20.239 539.259827 3+ 3+ 1614.7597762331402 0 -1.31330061417066 100.0 Confident
|
|
|
3718 3717 P38919 ELAVQIQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21374 (Experiment 1) 21374 45.259 464.776611 2+ 2+ 927.5389314481902 0 -0.28226650589813496 98.91304347826086 Confident
|
|
|
3719 3718 O00299 YLSNAYAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16472 (Experiment 1) 16472 38.925 479.243805 2+ 2+ 956.4715801643601 0 1.5408694658715354 100.0 Confident
|
|
|
3720 3719 P78347 SPSWYGIPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38194 (Experiment 1) 38194 65.373 571.755005 2+ 2+ 1141.4957599144 0 -0.26484065840559723 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.73262032085562 Confident
|
|
|
3721 3720 P26373 LATQLTGPVMPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35553 (Experiment 1) 35553 62.16 691.895203 2+ 2+ 1381.7751560456102 0 0.5037042559523841 92.93478260869566 Confident
|
|
|
3722 3721 O15042 KPGQSFQEQVEHYR Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20110 (Experiment 1) 20110 43.682 604.941162 3+ 3+ 1811.7992121245006 0 1.3469510255971877 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 90.14539579967689) Y13 1 0 96.2406015037594 Confident
|
|
|
3723 3722 P06748 VDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17150 (Experiment 1) 17150 39.793 784.867371 2+ 2+ 1567.7226624484301 0 -1.5756663153169361 96.22641509433963 Confident
|
|
|
3724 3723 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30412 (Experiment 1) 30412 56.205 528.263245 2+ 2+ 1054.5100129962104 0 1.8211314979635536 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 99.73190348525469 Confident
|
|
|
3725 3724 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20500 (Experiment 1) 20500 44.13 713.290833 2+ 2+ 1424.5666150733405 0 0.3490814589397616 Phosphorylation of Y (4: Doubtfull, 9: Doubtfull) Phosphorylation of Y (4: 51.169289697222375, 9: 31.82552504038772) 0 Y4-{Y4}, Y9-{Y9} 2 99.73890339425587 Confident
|
|
|
3726 3725 O76021 KKVPVSVNLLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20441 (Experiment 1) 20441 44.063 437.950653 3+ 3+ 1310.8285715174604 0 1.185890039229302 99.43181818181817 Confident
|
|
|
3727 3726 P51659 IIMTSSASGIYGNFGQANYSAAK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40186 (Experiment 1) 40186 67.993 811.038757 3+ 3+ 2430.092676814521 0 0.7253193544034502 Phosphorylation of Y (11: Random) Phosphorylation of Y (11: 0.0, 19: 0.0) Phosphorylation of Y (11: 99.82547993019197) 0 Y11-{Y11 Y19} 1 99.28057553956835 Confident
|
|
|
3728 3727 Q13356 HYYDGTIFHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23764 (Experiment 1) 23764 48.402 463.530396 3+ 3+ 1387.5710501129804 0 -1.2163972945499657 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 3: 0.0) Phosphorylation of Y (2: 6.457242582897034) 0 Y2-{Y2 Y3} 1 99.24812030075188 Confident
|
|
|
3729 3728 P48047 LVRPPVQVYGIEGR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33583 (Experiment 1) 33583 59.866 554.962891 3+ 3+ 1661.8654412095202 0 0.8423333330683915 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3730 3729 Q14697 SGGMERPFVLAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28108 (Experiment 1) 28108 53.526 440.568848 3+ 3+ 1318.6815900139402 0 2.364059574926566 100.0 Confident
|
|
|
3731 3730 P08621 EFEVYGPIKR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29685 (Experiment 1) 29685 55.363 439.879395 3+ 3+ 1316.6166033230702 0 -0.18772074234674704 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3732 3731 P62424 MGVPYCIIK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37821 (Experiment 1) 37821 64.916 540.783142 2+ 2+ 1079.55075908519 0 0.8986800658118649 99.46091644204851 Confident
|
|
|
3733 3732 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHRK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12375 (Experiment 1) 12375 32.756 575.592896 3+ 3+ 1723.7566786061805 0 0.10423652067658214 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3734 3733 Q08170, Q13243, Q13247 LIVENLSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27122 (Experiment 1) 27122 52.367 515.798462 2+ 2+ 1029.58185888933 0 0.4964897510798244 99.73333333333333 Confident
|
|
|
3735 3734 P11021 SDIDEIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41540 (Experiment 1) 41540 69.97 730.884033 2+ 2+ 1459.7518373183902 0 1.1463856310252667 99.46091644204851 Confident
|
|
|
3736 3735 A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536 IIPGFMCQGGDFTR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42409 (Experiment 1) 42409 71.353 799.876709 2+ 2+ 1597.73811891389 0 0.4664174024822893 100.0 Confident
|
|
|
3737 3736 P31930 ADLTEYLSTHYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35120 (Experiment 1) 35120 61.66 760.837341 2+ 2+ 1519.6595903338603 0 0.35403934414112614 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 11: 0.0) Phosphorylation of Y (6: 84.99127399650959) 0 Y6-{Y6 Y11} 1 95.16129032258065 Confident
|
|
|
3738 3737 P49327 LQVVDQPLPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32871 (Experiment 1) 32871 59.051 632.374878 2+ 2+ 1262.7346711326202 0 0.42058436999868376 100.0 Confident
|
|
|
3739 3738 P07814 VAVQGDVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15106 (Experiment 1) 15106 37.015 471.772369 2+ 2+ 941.5294293936502 0 0.8008876534919547 92.63157894736842 Confident
|
|
|
3740 3739 Q969Q0 GKDSLYAQGR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8898 (Experiment 1) 8898 26.444 587.766418 2+ 2+ 1173.5179519109602 0 0.28170672815446807 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
3741 3740 P08238, Q58FF7 EQVANSAFVER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20717 (Experiment 1) 20717 44.377 625.313049 2+ 2+ 1248.6098645423203 0 1.3437479965926438 100.0 Confident
|
|
|
3742 3741 P54725, P54727 DAFPVAGQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19950 (Experiment 1) 19950 43.487 466.746033 2+ 2+ 931.4763311916302 0 1.266080650654003 99.19354838709677 Confident
|
|
|
3743 3742 P06753, P09493 MELQEIQLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36715 (Experiment 1) 36715 63.585 566.307983 2+ 2+ 1130.6005457285803 0 0.7657833598105006 99.45799457994579 Confident
|
|
|
3744 3743 P06748 VDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17301 (Experiment 1) 17301 40.015 523.581421 3+ 3+ 1567.7226624484301 0 -0.14569452096594251 100.0 Confident
|
|
|
3745 3744 P13639 YFDPANGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17908 (Experiment 1) 17908 40.821 456.215973 2+ 2+ 910.4184819623401 0 -1.193398224715869 100.0 Confident
|
|
|
3746 3745 P10809 APGFGDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12065 (Experiment 1) 12065 32.216 417.199036 2+ 2+ 832.3827651599602 0 0.9035340832457126 99.46666666666667 Confident
|
|
|
3747 3746 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21293 (Experiment 1) 21293 45.14 759.857849 2+ 2+ 1517.7014551458406 0 -0.2040377696074536 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3748 3747 Q13242 DAEDAIYGR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18849 (Experiment 1) 18849 42.107 545.216187 2+ 2+ 1088.4175691633502 0 0.23101211026654875 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
3749 3748 Q9Y2W1 SGKWEGLVYAPPGK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33133 (Experiment 1) 33133 59.349 523.588562 3+ 3+ 1567.7435947413403 0 0.1667074025625872 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
3750 3749 P49736 VAVGELTDEDVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26965 (Experiment 1) 26965 52.187 637.827454 2+ 2+ 1273.6401616110904 0 0.1516517621833142 92.44791666666666 Confident
|
|
|
3751 3750 P20700 ALYETELADAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30448 (Experiment 1) 30448 56.245 626.314087 2+ 2+ 1250.6142812164203 0 -0.5270116945246263 100.0 Confident
|
|
|
3752 3751 O00139 GIYALAAR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27911 (Experiment 1) 27911 53.3 457.728027 2+ 2+ 913.4422677895602 0 -0.8375306915477497 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 99.73474801061008 Confident
|
|
|
3753 3752 Q9BZ11 KYLELYIVADHTLFLTRHR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33374 (Experiment 1) 33374 59.626 617.824341 2+ 4+ 2467.27771559261 0 -3.8269063866302586 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.249656530390226) Phosphorylation of Y (2: 99.67689822294022) 0 Y2-{Y2 Y6} 1 100.0 Doubtful
|
|
|
3754 3753 P62316 NNTQVLINCR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19861 (Experiment 1) 19861 43.366 616.31311 2+ 2+ 1230.6139043769401 0 -1.8150729450548422 100.0 Confident
|
|
|
3755 3754 P17844 TGTAYTFFTPNNIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42568 (Experiment 1) 42568 71.639 827.879761 2+ 2+ 1653.7439886641603 0 0.5921166589301159 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.72826086956522 Confident
|
|
|
3756 3755 P14625 IYFMAGSSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34174 (Experiment 1) 34174 60.561 556.235229 2+ 2+ 1110.4569318775302 0 -0.9229999765210066 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3757 3756 O95757, Q92598 DISTTLNADEAVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33512 (Experiment 1) 33512 59.787 738.370361 2+ 2+ 1474.7263508465403 0 -0.12309550305943244 99.45945945945947 Confident
|
|
|
3758 3757 P27797 IDDPTDSKPEDWDKPEHIPDPDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27072 (Experiment 1) 27072 52.31 690.820923 4+ 4+ 2759.256233732661 0 -0.5962467521933305 100.0 Doubtful
|
|
|
3759 3758 P28062 KGPGLYYVDEHGTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18446 (Experiment 1) 18446 41.598 531.267212 3+ 3+ 1590.7790551257403 0 0.4714979335749956 92.14285714285715 Doubtful
|
|
|
3760 3759 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22980 (Experiment 1) 22980 47.421 673.307495 2+ 2+ 1344.6002845525904 0 0.11325716990921555 Phosphorylation of Y (7: Random) Phosphorylation of Y (7: 0.0, 9: 0.0) Phosphorylation of Y (7: 79.73431455106848) 0 Y9-{Y4 Y7 Y9} 1 98.91891891891892 Confident
|
|
|
3761 3760 Q14165 FAEVYFAQSQQK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36391 (Experiment 1) 36391 63.206 763.340637 2+ 2+ 1524.6650100674706 0 1.1207321737812854 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.67689822294022) Y5 1 0 100.0 Confident
|
|
|
3762 3761 P05141 QIFLGGVDKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23760 (Experiment 1) 23760 48.398 566.82782 2+ 2+ 1131.6400424717901 0 0.9214399076210349 99.7289972899729 Confident
|
|
|
3763 3762 P14866 IEYAKPTR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7790 (Experiment 1) 7790 24.044 529.25824 2+ 2+ 1056.5005109416702 0 1.3378408621524975 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 98.77835951134381) Y3 1 0 99.73890339425587 Confident
|
|
|
3764 3763 P59998 AENFFILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44059 (Experiment 1) 44059 74.258 505.2771 2+ 2+ 1008.53926580136 0 0.377283237233275 99.7289972899729 Confident
|
|
|
3765 3764 Q92608 DQPDYAMYSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22737 (Experiment 1) 22737 47.134 663.248291 2+ 2+ 1324.4795177969102 0 1.8931629783331427 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 8: 0.0) Phosphorylation of Y (5: 1.1308562197092082) 0 Y5-{Y5 Y8} 1 100.0 Confident
|
|
|
3766 3765 Q08945 LFDFVNAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40855 (Experiment 1) 40855 68.962 477.257507 2+ 2+ 952.5018176634803 0 -1.4212402700251066 100.0 Confident
|
|
|
3767 3766 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44362 (Experiment 1) 44362 75.046 612.980896 3+ 3+ 1835.9222873793005 0 -0.7769565825334487 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
3768 3767 P14868 NNAYLAQSPQLYK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30537 (Experiment 1) 30537 56.348 795.874084 2+ 2+ 1588.7286729531904 1 0.9978199872788209 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 17.173160207314368) Phosphorylation of Y (12: 100.0) 0 Y12-{Y4 Y12} 1 100.0 Confident
|
|
|
3769 3768 P49368 AMTGVEQWPYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35558 (Experiment 1) 35558 62.165 669.319458 2+ 2+ 1336.6234064314801 0 0.7146330261562833 100.0 Confident
|
|
|
3770 3769 P11586 TPVPSDIDISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28094 (Experiment 1) 28094 53.509 600.317322 2+ 2+ 1198.6193665968601 0 0.6034058374764454 100.0 Confident
|
|
|
3771 3770 P11586 TDTESELDLISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 36977 (Experiment 1) 36977 63.9 689.839661 2+ 2+ 1377.6623536076502 0 1.7507423036394343 99.74811083123426 Confident
|
|
|
3772 3771 Q02878 YYPTEDVPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22892 (Experiment 1) 22892 47.314 570.271729 2+ 2+ 1138.5294889633 0 -0.5119459684832731 100.0 Confident
|
|
|
3773 3772 Q99497 VTTHPLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6240 (Experiment 1) 6240 20.569 433.758331 2+ 2+ 865.5021520166504 0 -0.049509449266754386 92.63157894736842 Confident
|
|
|
3774 3773 O14602, P47813 EDGQEYAQVIK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21565 (Experiment 1) 21565 45.579 680.295471 2+ 2+ 1358.5755263567305 0 0.6340702159457344 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
3775 3774 P31949 DGYNYTLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23367 (Experiment 1) 23367 47.896 530.751343 2+ 2+ 1059.4872897981504 0 0.7944105149271261 100.0 Confident
|
|
|
3776 3775 P62241 IIDVVYNASNNELVR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41445 (Experiment 1) 41445 69.819 600.296021 3+ 3+ 1797.8662290551604 0 0.0025234236454407893 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3777 3776 P52565 AEEYEFLTPVEEAPK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42807 (Experiment 1) 42807 72.089 916.404114 2+ 2+ 1830.7964777294908 0 -1.529160981653959 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3778 3777 P23193 LLDGPSTEKDLDEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20358 (Experiment 1) 20358 43.961 520.598938 3+ 3+ 1558.7726323326203 0 1.506130928956847 92.46575342465754 Doubtful
|
|
|
3779 3778 P80303 ELDLVSHHVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17426 (Experiment 1) 17426 40.191 402.217865 3+ 3+ 1203.6360197205104 0 -3.5255403588265017 100.0 Confident
|
|
|
3780 3779 Q9NR30 STYEQVDLIGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32972 (Experiment 1) 32972 59.163 666.806641 2+ 2+ 1331.6010128285802 0 -1.712459169623835 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
3781 3780 P62873, P62879 IYAMHWGTDSR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30826 (Experiment 1) 30826 56.681 708.791809 2+ 2+ 1415.5693358608203 0 -0.19102534013858014 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
3782 3781 Q9NV31 LYALGLVPTR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44246 (Experiment 1) 44246 74.709 591.817871 2+ 2+ 1181.6209604275202 0 0.19316660659419316 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.65095986038395) Y2 1 0 100.0 Confident
|
|
|
3783 3782 P35579, P35580, P35749, Q7Z406 KFDQLLAEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25111 (Experiment 1) 25111 50.038 610.82959 2+ 2+ 1219.6448530687105 0 -0.18499618915603042 99.1869918699187 Confident
|
|
|
3784 3783 O60361, P22392 SCAHDWVYE Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28660 (Experiment 1) 28660 54.181 583.731323 2+ 2+ 1165.4498587436103 0 -1.5124034761621603 97.59358288770053 Confident
|
|
|
3785 3784 Q15233 AAPGAEFAPNKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13481 (Experiment 1) 13481 34.448 614.823181 2+ 2+ 1227.6360197205101 0 -3.424268835374594 99.21052631578947 Confident
|
|
|
3786 3785 P53621 GHYNNVSCAVFHPR Phosphorylation of Y(3) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20788 (Experiment 1) 20788 44.46 579.914917 3+ 3+ 1736.7242733624303 0 -0.776988587170072 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3787 3786 P26599 VLFSSNGGVVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27982 (Experiment 1) 27982 53.381 553.812683 2+ 2+ 1105.6131590176103 0 -2.1179961544494357 92.7807486631016 Confident
|
|
|
3788 3787 Q16698 FNVIQPGPIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33303 (Experiment 1) 33303 59.543 556.826111 2+ 2+ 1111.63897984263 0 -1.1770054291645062 99.45945945945947 Confident
|
|
|
3789 3788 P23193 DTYVSSFPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29259 (Experiment 1) 29259 54.872 536.258728 2+ 2+ 1070.5032742154601 0 -0.3460540000693586 99.7289972899729 Confident
|
|
|
3790 3789 A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65 LDHKFDLMYAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27675 (Experiment 1) 27675 53.025 460.903992 3+ 3+ 1379.6907577153104 0 -0.4419687446798827 100.0 Confident
|
|
|
3791 3790 P23528, Q9Y281 YALYDATYETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31127 (Experiment 1) 31127 57.035 669.316345 2+ 2+ 1336.6186978905205 0 -0.41895279709225886 100.0 Confident
|
|
|
3792 3791 O00567 VVSLSEYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22257 (Experiment 1) 22257 46.553 516.743042 2+ 2+ 1031.4688764602201 0 2.5686005988106073 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3793 3792 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 KESYSIYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24786 (Experiment 1) 24786 49.659 680.31543 2+ 2+ 1358.6159346167303 0 0.27373313248418457 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 23.31525159244004) Phosphorylation of Y (4: 0.16142060555526605) 0 Y4-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3794 3793 P00505 IAAAILNTPDLRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30018 (Experiment 1) 30018 55.751 465.948975 3+ 3+ 1394.8245487661802 0 0.3911970531588822 99.24812030075188 Confident
|
|
|
3795 3794 P52272 GGNRFEPYANPTKR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14413 (Experiment 1) 14413 35.924 562.929993 3+ 3+ 1685.7675180734002 0 0.3739520057135596 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3796 3795 P47756 DYLLCDYNR Phosphorylation of Y(2) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37254 (Experiment 1) 37254 64.228 656.256836 2+ 2+ 1310.5002532414903 0 -0.8641236724294259 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 21.720648822875955) Phosphorylation of Y (2: 99.19224555735056) 0 Y2-{Y2 Y7} 1 99.73544973544973 Confident
|
|
|
3797 3796 Q02790 GEHSIVYLKPSYAFGSVGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38849 (Experiment 1) 38849 66.177 530.511475 4+ 4+ 2118.0187069452804 0 -0.9013993544797039 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 4.363113485639207) Phosphorylation of Y (7: 0.16155088852988692) 0 Y7-{Y7 Y12} 1 100.0 Doubtful
|
|
|
3798 3797 P26373 GFSLEELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39884 (Experiment 1) 39884 67.574 475.751129 2+ 2+ 949.48689587533 0 0.850435957913016 99.7289972899729 Confident
|
|
|
3799 3798 P27797 IKDPDASKPEDWDER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17732 (Experiment 1) 17732 40.596 450.965729 4+ 4+ 1799.8326068202302 0 0.6670758147783964 100.0 Doubtful
|
|
|
3800 3799 P06748 ADKDYHFKVDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23415 (Experiment 1) 23415 47.956 515.645691 5+ 5+ 2572.1942426127903 1 -2.143690438899541 100.0 Doubtful
|
|
|
3801 3800 P19338 NDLAVVDVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28506 (Experiment 1) 28506 54.003 500.775879 2+ 2+ 999.5349086969102 0 2.29281683414253 100.0 Confident
|
|
|
3802 3801 P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3 TIGGGDDSFNTFFSETGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45537 (Experiment 1) 45537 77.745 1004.452087 2+ 2+ 2006.8857645919009 0 1.9196942931269623 100.0 Confident
|
|
|
3803 3802 P05141, P12235, P12236, Q9H0C2 TAVAPIER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13632 (Experiment 1) 13632 34.694 428.74646 2+ 2+ 855.4814165720702 0 -3.5562915775003168 99.72972972972973 Confident
|
|
|
3804 3803 Q9Y230 LLIVSTTPYSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35128 (Experiment 1) 35128 61.669 675.878357 2+ 2+ 1349.7442327568103 0 -1.5325888437403483 100.0 Confident
|
|
|
3805 3804 Q5JVS0, Q8NC51 EMTLDEWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36490 (Experiment 1) 36490 63.322 526.241821 2+ 2+ 1050.4691972058602 0 -0.10274693967287574 99.1869918699187 Confident
|
|
|
3806 3805 P00338, Q6ZMR3, Q9BYZ2 LVIITAGAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27676 (Experiment 1) 27676 53.026 457.294159 2+ 2+ 912.5756513100803 0 -2.0623922008810287 100.0 Confident
|
|
|
3807 3806 P28702 VYASLETYCK Phosphorylation of Y(2) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28142 (Experiment 1) 28142 53.57 657.276855 2+ 2+ 1312.5410554243103 0 -1.4441062230527588 Phosphorylation of Y (2: Random) Phosphorylation of Y (2: 0.0, 8: 0.0) Phosphorylation of Y (2: 96.50959860383944) 0 Y2-{Y2 Y8} 1 98.94179894179894 Confident
|
|
|
3808 3807 Q9NSD9 ASEGPAFFPGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32786 (Experiment 1) 32786 58.956 568.27887 2+ 2+ 1134.54580773378 0 -2.3057881437157164 100.0 Confident
|
|
|
3809 3808 O75368 GDYDAFFEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41273 (Experiment 1) 41273 69.561 595.758911 2+ 2+ 1189.5040024914504 0 -0.6155381056776742 100.0 Confident
|
|
|
3810 3809 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17731 (Experiment 1) 17731 40.594 798.838745 2+ 2+ 1595.6617155921804 0 0.764531726220561 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3811 3810 P78527 LSFAVPFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43969 (Experiment 1) 43969 74.081 468.769928 2+ 2+ 935.5228874612301 0 2.576542591159546 99.7289972899729 Confident
|
|
|
3812 3811 Q9P258 GNLYSFGCPEYGQLGHNSDGK Phosphorylation of Y(11) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35762 (Experiment 1) 35762 62.42 793.9953 3+ 3+ 2378.9627252741298 0 0.5647918377632982 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 15.830096148044477) Phosphorylation of Y (11: 0.0) 0 Y11-{Y4 Y11} 1 100.0 Confident
|
|
|
3813 3812 O43930, P49137, P51817, Q16644, Q96PN8 LTDFGFAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34532 (Experiment 1) 34532 60.981 449.737183 2+ 2+ 897.4596184983302 0 0.2163130994670489 96.19565217391303 Confident
|
|
|
3814 3813 O00299 GVTFNVTTVDTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32025 (Experiment 1) 32025 58.086 641.339722 2+ 2+ 1280.6612314088404 0 2.85314307809447 100.0 Confident
|
|
|
3815 3814 Q12905 ILITTVPPNLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38328 (Experiment 1) 38328 65.545 618.887329 2+ 2+ 1235.7601576044701 0 -0.04244560320732722 94.9468085106383 Confident
|
|
|
3816 3815 P49207 SACGVCPGR Carbamidomethylation of C(3, 6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7638 (Experiment 1) 7638 23.753 482.209229 2+ 2+ 962.40622010982 0 -2.4004495844637277 100.0 Confident
|
|
|
3817 3816 O43809 TVEGVLIVHEHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20025 (Experiment 1) 20025 43.579 463.928497 3+ 3+ 1387.7571974823504 1 2.2356386985636134 92.71523178807946 Doubtful
|
|
|
3818 3817 P11142, P54652 STAGDTHLGGEDFDNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18795 (Experiment 1) 18795 42.043 564.581238 3+ 3+ 1690.7183053439803 0 2.113225937282834 99.37888198757764 Confident
|
|
|
3819 3818 O14980 AVGHPFVIQLGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34533 (Experiment 1) 34533 60.982 431.919342 3+ 3+ 1292.73533983896 0 0.6612046023900234 100.0 Confident
|
|
|
3820 3819 P13796 VYALPEDLVEVNPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45072 (Experiment 1) 45072 76.733 833.411194 2+ 2+ 1664.8062545675507 0 0.9482116002470222 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 100.0 Confident
|
|
|
3821 3820 P62158 DGNGYISAAELR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31557 (Experiment 1) 31557 57.541 673.292603 3+ 2+ 1344.5711096826303 0 -0.3390918730034308 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.38449111470113) Y5 1 0 98.91304347826086 Confident
|
|
|
3822 3821 P50990 HFSGLEEAVYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27827 (Experiment 1) 27827 53.204 436.55072 3+ 3+ 1306.6305999869005 0 -0.20569376302781703 100.0 Confident
|
|
|
3823 3822 Q9BZZ5 PTVEELYR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25218 (Experiment 1) 25218 50.163 543.748047 2+ 2+ 1085.4794411439202 0 1.930973841844936 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 85.51483420593368) Y7 1 0 96.48648648648648 Confident
|
|
|
3824 3823 P62269 YSQVLANGLDNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25376 (Experiment 1) 25376 50.344 661.341614 2+ 2+ 1320.6673794184405 0 0.979561226120019 100.0 Confident
|
|
|
3825 3824 P27348 QTIDNSQGAYQEAFDISKK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28505 (Experiment 1) 28505 54.0 741.670288 3+ 3+ 2221.9892572918006 0 -0.10008589979332419 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 99.82547993019197) Y10 1 0 100.0 Confident
|
|
|
3826 3825 P27348, P31946, P31947, P61981, P62258, P63104, Q04917 NLLSVAYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34864 (Experiment 1) 34864 61.363 494.248871 2+ 2+ 986.4837982483702 0 -0.6162701166085393 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.60383944153578) Y7 1 0 99.1891891891892 Confident
|
|
|
3827 3826 O75643 MTQNPNYYNLQGISHR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29256 (Experiment 1) 29256 54.869 672.632202 3+ 3+ 2014.8720597949302 0 1.3463565394717645 Phosphorylation of Y (7: Random) Phosphorylation of Y (7: 0.0, 8: 0.0) Phosphorylation of Y (7: 0.17528283235089528) 0 Y7-{Y7 Y8} 1 98.7012987012987 Confident
|
|
|
3828 3827 O14979 DLTEYLSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38676 (Experiment 1) 38676 65.96 538.736877 2+ 2+ 1075.4587056993403 0 0.45974879813828584 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.67689822294022) Y5 1 0 100.0 Confident
|
|
|
3829 3828 P23528 HELQANCYEEVKDR Phosphorylation of Y(8) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13326 (Experiment 1) 13326 34.2 624.265076 3+ 3+ 1869.7716770473203 0 0.9192429587032951 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3830 3829 Q9HB71 TDTVLILCR Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35857 (Experiment 1) 35857 62.534 545.799683 2+ 2+ 1089.58523001761 0 -0.38196346384517144 100.0 Confident
|
|
|
3831 3830 P83731 VFQFLNAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38760 (Experiment 1) 38760 66.07 483.773346 2+ 2+ 965.5334521449302 0 -1.3571197988836516 100.0 Confident
|
|
|
3832 3831 P22914 ITFYEDKNFQGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30917 (Experiment 1) 30917 56.788 759.870239 2+ 2+ 1516.7310423041602 1 -5.578337551078544 92.22520107238606 Doubtful
|
|
|
3833 3832 P49327 SEGVVAVLLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42896 (Experiment 1) 42896 72.253 558.337524 2+ 2+ 1114.6597748568602 0 0.6449593205685903 96.7654986522911 Confident
|
|
|
3834 3833 P08238 NPDDITQEEYGEFYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35631 (Experiment 1) 35631 62.252 964.385559 2+ 2+ 1926.7560694694905 0 0.256949623492587 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 4.197843481395482) Phosphorylation of Y (10: 95.89572730933989) 0 Y10-{Y10 Y14} 1 99.74226804123711 Confident
|
|
|
3835 3834 P07108 TKPSDEEMLFIYGHYK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37229 (Experiment 1) 37229 64.199 679.973572 3+ 3+ 2036.8954805781104 0 1.6696860392309087 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 17.02388139820072) Phosphorylation of Y (12: 2.10016155088853) 0 Y12-{Y12 Y15} 1 100.0 Confident
|
|
|
3836 3835 P13639 RCLYASVLTAQPR Phosphorylation of Y(4) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28379 (Experiment 1) 28379 53.853 538.932739 3+ 3+ 1613.77491195296 0 0.9126976607208008 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3837 3836 P12956 SDSFENPVLQQHFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33980 (Experiment 1) 33980 60.331 568.610107 3+ 3+ 1702.8063325027404 0 1.26571765661684 100.0 Confident
|
|
|
3838 3837 O75643 IIYIAPMR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39911 (Experiment 1) 39911 67.613 528.768433 2+ 2+ 1055.52388923854 0 -1.4904159521994251 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.67689822294022) Y3 1 0 99.73821989528795 Confident
|
|
|
3839 3838 Q9NZ63 NAEDCLYELPENIR Phosphorylation of Y(7) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42593 (Experiment 1) 42593 71.674 908.382813 2+ 2+ 1814.7546300008503 0 -1.957835099653564 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
3840 3839 P25705 HALIIYDDLSK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35079 (Experiment 1) 35079 61.613 684.334656 2+ 2+ 1366.6533827546102 0 1.005584868131861 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3841 3840 P15170, Q8IYD1 HLIVLINK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25648 (Experiment 1) 25648 50.669 475.313416 2+ 2+ 948.6120368188001 0 0.2548293710934517 92.85714285714286 Confident
|
|
|
3842 3841 P50991 DIEREDIEFICK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35843 (Experiment 1) 35843 62.518 522.922119 3+ 3+ 1565.7395583825303 0 3.167605393840615 92.71523178807946 Doubtful
|
|
|
3843 3842 O14949 HVISYSLSPFEQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35250 (Experiment 1) 35250 61.811 521.603699 3+ 3+ 1561.7888915334504 0 0.2403269025449482 100.0 Confident
|
|
|
3844 3843 Q9NRX4 IHVYGYSMAYGPAQHAISTEK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32575 (Experiment 1) 32575 58.716 801.701111 3+ 3+ 2402.0766328275604 0 2.025186111882651 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 6.206864492365192) Phosphorylation of Y (6: 0.012969181278141003) 0 Y6-{Y4 Y6 Y10} 1 100.0 Confident
|
|
|
3845 3844 P15311, P26038, P35241 RKPDTIEVQQMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12407 (Experiment 1) 12407 32.801 491.602112 3+ 3+ 1471.7816979780305 0 1.9044038621176065 100.0 Confident
|
|
|
3846 3845 P54578 SSSSGHYVSWVK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23497 (Experiment 1) 23497 48.057 702.303406 2+ 2+ 1402.5918451272105 0 0.2947011817166244 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
3847 3846 P10412, P16402, P16403 ASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31269 (Experiment 1) 31269 57.199 599.837219 2+ 2+ 1197.6605031328502 0 -0.51519490314609 100.0 Confident
|
|
|
3848 3847 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21455 (Experiment 1) 21455 45.373 673.307251 2+ 2+ 1344.6002845525904 0 -0.24913301512924108 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 10.33452891645359) Phosphorylation of Y (9: 26.33279483037157) 0 Y9-{Y4 Y7 Y9} 1 100.0 Confident
|
|
|
3849 3848 Q9Y2W1 SIFQHIQSAQSQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23302 (Experiment 1) 23302 47.816 510.599396 3+ 3+ 1528.7746384516404 0 1.1229611503643804 99.27536231884058 Confident
|
|
|
3850 3849 P26373 TIGISVDPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26954 (Experiment 1) 26954 52.175 479.271759 2+ 2+ 956.5290950404801 0 -0.13559539449099423 96.24664879356568 Confident
|
|
|
3851 3850 P62851 LITPAVVSER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28238 (Experiment 1) 28238 53.692 542.821472 2+ 2+ 1083.6288090817504 0 -0.38503931333279423 99.23664122137404 Confident
|
|
|
3852 3851 P46782 AQCPIVER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13120 (Experiment 1) 13120 33.901 486.751587 2+ 2+ 971.4858503295102 0 2.846158929727994 92.41192411924119 Confident
|
|
|
3853 3852 P61604 VLQATVVAVGSGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24884 (Experiment 1) 24884 49.773 658.382202 2+ 2+ 1314.7507151195805 0 -0.6561937997501867 100.0 Confident
|
|
|
3854 3853 Q9UBR2 NVDGVNYASITR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27869 (Experiment 1) 27869 53.252 694.8125 2+ 2+ 1387.6133088477804 0 -2.059386892920775 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 100.0 Confident
|
|
|
3855 3854 P61978 NLPLPPPPPPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29978 (Experiment 1) 29978 55.705 597.852783 2+ 2+ 1193.6920780446499 0 -0.89066853551291 97.5609756097561 Confident
|
|
|
3856 3855 P61313 GATYGKPVHHGVNQLK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7394 (Experiment 1) 7394 23.251 447.225372 4+ 4+ 1784.8723174951103 0 0.03613258993897884 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Doubtful
|
|
|
3857 3856 B2RPK0, P09429, P26583 MSSYAFFVQTCR Phosphorylation of Y(4) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43440 (Experiment 1) 43440 73.172 788.820496 2+ 2+ 1575.6251364847806 0 0.8256521461263632 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3858 3857 P49368 NLQDAMQVCR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25890 (Experiment 1) 25890 50.945 617.783203 2+ 2+ 1233.55942627593 0 -6.129304826499419 100.0 Doubtful
|
|
|
3859 3858 P10412, P16401, P16402, P16403, P22492, Q02539 GTGASGSFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7134 (Experiment 1) 7134 22.658 406.201019 2+ 2+ 810.3871818340601 0 0.37325414622258524 100.0 Confident
|
|
|
3860 3859 P31949 DGYNYTLSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21141 (Experiment 1) 21141 44.909 570.734436 2+ 2+ 1139.4536203189004 0 0.6121480140220803 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 5: 0.0) Phosphorylation of Y (3: 26.178010471204193) 0 Y3-{Y3 Y5} 1 96.21621621621621 Confident
|
|
|
3861 3860 Q96JB5 EQFYHSCK Phosphorylation of Y(4) Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8954 (Experiment 1) 8954 26.552 589.722473 2+ 2+ 1177.4263600252402 0 3.4194516159197232 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.33507853403141) Y4 1 0 96.19565217391303 Confident
|
|
|
3862 3861 Q92608 DQPDYAMYSR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22518 (Experiment 1) 22518 46.876 663.247437 2+ 2+ 1324.4795177969102 0 0.6055582783233078 Phosphorylation of Y (5: Random) Phosphorylation of Y (5: 0.0, 8: 0.0) Phosphorylation of Y (5: 2.504038772213247) 0 Y5-{Y5 Y8} 1 100.0 Confident
|
|
|
3863 3862 P06744 TFTTQETITNAETAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25591 (Experiment 1) 25591 50.602 828.406799 2+ 2+ 1654.8049950900606 0 -3.59123218452813 98.92183288409704 Confident
|
|
|
3864 3863 Q7Z5R6 TLYDNYQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17933 (Experiment 1) 17933 40.856 576.741272 2+ 2+ 1151.4648537089402 0 2.7199076269545546 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 6: 0.0) Phosphorylation of Y (3: 79.40663176265271) 0 Y3-{Y3 Y6} 1 97.289972899729 Confident
|
|
|
3865 3864 P17987 TSASIILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24203 (Experiment 1) 24203 48.97 430.763794 2+ 2+ 859.5127167003502 0 0.3695367948637887 99.72972972972973 Confident
|
|
|
3866 3865 Q8IWS0 EKPSQGIYMVYCR Phosphorylation of Y(8) Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30374 (Experiment 1) 30374 56.163 855.872986 2+ 2+ 1709.7306641824803 0 0.4410024856364296 Phosphorylation of Y (8: Random) Phosphorylation of Y (8: 0.0, 11: 0.0) Phosphorylation of Y (8: 15.706806282722512) 0 Y8-{Y8 Y11} 1 100.0 Confident
|
|
|
3867 3866 P07900 RAPFDLFENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40220 (Experiment 1) 40220 68.045 422.218994 3+ 3+ 1263.6360197205104 0 -0.6845739336769544 100.0 Confident
|
|
|
3868 3867 Q14498 TGIDLGTTGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22188 (Experiment 1) 22188 46.469 495.764557 2+ 2+ 989.51417325233 0 0.3911273933664748 98.92183288409704 Confident
|
|
|
3869 3868 P41250 LLEFNQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26742 (Experiment 1) 26742 51.926 474.761444 2+ 2+ 947.5076313199102 0 0.7411585295831066 99.45799457994579 Confident
|
|
|
3870 3869 P06733, P13929 VNQIGSVTESIQACK Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31219 (Experiment 1) 31219 57.143 545.278931 3+ 3+ 1632.8141203051202 0 0.5155128445183557 100.0 Confident
|
|
|
3871 3870 P30086 CDEPILSNR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19713 (Experiment 1) 19713 43.178 552.260925 2+ 2+ 1102.5077079729 0 -0.3720219489548126 99.72972972972973 Confident
|
|
|
3872 3871 Q9UQ80 EGEFVAQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32194 (Experiment 1) 32194 58.277 527.764832 2+ 2+ 1053.5131106231704 0 1.8952067998106452 99.45799457994579 Confident
|
|
|
3873 3872 P61254, Q9UNX3 IMSSPLSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20199 (Experiment 1) 20199 43.785 431.738617 2+ 2+ 861.4629896266101 0 -0.3573459862939612 99.7289972899729 Confident
|
|
|
3874 3873 P38646 TTPSVVAFTADGER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32930 (Experiment 1) 32930 59.117 725.862671 2+ 2+ 1449.7099725064102 0 0.5624758356925317 100.0 Confident
|
|
|
3875 3874 P04406 AGAHLQGGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4114 (Experiment 1) 4114 16.684 455.247894 2+ 2+ 908.4828135544001 0 -1.7336546838572942 100.0 Confident
|
|
|
3876 3875 P49915 TLNMTTSPEEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17735 (Experiment 1) 17735 40.599 625.800415 2+ 2+ 1249.5860178632504 0 0.20709732130170788 99.45799457994579 Confident
|
|
|
3877 3876 Q9Y277 VNNASLIGLGYTQTLRPGVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38285 (Experiment 1) 38285 65.483 701.064453 3+ 3+ 2100.16913751227 0 1.1373609582521174 100.0 Confident
|
|
|
3878 3877 O95881 ILFLDPSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43116 (Experiment 1) 43116 72.628 495.287231 2+ 2+ 988.5593325396003 0 0.5820128960448225 94.03794037940379 Confident
|
|
|
3879 3878 Q9Y230 TEALTQAFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28181 (Experiment 1) 28181 53.621 518.773682 2+ 2+ 1035.5349086969102 0 -2.0217161801730965 99.73190348525469 Confident
|
|
|
3880 3879 Q08211 LAAQSCALSLVR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33956 (Experiment 1) 33956 60.3 644.856445 2+ 2+ 1287.69690572491 0 1.109815266215105 100.0 Confident
|
|
|
3881 3880 Q14919 VAAAVPVIISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33127 (Experiment 1) 33127 59.341 548.348206 2+ 2+ 1094.6811790077802 0 0.6200977863374171 99.73474801061008 Confident
|
|
|
3882 3881 P61086 NAVIVALSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29914 (Experiment 1) 29914 55.628 501.303497 2+ 2+ 1000.5916952970404 0 0.74383072818899 97.61273209549071 Confident
|
|
|
3883 3882 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29234 (Experiment 1) 29234 54.843 609.259949 2+ 2+ 1216.5053215385904 0 0.019308495502044134 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 10.33452891645359) Phosphorylation of Y (8: 0.0) 0 Y3-{Y3 Y6 Y8} 1 100.0 Confident
|
|
|
3884 3883 Q9BUJ2 HLPSTEPDPHVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14310 (Experiment 1) 14310 35.751 495.259583 3+ 3+ 1482.7579257583402 0 -0.6771924120261774 100.0 Confident
|
|
|
3885 3884 P52272 GGNRFEPYANPTKR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14248 (Experiment 1) 14248 35.669 562.93103 3+ 3+ 1685.7675180734002 0 2.216100053747756 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
3886 3885 P14625 NLLHVTDTGVGMTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29833 (Experiment 1) 29833 55.534 505.265503 3+ 3+ 1512.7718615703202 0 1.8591113426098256 100.0 Confident
|
|
|
3887 3886 P11216 HLEIIYAINQR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41668 (Experiment 1) 41668 70.176 725.367188 2+ 2+ 1448.7177143466702 0 1.4535553894830846 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 95.81151832460732) Y6 1 0 95.13513513513514 Confident
|
|
|
3888 3887 Q15046 INMVEELEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36709 (Experiment 1) 36709 63.579 552.784058 2+ 2+ 1103.5532611829904 0 0.2730573209203748 92.99191374663073 Confident
|
|
|
3889 3888 P48047 YATALYSAASK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21586 (Experiment 1) 21586 45.622 613.277405 2+ 2+ 1224.5427696764705 0 -2.0485060487677784 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 23.868167899130043) Phosphorylation of Y (6: 100.0) 0 Y6-{Y1 Y6} 1 100.0 Confident
|
|
|
3890 3889 O15347 MSAYAFFVQTCR Phosphorylation of Y(4) Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46079 (Experiment 1) 46079 78.891 780.823792 2+ 2+ 1559.6302218652202 0 1.798873342437147 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3891 3890 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHRK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12538 (Experiment 1) 12538 33.01 575.592651 3+ 3+ 1723.7566786061805 0 -0.3214115844171545 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3892 3891 P52272 MGANNLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12027 (Experiment 1) 12027 32.151 452.718933 2+ 2+ 903.4232500729502 0 0.06957233913845286 100.0 Confident
|
|
|
3893 3892 Q96GX2 DFGIQPVEDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31476 (Experiment 1) 31476 57.444 574.283997 2+ 2+ 1146.5557037111403 0 -1.9699663571508383 97.56756756756756 Confident
|
|
|
3894 3893 O00116 EYVDPNNIFGNR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41967 (Experiment 1) 41967 70.646 506.552246 3+ 3+ 1516.6347725683504 0 0.08951444261097757 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 92.95774647887323 Doubtful
|
|
|
3895 3894 P62424 AGVNTVTTLVENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31649 (Experiment 1) 31649 57.65 673.367554 2+ 2+ 1344.7248942945605 0 -3.2220250127027388 100.0 Confident
|
|
|
3896 3895 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17299 (Experiment 1) 17299 40.013 514.762817 2+ 2+ 1027.5120650773501 0 -0.9557897357800081 100.0 Confident
|
|
|
3897 3896 P52272 MGAGMGFGLER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36116 (Experiment 1) 36116 62.866 563.263245 2+ 2+ 1124.51068517836 0 1.1112827066854842 100.0 Confident
|
|
|
3898 3897 Q96ST3 RLDDQESPVYAAQQR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20751 (Experiment 1) 20751 44.418 619.283142 3+ 3+ 1854.8261551483306 0 0.7758714627851115 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3899 3898 P00338 VTLTSEEEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16127 (Experiment 1) 16127 38.504 567.785767 2+ 2+ 1133.5564319871305 0 0.4835270120194332 100.0 Confident
|
|
|
3900 3899 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27739 (Experiment 1) 27739 53.101 523.252319 2+ 2+ 1044.4892775516303 0 0.7716309507702686 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.83844911147011) Y7 1 0 100.0 Confident
|
|
|
3901 3900 P23396 KFVADGIFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30304 (Experiment 1) 30304 56.083 512.795227 2+ 2+ 1023.5753169569102 0 0.5695351355191967 100.0 Confident
|
|
|
3902 3901 Q06830 LVQAFQFTDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36878 (Experiment 1) 36878 63.782 598.819336 2+ 2+ 1195.6237237013104 0 0.3301205992060721 100.0 Confident
|
|
|
3903 3902 Q9NWQ8 SPSSCNDLYATVK Phosphorylation of Y(9) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23089 (Experiment 1) 23089 47.555 761.318542 2+ 2+ 1520.6218249261506 0 0.4637615621925855 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
3904 3903 Q00610 IHEGCEEPATHNALAK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9764 (Experiment 1) 9764 28.151 592.950562 3+ 3+ 1775.8260819711506 0 2.1219511736194243 99.24812030075188 Confident
|
|
|
3905 3904 Q99497 DGLILTSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29491 (Experiment 1) 29491 55.139 437.752777 2+ 2+ 873.4919812557703 0 -1.1195683366706743 92.43243243243244 Confident
|
|
|
3906 3905 P62857 VEFMDDTSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25148 (Experiment 1) 25148 50.08 550.240417 2+ 2+ 1098.4651744545802 0 1.0055721773950428 100.0 Confident
|
|
|
3907 3906 P62280 EAIEGTYIDKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17052 (Experiment 1) 17052 39.657 422.890198 3+ 3+ 1265.6503323719703 0 -1.2357584990045651 99.28057553956835 Confident
|
|
|
3908 3907 P23526 AGIPVYAWK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38236 (Experiment 1) 38236 65.422 502.781738 2+ 2+ 1003.5491022090703 0 -0.17815152052750727 94.08602150537635 Confident
|
|
|
3909 3908 P62263 VKADRDESSPYAAMLAAQDVAQR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33363 (Experiment 1) 33363 59.614 643.803101 4+ 4+ 2571.1788660499706 0 1.7210581938835905 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Doubtful
|
|
|
3910 3909 P10398 QQFYHSVQDLSGGSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25289 (Experiment 1) 25289 50.244 596.92865 3+ 3+ 1787.76282661578 0 0.7225792221259865 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 100.0 Confident
|
|
|
3911 3910 P62805 DAVTYTEHAK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10112 (Experiment 1) 10112 28.839 607.758301 2+ 2+ 1213.5016331404804 0 0.3421804663178763 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3912 3911 P38159, Q96E39 YDDYSSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9697 (Experiment 1) 9697 28.03 496.701935 2+ 2+ 991.3883040328701 0 1.019761015233205 99.7289972899729 Confident
|
|
|
3913 3912 Q13242 EAGDVCYADVQK Phosphorylation of Y(7) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16758 (Experiment 1) 16758 39.276 717.785095 2+ 2+ 1433.5534110131603 0 1.5506428615115333 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3914 3913 P17844 TGTAYTFFTPNNIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42699 (Experiment 1) 42699 71.89 827.880066 2+ 2+ 1653.7439886641603 0 0.9605278642637584 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3915 3914 P07900, P08238, Q12931, Q58FF7 GVVDSEDIPLNLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40098 (Experiment 1) 40098 67.86 757.397583 2+ 2+ 1512.7783864194002 0 1.4699348787994662 100.0 Confident
|
|
|
3916 3915 Q99623 VLSRPNAQELPSMYQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27763 (Experiment 1) 27763 53.131 630.328979 3+ 3+ 1887.9625158743102 0 1.370569386436773 100.0 Confident
|
|
|
3917 3916 Q8IVF2 EKEDTDVADGCRETPTK Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29953 (Experiment 1) 29953 55.675 975.935425 2+ 2+ 1949.8636492483304 0 -3.7667216869799263 94.08602150537635 Confident
|
|
|
3918 3917 P61247 LITEDVQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16912 (Experiment 1) 16912 39.472 501.775604 2+ 2+ 1001.5393253710104 0 -2.660848303250441 99.19354838709677 Confident
|
|
|
3919 3918 P50990 TAEELMNFSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33495 (Experiment 1) 33495 59.767 585.277222 2+ 2+ 1168.5434247752803 0 -3.0188243313319365 100.0 Confident
|
|
|
3920 3919 P46778 HGVVPLATYMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30441 (Experiment 1) 30441 56.239 415.225281 3+ 3+ 1242.6543126369404 0 -0.2400602904047778 100.0 Confident
|
|
|
3921 3920 P30101 LNFAVASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26848 (Experiment 1) 26848 52.05 439.247711 2+ 2+ 876.4817509252402 0 -1.0038276317506378 100.0 Confident
|
|
|
3922 3921 O75083 LYSILGTTLKDEGK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39176 (Experiment 1) 39176 66.583 809.409119 2+ 2+ 1616.8062545675505 0 -1.5872672025476702 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 95.15347334410339) Y2 1 0 96.48648648648648 Confident
|
|
|
3923 3922 P07737 CYEMASHLR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16884 (Experiment 1) 16884 39.436 389.507843 3+ 3+ 1165.50084877065 0 0.728123578409947 100.0 Confident
|
|
|
3924 3923 P06748 SNQNGKDSKPSSTPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 3996 (Experiment 1) 3996 16.553 535.264038 3+ 3+ 1601.7757606504504 1 -5.502805301426082 100.0 Doubtful
|
|
|
3925 3924 P51659 AYALAFAER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36613 (Experiment 1) 36613 63.461 546.249634 2+ 2+ 1090.4848608775303 0 -0.1334656591865691 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
3926 3925 Q15019, Q9UHD8 VNIVPVIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33561 (Experiment 1) 33561 59.841 476.813324 2+ 2+ 951.6117024656303 0 0.4116924671667987 100.0 Confident
|
|
|
3927 3926 P04406 LVINGNPITIFQERDPSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43940 (Experiment 1) 43940 74.034 681.041565 3+ 3+ 2040.1003892461104 0 1.212043719615201 94.73684210526316 Confident
|
|
|
3928 3927 P50991 LVIEEAER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20928 (Experiment 1) 20928 44.624 479.763916 2+ 2+ 957.5131106231702 0 0.17554804545115546 99.73118279569893 Confident
|
|
|
3929 3928 P11940, Q13310, Q4VXU2, Q9H361 GFGFVCFSSPEEATK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44584 (Experiment 1) 44584 75.632 831.877747 2+ 2+ 1661.7395583825303 0 0.8310626168690527 100.0 Confident
|
|
|
3930 3929 P62701 LSNIFVIGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41156 (Experiment 1) 41156 69.406 495.802917 2+ 2+ 989.5909670210501 0 0.31670389041037916 99.45945945945947 Confident
|
|
|
3931 3930 P37837 LLGELLQDNAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38433 (Experiment 1) 38433 65.672 607.342163 2+ 2+ 1212.6714021697203 0 -1.341172454938221 100.0 Confident
|
|
|
3932 3931 P22314 DEFEGLFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44210 (Experiment 1) 44210 74.616 492.73703 2+ 2+ 983.4600124211502 0 -0.5128034673277186 99.45799457994579 Confident
|
|
|
3933 3932 Q9UKK9 VYSYALALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35226 (Experiment 1) 35226 61.783 514.294189 2+ 2+ 1026.5749826037402 0 -1.125363737831194 99.45652173913044 Confident
|
|
|
3934 3933 P13639 EDLYLKPIQR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30575 (Experiment 1) 30575 56.392 677.843994 2+ 2+ 1353.6693671719202 0 3.0006216015938096 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 84.64223385689354) Y4 1 0 92.46753246753246 Confident
|
|
|
3935 3934 P25205 VQVVGTYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17503 (Experiment 1) 17503 40.295 461.261749 2+ 2+ 920.5079656730802 0 1.0616470342339108 95.23809523809523 Confident
|
|
|
3936 3935 P29401 IIALDGDTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23352 (Experiment 1) 23352 47.878 473.266205 2+ 2+ 944.5178616504402 0 -0.004843008017160273 100.0 Confident
|
|
|
3937 3936 E9PAV3, Q13765 SPASDTYIVFGEAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38775 (Experiment 1) 38775 66.087 742.86731 2+ 2+ 1483.7194745609506 0 0.39879642938104093 99.75247524752476 Confident
|
|
|
3938 3937 Q14240 GFKDQIYEIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46222 (Experiment 1) 46222 79.146 798.380249 2+ 2+ 1594.7432603881705 0 1.6813308712634327 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.30191972076788) Y7 1 0 99.7340425531915 Confident
|
|
|
3939 3938 P00491 VIMDYESLEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34593 (Experiment 1) 34593 61.05 613.802673 2+ 2+ 1225.5900406145304 0 0.6129431654809919 100.0 Confident
|
|
|
3940 3939 P26599 GQPIYIQFSNHK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31836 (Experiment 1) 31836 57.869 756.355957 2+ 2+ 1510.6969789020904 0 0.25263526940913683 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
3941 3940 A8MUU1, Q01469 TQTVCNFTDGALVQHQEWDGKESTITR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34325 (Experiment 1) 34325 60.739 781.121399 4+ 4+ 3120.457075880871 0 -0.18747022234059313 100.0 Doubtful
|
|
|
3942 3941 P25205 ELISDNQYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 20999 (Experiment 1) 20999 44.722 569.281311 2+ 2+ 1136.5462016566003 0 1.6401494325051627 99.73045822102425 Confident
|
|
|
3943 3942 P33993 SQLLSYIDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38105 (Experiment 1) 38105 65.265 547.796204 2+ 2+ 1093.57677350889 0 0.987190624551778 99.73262032085562 Confident
|
|
|
3944 3943 A5A3E0, P0CG38, P0CG39, P60709, P63261, P68032, P68133, Q6S8J3, Q9BYX7 IWHHTFYNELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25316 (Experiment 1) 25316 50.276 505.921417 3+ 3+ 1514.7418817713801 0 0.3556734028970638 100.0 Confident
|
|
|
3945 3944 ALDOA_RABIT, P04075 ALSDHHIYLEGTLLKPNMVTPGHACTQK Phosphorylation of Y(8) Carbamidomethylation of C(25) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34624 (Experiment 1) 34624 61.085 643.114441 5+ 5+ 3210.5355401332404 0 0.08786390312419277 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Doubtful
|
|
|
3946 3945 P62249 VKGGGHVAQIYAIR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18217 (Experiment 1) 18217 41.291 516.940369 3+ 3+ 1547.7973616497004 0 1.235443741448371 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3947 3946 P63104 YLAEVAAGDDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20266 (Experiment 1) 20266 43.86 576.282043 2+ 2+ 1150.5506183307002 0 -0.941607773106445 100.0 Confident
|
|
|
3948 3947 Q08211 DFVNYLVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43870 (Experiment 1) 43870 73.907 513.274475 2+ 2+ 1024.5341804209202 0 0.21104254357778449 99.7289972899729 Confident
|
|
|
3949 3948 P11142 LDKSQIHDIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29822 (Experiment 1) 29822 55.521 460.258057 4+ 4+ 1837.0057605852803 0 -1.4331355567582065 100.0 Doubtful
|
|
|
3950 3949 P05387 KILDSVGIEADDDRLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27186 (Experiment 1) 27186 52.442 634.338196 3+ 3+ 1899.9901700907901 0 1.360216737776267 97.88732394366197 Confident
|
|
|
3951 3950 P28065 EGGQVYGTLGGMLTR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42554 (Experiment 1) 42554 71.612 809.868774 2+ 2+ 1617.7222076737603 0 0.4861238163944062 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
3952 3951 Q13263 DHQYQFLEDAVR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37331 (Experiment 1) 37331 64.321 800.843445 2+ 2+ 1599.6718863530605 0 0.28139922039410686 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
3953 3952 P62910 SYCAEIAHNVSSK Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18877 (Experiment 1) 18877 42.143 489.229095 3+ 3+ 1464.6667277954405 0 -0.866802340524398 100.0 Confident
|
|
|
3954 3953 P08238 YHTSQSGDEMTSLSEYVSR Phosphorylation of Y(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32772 (Experiment 1) 32772 58.941 753.309387 3+ 3+ 2255.9042073385003 1 -0.5447618542384427 Phosphorylation of Y (16: Doubtfull) Phosphorylation of Y (16: 3.073660714785918) Phosphorylation of Y (16: 97.20767888307155) 0 Y16-{Y1 Y16} 1 98.50746268656717 Confident
|
|
|
3955 3954 P46782 GSSNSYAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11362 (Experiment 1) 11362 31.109 463.732239 2+ 2+ 925.4505103666102 0 -0.6310752364192135 100.0 Confident
|
|
|
3956 3955 O00505 IEVLQQHENEDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24926 (Experiment 1) 24926 49.82 919.419739 2+ 2+ 1836.8295091932705 0 -2.4929394443812334 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 99.30191972076788) Y13 1 0 99.7289972899729 Confident
|
|
|
3957 3956 P30101 TADGIVSHLKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13621 (Experiment 1) 13621 34.68 390.22876 3+ 3+ 1167.6611718391903 0 2.800724338175165 96.71052631578947 Confident
|
|
|
3958 3957 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17513 (Experiment 1) 17513 40.308 532.89447 3+ 3+ 1595.6617155921804 0 -0.0844398610369085 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3959 3958 O15226 TNPEYIYAPLK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35684 (Experiment 1) 35684 62.315 694.830505 2+ 2+ 1387.6424837177403 0 2.8592296737682474 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 10.33452891645359) Phosphorylation of Y (7: 3.664921465968586) 0 Y7-{Y5 Y7} 1 100.0 Confident
|
|
|
3960 3959 O96011 AAQYACSLLGHALQR Phosphorylation of Y(4) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37938 (Experiment 1) 37938 65.058 580.275452 3+ 3+ 1737.8021893299601 0 1.342622561873968 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 99.82547993019197) Y4 1 0 99.28057553956835 Confident
|
|
|
3961 3960 O43813 IDPHAPNEMLYGR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28259 (Experiment 1) 28259 53.714 531.569275 3+ 3+ 1591.68542824222 0 0.35577523145949314 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3962 3961 P0C0S8, P20671, Q16777, Q6FI13, Q96KK5, Q99878, Q9BTM1 NDEELNKLLGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32617 (Experiment 1) 32617 58.764 636.843811 2+ 2+ 1271.67213044571 0 0.7369321497516047 100.0 Confident
|
|
|
3963 3962 P15311, P26038, P35241 APDFVFYAPR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44767 (Experiment 1) 44767 76.044 631.784302 2+ 2+ 1261.5532747905202 0 0.6143523431900699 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
3964 3963 O60678 DFIYQNPHIFK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37645 (Experiment 1) 37645 64.708 751.34845 2+ 2+ 1500.6802662087905 0 1.3847506218576773 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 92.89176090468497) Y4 1 0 95.23809523809523 Confident
|
|
|
3965 3964 P27797 AKIDDPTDSKPEDWDKPEHIPDPDAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24612 (Experiment 1) 24612 49.457 740.606995 4+ 4+ 2958.3883105313703 0 3.565872021575461 100.0 Doubtful
|
|
|
3966 3965 Q00610 LLYNNVSNFGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35511 (Experiment 1) 35511 62.111 688.822266 2+ 2+ 1375.6285649891001 0 1.0264467316268877 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
3967 3966 P0C0S5, Q71UI9 GDEELDSLIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37592 (Experiment 1) 37592 64.642 559.782166 2+ 2+ 1117.5502839775302 0 -0.4509887571916148 100.0 Confident
|
|
|
3968 3967 P25705 TGTAEMSSILEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35949 (Experiment 1) 35949 62.648 712.34021 2+ 2+ 1422.6660590891004 0 -0.13478299836760155 100.0 Confident
|
|
|
3969 3968 Q9Y3L3 EDSYANYFIR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40822 (Experiment 1) 40822 68.919 679.275452 2+ 2+ 1356.5387469251903 0 -1.7635368554927904 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 7: 0.0) Phosphorylation of Y (4: 86.98711846617606) 0 Y4-{Y4 Y7} 1 99.46236559139786 Confident
|
|
|
3970 3969 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 KESYSVYVYK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21102 (Experiment 1) 21102 44.856 673.306274 2+ 2+ 1344.6002845525904 0 -1.7001789604487576 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 9.94210316877388) Phosphorylation of Y (4: 24.071082390953148) 0 Y4-{Y4 Y7 Y9} 1 96.7479674796748 Confident
|
|
|
3971 3970 P13796 AACLPLPGYR Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34336 (Experiment 1) 34336 60.752 559.2948 2+ 2+ 1116.57499968708 0 0.04235628321560935 99.73333333333333 Confident
|
|
|
3972 3971 P37108 KISTVVSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7680 (Experiment 1) 7680 23.828 474.789154 2+ 2+ 947.5651461960304 0 -1.4649951505441547 90.32258064516128 Doubtful
|
|
|
3973 3972 Q99714 VCNFLASQVPFPSR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43719 (Experiment 1) 43719 73.621 811.412598 2+ 2+ 1620.8082470790403 0 1.4764318911372973 100.0 Confident
|
|
|
3974 3973 Q00839 KAVVVCPK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7069 (Experiment 1) 7069 22.462 450.770782 2+ 2+ 899.5262585895102 0 0.8346564639376128 97.90575916230367 Confident
|
|
|
3975 3974 P20042 DYTYEELLNR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39084 (Experiment 1) 39084 66.465 698.295837 2+ 2+ 1394.5755263567303 0 1.1418594970958231 Phosphorylation of Y (4: Random) Phosphorylation of Y (2: 0.0, 4: 0.0) Phosphorylation of Y (4: 3.315881326352531) 0 Y4-{Y2 Y4} 1 100.0 Confident
|
|
|
3976 3975 Q86UW6 ETEETPSELSFQDFEYPDYDDYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41319 (Experiment 1) 41319 69.632 959.072449 4+ 3+ 2874.1668095915707 0 9.977798328620155 92.41379310344827 Doubtful
|
|
|
3977 3976 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34597 (Experiment 1) 34597 61.054 636.639771 3+ 3+ 1906.8978635366104 0 -0.19892828365357665 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 8.753958426695245) Phosphorylation of Y (3: 0.0) 0 Y3-{Y3 Y5} 1 100.0 Confident
|
|
|
3978 3977 P17987 QAGVFEPTIVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32536 (Experiment 1) 32536 58.672 594.835938 2+ 2+ 1187.6550238295904 0 1.932668390016839 100.0 Confident
|
|
|
3979 3978 P37802 GPAYGLSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16345 (Experiment 1) 16345 38.775 410.719604 2+ 2+ 819.4239016959502 0 0.9171355706674496 100.0 Confident
|
|
|
3980 3979 P26599 NNQFQALLQYADPVSAQHAK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46232 (Experiment 1) 46232 79.163 775.034363 3+ 3+ 2322.07940970888 0 0.7956172628586575 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
3981 3980 P00558 ALESPERPFLAILGGAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46068 (Experiment 1) 46068 78.867 590.337952 3+ 3+ 1767.9883196159903 0 2.0931464315727877 100.0 Confident
|
|
|
3982 3981 P62263 IEDVTPIPSDSTRR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20967 (Experiment 1) 20967 44.679 529.612366 3+ 3+ 1584.81074917684 1 0.7334431472171575 100.0 Confident
|
|
|
3983 3982 P60842 GFKDQIYDIFQK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45406 (Experiment 1) 45406 77.447 791.370605 2+ 2+ 1580.7276103240304 0 -0.6022823405669057 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82758620689656) Y7 1 0 99.45945945945947 Confident
|
|
|
3984 3983 P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0 FDSDVGEYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20488 (Experiment 1) 20488 44.116 584.220276 2+ 2+ 1166.4281338470503 0 -1.8270307123731537 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
3985 3984 O75526, P38159 IVEVLLMK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40777 (Experiment 1) 40777 68.861 472.795441 2+ 2+ 943.5776254560303 0 -1.3709817867563519 99.45799457994579 Confident
|
|
|
3986 3985 P27348 KQTIDNSQGAYQEAFDISKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26710 (Experiment 1) 26710 51.888 568.537048 4+ 4+ 2270.1178897850505 0 0.5260643677121674 100.0 Doubtful
|
|
|
3987 3986 P63244 DETNYGIPQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20201 (Experiment 1) 20201 43.787 636.768921 2+ 2+ 1271.5183458337801 0 3.881511502736185 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 100.0 Confident
|
|
|
3988 3987 P27695 KNDKEAAGEGPALYEDPPDQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17197 (Experiment 1) 17197 39.862 568.774353 4+ 4+ 2271.0655198590202 0 1.224684766970977 71.42857142857143 Doubtful
|
|
|
3989 3988 P13639 GVQYLNEIK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29417 (Experiment 1) 29417 55.054 572.276306 2+ 2+ 1142.5372903732102 0 0.6716106134272477 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 83.0715532286213) Y4 1 0 93.4959349593496 Confident
|
|
|
3990 3989 Q00839 GYFEYIEENK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38563 (Experiment 1) 38563 65.826 646.297913 2+ 2+ 1290.5768330785402 0 3.434950815636444 100.0 Confident
|
|
|
3991 3990 Q96AE4 SCMLTGTPESVQSAK Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23391 (Experiment 1) 23391 47.927 798.377991 2+ 2+ 1594.7330931031006 0 5.22058904915169 93.10344827586206 Doubtful
|
|
|
3992 3991 P61604 GGEIQPVSVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17578 (Experiment 1) 17578 40.393 507.285461 2+ 2+ 1012.5553097883203 0 1.044066155222986 99.7289972899729 Confident
|
|
|
3993 3992 P23246, Q15233 AVVIVDDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19566 (Experiment 1) 19566 42.988 443.752991 2+ 2+ 885.49198125577 0 -0.6221806518274533 100.0 Confident
|
|
|
3994 3993 P13796, P13797, Q14651 KLENCNYAVELGK Phosphorylation of Y(7) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21314 (Experiment 1) 21314 45.171 539.916382 3+ 3+ 1616.7269587010303 0 0.22095928468819476 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.30191972076788) Y7 1 0 99.24812030075188 Confident
|
|
|
3995 3994 P63104 KGIVDQSQQAYQEAFEISK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33099 (Experiment 1) 33099 59.309 750.356323 3+ 3+ 2248.0412928646606 0 2.5973216145236178 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
3996 3995 P43243 MDYEDDRLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18524 (Experiment 1) 18524 41.698 404.849487 3+ 3+ 1211.52408631303 0 2.0956692547392635 99.38271604938271 Confident
|
|
|
3997 3996 CATA_HUMAN, P04040 LNVITVGPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29097 (Experiment 1) 29097 54.689 484.79776 2+ 2+ 967.5814649665101 0 -0.5135129733130245 99.74424552429667 Confident
|
|
|
3998 3997 Q06830 HGEVCPAGWKPGSDTIKPDVQK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20308 (Experiment 1) 20308 43.906 482.042877 5+ 5+ 2405.17977884896 0 -0.7369393038288408 100.0 Doubtful
|
|
|
3999 3998 Q01469 TTQFSCTLGEK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22260 (Experiment 1) 22260 46.558 636.30072 2+ 2+ 1270.5863522164202 0 0.4202809799931558 100.0 Confident
|
|
|
4000 3999 P01911, P01912, Q5Y7A7, Q9GIY3 HNYGVVESFTVQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32307 (Experiment 1) 32307 58.406 808.36792 2+ 2+ 1614.7191708986504 0 1.3089154350497376 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4001 4000 P04350, P07437, P68371, Q13509, Q13885, Q9BVA1 EIVHLQAGQCGNQIGAK Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20808 (Experiment 1) 20808 44.483 608.312317 3+ 3+ 1821.91556568189 0 -0.2433411290210343 100.0 Confident
|
|
|
4002 4001 P14866 SKPGAAMVEMADGYAVDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33819 (Experiment 1) 33819 60.137 623.298157 3+ 3+ 1866.8604188745403 0 6.536628194007458 92.7536231884058 Doubtful
|
|
|
4003 4002 P13639 VFSGLVSTGLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36430 (Experiment 1) 36430 63.253 554.323608 2+ 2+ 1106.6335601090204 0 -0.8091319815161115 100.0 Confident
|
|
|
4004 4003 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19855 (Experiment 1) 19855 43.358 514.767944 2+ 2+ 1027.5120650773501 0 9.0041275899539 91.32791327913279 Doubtful
|
|
|
4005 4004 P00558 GCITIIGGGDTATCCAK Carbamidomethylation of C(2, 14, 15) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28799 (Experiment 1) 28799 54.348 877.900879 2+ 2+ 1753.77972602569 0 4.259633816740034 100.0 Confident
|
|
|
4006 4005 P13639 KEDLYLKPIQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22881 (Experiment 1) 22881 47.302 494.928925 3+ 3+ 1481.7643301859202 0 0.41447964733949183 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 96.68411867364746) Y5 1 0 96.7741935483871 Confident
|
|
|
4007 4006 P29692 FYEQMNGPVAGASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25827 (Experiment 1) 25827 50.873 763.855347 2+ 2+ 1525.6983622768903 0 -1.4539449737055141 100.0 Confident
|
|
|
4008 4007 P62995 RPHTPTPGIYMGRPTYGSSR Phosphorylation of Y(10, 16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21930 (Experiment 1) 21930 46.139 797.687012 3+ 3+ 2390.03921538055 0 -0.0036693532254834104 Phosphorylation of Y (10: Very Confident, 16: Very Confident) Phosphorylation of Y (10: 99.82547993019197, 16: 99.82547993019197) Y10, Y16 2 0 99.28057553956835 Confident
|
|
|
4009 4008 Q9Y3U8 EVCGFAPYER Carbamidomethylation of C(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28826 (Experiment 1) 28826 54.377 614.276978 2+ 2+ 1226.5390081011801 0 0.3214879743438711 100.0 Confident
|
|
|
4010 4009 P13796 NWMNSLGVNPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40559 (Experiment 1) 40559 68.558 644.316895 2+ 2+ 1286.6189897573802 0 0.19191569020551777 100.0 Confident
|
|
|
4011 4010 P38919 LDYGQHVVAGTPGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17760 (Experiment 1) 17760 40.629 517.243408 3+ 3+ 1548.7086062149504 0 -0.136373806525393 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 100.0 Confident
|
|
|
4012 4011 O75431 ANAEYMSPSGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12365 (Experiment 1) 12365 32.743 617.74408 2+ 2+ 1233.4737041404803 0 -0.07857145044025697 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
4013 4012 P23193 DTYVSSFPR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28273 (Experiment 1) 28273 53.731 576.241455 2+ 2+ 1150.4696047362102 0 -1.082591744149282 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82578397212544) Y3 1 0 99.73614775725594 Confident
|
|
|
4014 4013 P31483, Q01085 TLYVGNLSR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31370 (Experiment 1) 31370 57.319 551.768921 2+ 2+ 1101.5219746622402 0 1.1910834873032694 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 83.52180936995154) Y3 1 0 92.66304347826086 Confident
|
|
|
4015 4014 P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8 YESLTDPSK Phosphorylation of Y(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16926 (Experiment 1) 16926 39.491 560.233582 2+ 2+ 1118.4532859657302 0 -0.6023371050710908 Phosphorylation of Y (1: Very Confident) Phosphorylation of Y (1: 100.0) Phosphorylation of Y (1: 96.33507853403141) Y1 1 0 96.19565217391303 Confident
|
|
|
4016 4015 Q14019 FTTGDAMSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14445 (Experiment 1) 14445 35.971 479.22052 2+ 2+ 956.4273323938803 0 -0.881980970490821 99.73045822102425 Confident
|
|
|
4017 4016 P14868 LQSGICHLFR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30628 (Experiment 1) 30628 56.454 410.88562 3+ 3+ 1229.63391154553 0 0.907839875139076 100.0 Confident
|
|
|
4018 4017 P78527 ATQQQHDFTLTQTADGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20386 (Experiment 1) 20386 43.993 639.973938 3+ 3+ 1916.8976666882804 0 1.207296081084699 100.0 Confident
|
|
|
4019 4018 P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3 IHFPLATYAPVISAEK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44661 (Experiment 1) 44661 75.805 612.982178 3+ 3+ 1835.9222873793005 0 1.314460967758614 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.83844911147011) Y8 1 0 100.0 Confident
|
|
|
4020 4019 P23528 MLPDKDCR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8300 (Experiment 1) 8300 25.096 517.74115 2+ 2+ 1033.46848601321 0 -0.7136252419367605 98.91598915989161 Confident
|
|
|
4021 4020 O43933, P55072, Q8IYT4 GILLYGPPGTGK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38232 (Experiment 1) 38232 65.417 626.821289 2+ 2+ 1251.6264397307802 0 1.264585000682539 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.65095986038395) Y5 1 0 100.0 Confident
|
|
|
4022 4021 P28066 AIGSASEGAQSSLQEVYHK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25263 (Experiment 1) 25263 50.214 654.656433 3+ 3+ 1960.9490335548005 0 -0.7963230341821115 100.0 Confident
|
|
|
4023 4022 Q15717 NVALLSQLYHSPAR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39753 (Experiment 1) 39753 67.402 550.279236 3+ 3+ 1647.8134056366603 0 1.4980071004547941 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
4024 4023 O75368 VYIASSSGSTAIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19291 (Experiment 1) 19291 42.656 642.346985 2+ 2+ 1282.6768814729803 0 1.973698374309739 95.6639566395664 Confident
|
|
|
4025 4024 P26641 ALIAAQYSGAQVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27358 (Experiment 1) 27358 52.645 674.373169 2+ 2+ 1346.7306483813402 0 0.8427722556355489 100.0 Confident
|
|
|
4026 4025 Q08211 DVVQAYPEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25841 (Experiment 1) 25841 50.889 588.306885 2+ 2+ 1174.5982372294602 0 0.8327607210866758 100.0 Confident
|
|
|
4027 4026 Q9UI12 QEYALAMIQCK Phosphorylation of Y(3) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39425 (Experiment 1) 39425 66.932 717.812195 2+ 2+ 1433.6084237914802 0 0.9844331823553225 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4028 4027 P26038 IQVWHEEHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13439 (Experiment 1) 13439 34.381 411.875854 3+ 3+ 1232.6050539454004 0 0.5492387489739611 99.24812030075188 Confident
|
|
|
4029 4028 TRYP_PIG VATVSLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22592 (Experiment 1) 22592 46.962 421.758575 2+ 2+ 841.5021520166501 0 0.527612225510443 100.0 Confident
|
|
|
4030 4029 ALDOA_RABIT, P04075 GVVPLAGTNGETTTQGLDGLSER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40534 (Experiment 1) 40534 68.527 758.382568 3+ 3+ 2271.1342681251804 1 -5.166032107243167 100.0 Doubtful
|
|
|
4031 4030 P51965, Q969T4, Q96LR5 GDNIYEWR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31751 (Experiment 1) 31751 57.77 566.727539 2+ 2+ 1131.4386389611002 0 1.664034553084291 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.03069466882067) Y5 1 0 99.72826086956522 Confident
|
|
|
4032 4031 P17987 EQLAIAEFAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39859 (Experiment 1) 39859 67.537 574.308655 2+ 2+ 1146.6033226099005 0 -0.4923687299196829 99.1869918699187 Confident
|
|
|
4033 4032 Q9Y5S9 FAEYGEIK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22451 (Experiment 1) 22451 46.793 518.722961 2+ 2+ 1035.4314283223403 0 -0.057117156323169264 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 96.16055846422339) Y4 1 0 96.24664879356568 Confident
|
|
|
4034 4033 P40121 ANAQAAALYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14402 (Experiment 1) 14402 35.906 550.759644 2+ 2+ 1099.5063245981003 0 -1.4430336790441403 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 98.86914378029078) Y9 1 0 99.73190348525469 Confident
|
|
|
4035 4034 P68104, Q5VTE0 EVSTYIKK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10320 (Experiment 1) 10320 29.229 524.259705 2+ 2+ 1046.5049276157704 0 -0.06728477222516514 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 97.03315881326353) Y5 1 0 96.52406417112299 Confident
|
|
|
4036 4035 P78527 VTELALTASDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26098 (Experiment 1) 26098 51.186 588.31781 2+ 2+ 1174.6193665968601 0 1.4451984491764522 100.0 Confident
|
|
|
4037 4036 Q02878 AIPQLQGYLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39612 (Experiment 1) 39612 67.205 579.834351 2+ 2+ 1157.65569253593 0 -1.3309555541889306 91.30434782608697 Confident
|
|
|
4038 4037 P16401 ATGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31998 (Experiment 1) 31998 58.054 606.845276 2+ 2+ 1211.6761531969903 0 -0.126993321808018 100.0 Confident
|
|
|
4039 4038 P07900 LGIHEDSQNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9216 (Experiment 1) 9216 27.098 584.789978 2+ 2+ 1167.5632487030703 0 1.8420008507519126 99.73118279569893 Confident
|
|
|
4040 4039 P54886 LNSLAIGLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34543 (Experiment 1) 34543 60.993 478.79834 2+ 2+ 955.5814649665101 0 0.6914187753356157 100.0 Confident
|
|
|
4041 4040 Q9BTT0 IKDLSTVEALQNLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36070 (Experiment 1) 36070 62.803 524.637634 3+ 3+ 1570.8930222488204 0 -1.238726004933748 97.82608695652173 Confident
|
|
|
4042 4041 P60709, P62736, P63261, P63267, P68032, P68133 DSYVGDEAQSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12316 (Experiment 1) 12316 32.661 599.764221 2+ 2+ 1197.5149610979704 0 -0.8937100604557575 100.0 Confident
|
|
|
4043 4042 P46778 VYNVTQHAVGIVVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28087 (Experiment 1) 28087 53.501 820.960144 2+ 2+ 1639.9045899920304 0 0.6973999605233303 99.72826086956522 Confident
|
|
|
4044 4043 P25098, P35626 KKPHASVGTHGYMAPEVLQK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14995 (Experiment 1) 14995 36.819 565.285156 4+ 4+ 2257.1078733861905 0 1.6119087851778686 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 99.03069466882067) Y12 1 0 100.0 Doubtful
|
|
|
4045 4044 Q9UN86 NSSYVHGGVDASGKPQEAVYGQNDIHHK Phosphorylation of Y(20) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15200 (Experiment 1) 15200 37.176 615.680847 5+ 5+ 3073.36794013083 0 -0.028412411429819522 Phosphorylation of Y (20: Doubtfull) Phosphorylation of Y (20: 6.852167603129168) Phosphorylation of Y (20: 16.05584642233857) 0 Y20-{Y4 Y20} 1 100.0 Doubtful
|
|
|
4046 4045 P13639 FSVSPVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27421 (Experiment 1) 27421 52.719 445.758026 2+ 2+ 889.5021520166501 0 -0.7324038579314754 100.0 Confident
|
|
|
4047 4046 P10412, P16402, P16403 SGVSLAALK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29103 (Experiment 1) 29103 54.696 423.257996 2+ 2+ 844.5018176634801 0 -0.4472413259586369 99.72826086956522 Confident
|
|
|
4048 4047 Q13151 EDIYSGGGGGGSR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9683 (Experiment 1) 9683 28.006 646.251282 2+ 2+ 1290.48777398149 0 0.18343091606258902 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
4049 4048 P22102 AVQEIMQEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18453 (Experiment 1) 18453 41.606 538.275696 2+ 2+ 1074.5379454720203 0 -1.0277303206195043 94.85094850948511 Confident
|
|
|
4050 4049 Q00610 EAIDSYIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27083 (Experiment 1) 27083 52.322 469.744781 2+ 2+ 937.4756624852903 0 -0.6955036928558229 96.53333333333333 Confident
|
|
|
4051 4050 P00491 ACVMMQGR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14614 (Experiment 1) 14614 36.211 476.71167 2+ 2+ 951.4088629621101 0 -0.07960338786095544 99.72826086956522 Confident
|
|
|
4052 4051 P06576 VALVYGQMNEPPGAR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31427 (Experiment 1) 31427 57.386 841.395081 2+ 2+ 1680.76949221935 0 3.6349566324149145 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
4053 4052 Q07955 TKDIEDVFYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30526 (Experiment 1) 30526 56.336 629.322266 2+ 2+ 1256.6288686514004 0 0.8822315808316625 99.74358974358975 Confident
|
|
|
4054 4053 P60709, P63261 GYSFTTTAER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21283 (Experiment 1) 21283 45.127 606.750427 2+ 2+ 1211.4859830763403 0 0.26204358879054046 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
4055 4054 P67809 RPQYSNPPVQGEVMEGADNQGAGEQGRPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20382 (Experiment 1) 20382 43.988 806.638794 4+ 4+ 3222.5224701020907 0 1.115751778990133 100.0 Doubtful
|
|
|
4056 4055 P52597 DLSYCLSGMYDHR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37951 (Experiment 1) 37951 65.073 539.565735 3+ 3+ 1615.6759125801502 0 -0.3317361680537621 98.7012987012987 Confident
|
|
|
4057 4056 P14618 ITLDNAYMEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30047 (Experiment 1) 30047 55.783 639.277466 2+ 2+ 1276.5410554243103 0 -0.529001578077058 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73333333333333 Confident
|
|
|
4058 4057 O94760 DYAVSTVPVADGLHLK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39894 (Experiment 1) 39894 67.589 882.931335 2+ 2+ 1763.8495163618604 0 -0.79241404189577 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 95.79967689822294) Y2 1 0 95.2127659574468 Confident
|
|
|
4059 4058 P61604 VVLDDKDYFLFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44133 (Experiment 1) 44133 74.416 510.604889 3+ 3+ 1528.7925799315603 0 0.16821098048337493 100.0 Confident
|
|
|
4060 4059 Q96PK6 ASYVAPLTAQPATYR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32200 (Experiment 1) 32200 58.284 844.90686 2+ 2+ 1687.7970868661803 0 1.23102489454065 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 2.609972437985359) Phosphorylation of Y (3: 99.35379644588045) 0 Y3-{Y3 Y14} 1 99.73262032085562 Confident
|
|
|
4061 4060 Q9Y676 DHGLLIYHIPQVEPR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40382 (Experiment 1) 40382 68.307 622.982483 3+ 3+ 1865.9189333343604 0 3.5775693574833825 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Confident
|
|
|
4062 4061 P14618 NTGIICTIGPASR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29745 (Experiment 1) 29745 55.434 680.357422 2+ 2+ 1358.6976340009 0 1.9527020492651181 100.0 Confident
|
|
|
4063 4062 P24539 HYLFDVQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29245 (Experiment 1) 29245 54.855 539.277283 2+ 2+ 1076.5403284305203 0 -0.2923950833172539 99.73333333333333 Confident
|
|
|
4064 4063 Q15365 AITIAGVPQSVTECVK Carbamidomethylation of C(14) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38683 (Experiment 1) 38683 65.968 836.950562 2+ 2+ 1671.8865569693905 0 0.008421635670721182 99.7289972899729 Confident
|
|
|
4065 4064 P04075 PYQYPALTPEQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29280 (Experiment 1) 29280 54.896 757.852356 2+ 2+ 1513.6854111588805 0 3.1324850615800175 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.972715810322882) Phosphorylation of Y (2: 18.163056441313046) 0 Y2-{Y2 Y4} 1 99.73262032085562 Confident
|
|
|
4066 4065 Q15477 TIYTSPIK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21261 (Experiment 1) 21261 45.091 501.747314 2+ 2+ 1001.4834638952002 0 -3.3770159654077725 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 96.33507853403141) Y3 1 0 96.19565217391303 Confident
|
|
|
4067 4066 P28482 GQVFDVGPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26644 (Experiment 1) 26644 51.812 487.756287 2+ 2+ 973.4981292653699 0 -0.11091500484366275 99.45652173913044 Confident
|
|
|
4068 4067 P62277 LTSDDVKEQIYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20702 (Experiment 1) 20702 44.359 759.857361 2+ 2+ 1517.7014551458406 0 -0.8462630240945492 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 96.33507853403141) Y11 1 0 99.1869918699187 Confident
|
|
|
4069 4068 Q9UI08 QVYGLNFASK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35321 (Experiment 1) 35321 61.892 603.78186 2+ 2+ 1205.5481894100803 0 0.809611179059852 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4070 4069 Q16658 LVARPEPATGYTLEFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34233 (Experiment 1) 34233 60.632 607.328369 3+ 3+ 1818.9628331441406 0 0.24394026594087861 100.0 Confident
|
|
|
4071 4070 Q9NUU7, Q9UMR2 HSMNILNR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17091 (Experiment 1) 17091 39.716 492.756134 2+ 2+ 983.4970837195501 0 0.6406284841611126 98.91598915989161 Confident
|
|
|
4072 4071 O75832 DHYEATAMHR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8403 (Experiment 1) 8403 25.342 437.504272 3+ 3+ 1309.4910855401201 0 -0.07538253910984205 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4073 4072 Q9NWQ8 ENDYESISDLQQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30233 (Experiment 1) 30233 56.0 867.355408 2+ 2+ 1732.6941379192701 0 1.2250743406946927 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
4074 4073 P22090, P62701, Q8TD47 LTGVFAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27111 (Experiment 1) 27111 52.355 430.753265 2+ 2+ 859.4915873329501 0 0.45238612679414425 99.72826086956522 Confident
|
|
|
4075 4074 O00571, O15523, P17844, Q92841, Q9NQI0 YLVLDEADR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31582 (Experiment 1) 31582 57.573 547.280518 2+ 2+ 1092.5451390274402 0 1.227926576854703 93.6 Confident
|
|
|
4076 4075 O75390 IVPNVLLEQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35466 (Experiment 1) 35466 62.06 605.363831 2+ 2+ 1208.7128730588802 0 0.1949303291724756 99.72826086956522 Confident
|
|
|
4077 4076 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35276 (Experiment 1) 35276 61.841 630.797974 2+ 2+ 1259.5798834611805 0 1.1981704671579947 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 100.0 Confident
|
|
|
4078 4077 P09874 AEPVEVVAPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21430 (Experiment 1) 21430 45.34 533.798828 2+ 2+ 1065.5818588893303 0 1.1654001752776975 99.73544973544973 Confident
|
|
|
4079 4078 P36578 NVTLPAVFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40489 (Experiment 1) 40489 68.458 494.795105 2+ 2+ 987.5753169569105 0 0.34368729504117634 100.0 Confident
|
|
|
4080 4079 P06748 VDNDENEHQLSLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17122 (Experiment 1) 17122 39.756 523.58197 3+ 3+ 1567.7226624484301 0 0.9028528452551715 100.0 Confident
|
|
|
4081 4080 P49588 NSSHAGAFVIVTEEAIAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39292 (Experiment 1) 39292 66.752 615.322998 3+ 3+ 1842.947577002821 0 -0.22340741701509953 100.0 Confident
|
|
|
4082 4081 P55072 EVDIGIPDATGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34188 (Experiment 1) 34188 60.58 621.81958 2+ 2+ 1241.6251802532902 0 -0.4608946619221458 99.7289972899729 Confident
|
|
|
4083 4082 Q02543 KSSGEIVYCGQVFEK Phosphorylation of Y(8) Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29249 (Experiment 1) 29249 54.861 905.908997 2+ 2+ 1809.8008519172806 0 1.4290358103242127 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.30191972076788) Y8 1 0 99.7340425531915 Confident
|
|
|
4084 4083 P31943 IQNGAQGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9251 (Experiment 1) 9251 27.162 478.766937 2+ 2+ 955.5199273391102 0 -0.6331602115576053 92.8388746803069 Confident
|
|
|
4085 4084 P10809 IGIEIIKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26267 (Experiment 1) 26267 51.382 471.311157 2+ 2+ 940.6069514383603 0 0.8589110390582481 100.0 Confident
|
|
|
4086 4085 Q8TCJ2 ESDYFTPQGEFR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37916 (Experiment 1) 37916 65.03 778.308899 2+ 2+ 1554.6028037337305 0 0.2835203163018 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
4087 4086 P31146 KLQATVQELQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16792 (Experiment 1) 16792 39.319 429.254333 3+ 3+ 1284.7401504358804 0 0.7914224052348164 100.0 Confident
|
|
|
4088 4087 P61160 ILLTEPPMNPTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34406 (Experiment 1) 34406 60.833 677.377991 2+ 2+ 1352.73737355456 0 2.9935457085953034 92.22520107238606 Confident
|
|
|
4089 4088 P62937, PPIA_HUMAN KITIADCGQLE Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27731 (Experiment 1) 27731 53.091 624.318909 2+ 2+ 1246.62273772514 0 0.4223334027290332 99.73684210526315 Confident
|
|
|
4090 4089 Q9Y277 GYGFGMVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31258 (Experiment 1) 31258 57.186 429.71225 2+ 2+ 857.4105601309302 0 -0.7133426110540393 92.40837696335078 Confident
|
|
|
4091 4090 Q09028, Q16576 TVALWDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43648 (Experiment 1) 43648 73.51 487.277069 2+ 2+ 972.53926580136 0 0.32760121598452613 99.7289972899729 Confident
|
|
|
4092 4091 Q9UQ80 AAHLCAEAALR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17077 (Experiment 1) 17077 39.699 394.873199 3+ 3+ 1181.5975260368102 0 0.2039159268619336 99.3975903614458 Confident
|
|
|
4093 4092 P32969 FLDGIYVSEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38856 (Experiment 1) 38856 66.184 585.805481 2+ 2+ 1169.5968402471303 0 -0.36802369541069774 100.0 Confident
|
|
|
4094 4093 P11310 IYQIYEGTSQIQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32346 (Experiment 1) 32346 58.45 839.896484 2+ 2+ 1677.7763514216003 0 1.2285128882048018 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 20.42149717361628) Phosphorylation of Y (5: 15.18324607329843) 0 Y5-{Y2 Y5} 1 100.0 Confident
|
|
|
4095 4094 Q06830 ADEGISFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23987 (Experiment 1) 23987 48.698 447.719818 2+ 2+ 893.4242956187702 0 0.8793985285578306 100.0 Confident
|
|
|
4096 4095 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32797 (Experiment 1) 32797 58.967 630.797302 2+ 2+ 1259.5798834611805 0 0.13285188200473977 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4097 4096 P62136 NVQLTENEIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23116 (Experiment 1) 23116 47.586 608.320007 2+ 2+ 1214.6255146064602 0 -0.04400651083059111 98.91598915989161 Confident
|
|
|
4098 4097 Q07955 EAGDVCYADVYR Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28442 (Experiment 1) 28442 53.928 709.306213 2+ 2+ 1416.59797952928 0 -0.0750472041554633 100.0 Confident
|
|
|
4099 4098 P62241 NCIVLIDSTPYR Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38700 (Experiment 1) 38700 65.988 725.872498 2+ 2+ 1449.7285997760102 0 1.2697083241435987 100.0 Confident
|
|
|
4100 4099 P29144 VPITAVIAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31297 (Experiment 1) 31297 57.234 491.817841 2+ 2+ 981.6222671493304 0 -1.1570154055463737 92.85714285714286 Confident
|
|
|
4101 4100 P06733 IGAEVYHNLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17781 (Experiment 1) 17781 40.657 572.312073 2+ 2+ 1142.6084079903403 0 1.035341834045637 100.0 Confident
|
|
|
4102 4101 B2RPK0, P09429 IKGEHPGLSIGDVAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19791 (Experiment 1) 19791 43.279 507.619293 3+ 3+ 1519.8358417258703 0 0.13650237825518233 100.0 Confident
|
|
|
4103 4102 P14550, Q96JD6 SPAQILLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30977 (Experiment 1) 30977 56.859 449.280151 2+ 2+ 896.5443511818 0 1.5556960925096066 99.7340425531915 Confident
|
|
|
4104 4103 P23396 GGKPEPPAMPQPVPTA ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27752 (Experiment 1) 27752 53.117 787.406311 2+ 2+ 1572.7970136890003 0 0.6701610515309474 96.46739130434783 Confident
|
|
|
4105 4104 Q9NSD9 TYTIANQFPLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37589 (Experiment 1) 37589 64.639 705.375488 2+ 2+ 1408.7350650554401 0 0.9626165539438805 97.289972899729 Confident
|
|
|
4106 4105 P24752 DGLTDVYNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24725 (Experiment 1) 24725 49.591 512.751282 2+ 2+ 1023.4872897981502 0 0.7033319644165092 99.45652173913044 Confident
|
|
|
4107 4106 Q8N163 TLAAEMQELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35691 (Experiment 1) 35691 62.323 581.298462 2+ 2+ 1160.5859582936002 0 -3.0855200817490114 99.72826086956522 Confident
|
|
|
4108 4107 P29218 KIEFGVVYSCVEGK Phosphorylation of Y(8) Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37356 (Experiment 1) 37356 64.352 565.599915 3+ 3+ 1693.7786599207204 0 -0.4386615639693402 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
4109 4108 P63241, Q6IS14, Q9GZV4 KYEDICPSTHNMDVPNIK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26432 (Experiment 1) 26432 51.572 541.007507 4+ 4+ 2159.9979749765102 0 1.361885101936965 100.0 Doubtful
|
|
|
4110 4109 Q07955 SHEGETAYIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11270 (Experiment 1) 11270 30.978 388.187805 3+ 3+ 1161.54145062933 0 0.11589772443367119 100.0 Confident
|
|
|
4111 4110 P46777 HIMGQNVADYMR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28319 (Experiment 1) 28319 53.783 478.891663 3+ 3+ 1433.6543892899301 0 -0.8559272786263593 100.0 Confident
|
|
|
4112 4111 Q14204 TPVIDADKPVSSQLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23461 (Experiment 1) 23461 48.011 542.63446 3+ 3+ 1624.8784348138404 0 1.9139905509492696 92.14285714285715 Doubtful
|
|
|
4113 4112 P35579 VIQYLAYVASSHK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34798 (Experiment 1) 34798 61.286 520.261108 3+ 3+ 1557.7592448054806 0 1.4414539749675617 Phosphorylation of Y (4: Doubtfull) Phosphorylation of Y (4: 2.0781118667818306) Phosphorylation of Y (4: 0.17452006980802792) 0 Y4-{Y4 Y7} 1 100.0 Confident
|
|
|
4114 4113 P62316 SEMTPEELQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19604 (Experiment 1) 19604 43.035 596.780029 2+ 2+ 1190.5489040785403 1 -5.663304476431165 96.24664879356568 Doubtful
|
|
|
4115 4114 Q13094 ESQVYLLGTGLR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43831 (Experiment 1) 43831 73.838 708.351074 2+ 2+ 1414.68574551205 0 1.3055367658929231 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 98.60383944153578) Y5 1 0 99.1869918699187 Confident
|
|
|
4116 4115 P62750 NKLDHYAIIK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20526 (Experiment 1) 20526 44.16 647.831909 2+ 2+ 1293.6482378045202 0 0.7928466132859163 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4117 4116 P22234 EVYELLDSPGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35222 (Experiment 1) 35222 61.779 665.304382 2+ 2+ 1328.59011379171 0 3.0792577001051944 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.20767888307155) Y3 1 0 96.75675675675676 Confident
|
|
|
4118 4117 P50402 DSAYQSITHYRPVSASR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23405 (Experiment 1) 23405 47.943 673.309387 3+ 3+ 2016.9054680981903 0 0.4274913136219447 Phosphorylation of Y (10: Doubtfull) Phosphorylation of Y (10: 1.7473451480274487) Phosphorylation of Y (10: 99.82547993019197) 0 Y10-{Y4 Y10} 1 100.0 Confident
|
|
|
4119 4118 Q13547, Q92769 YGEYFPGTGDLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37112 (Experiment 1) 37112 64.062 687.818237 2+ 2+ 1373.6251802532902 0 -2.3692154535761745 93.78378378378378 Confident
|
|
|
4120 4119 P29401 KAYGQALAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7740 (Experiment 1) 7740 23.939 475.275574 2+ 2+ 948.5392658013602 0 -2.8096620427825996 100.0 Confident
|
|
|
4121 4120 P15927 APTNIVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17605 (Experiment 1) 17605 40.429 493.240936 2+ 2+ 984.4681481842304 0 -0.8404788582543061 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 90.57591623036649) Y7 1 0 92.3076923076923 Confident
|
|
|
4122 4121 P52209 SFLEDIRK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28523 (Experiment 1) 28523 54.023 504.279694 2+ 2+ 1006.5447451046202 0 0.08919828118843191 99.73118279569893 Confident
|
|
|
4123 4122 Q9NWQ8 SGQSLTVPESTYTSIQGDPQR Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31233 (Experiment 1) 31233 57.159 777.688232 3+ 3+ 2330.0427494166406 0 0.05022703792299972 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 96.33507853403141) Y12 1 0 97.77777777777777 Confident
|
|
|
4124 4123 P60174 VTNGAFTGEISPGMIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39648 (Experiment 1) 39648 67.254 811.910828 2+ 2+ 1620.8181430564 1 -8.870185977723754 99.19354838709677 Doubtful
|
|
|
4125 4124 P04899 IAQSDYIPTQQDVLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35617 (Experiment 1) 35617 62.235 873.955811 2+ 2+ 1745.8948131539703 0 1.2906346572727356 96.19565217391303 Confident
|
|
|
4126 4125 Q6P2Q9 TNHIYVSSDDIK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21896 (Experiment 1) 21896 46.088 736.325623 2+ 2+ 1470.6391892424504 0 -1.6950190008090193 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
4127 4126 O95433 ETFLTSPEELYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42286 (Experiment 1) 42286 71.176 742.866943 2+ 2+ 1483.7194745609504 0 -0.0952354674155909 96.53333333333333 Confident
|
|
|
4128 4127 P11021 NELESYAYSLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37793 (Experiment 1) 37793 64.882 658.823059 2+ 2+ 1315.6295969273904 0 1.4936802061341405 100.0 Confident
|
|
|
4129 4128 P40939 VIGMHYFSPVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32529 (Experiment 1) 32529 58.665 464.904663 3+ 3+ 1391.6907577153104 0 1.0051420390146735 99.37888198757764 Confident
|
|
|
4130 4129 P07954 IYELAAGGTAVGTGLNTR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36219 (Experiment 1) 36219 63.001 922.451904 2+ 2+ 1842.88769277573 0 0.8468148648052588 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.83844911147011) Y2 1 0 99.7340425531915 Confident
|
|
|
4131 4130 P62820, Q9H0U4 YASENVNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6529 (Experiment 1) 6529 21.131 462.725464 2+ 2+ 923.4348603024703 0 1.636787364197296 94.08602150537635 Confident
|
|
|
4132 4131 P68104, Q05639, Q5VTE0 STTTGHLIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13956 (Experiment 1) 13956 35.209 600.786926 2+ 2+ 1199.5587540937802 0 0.45354918628356355 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
4133 4132 Q99714 DLAPIGIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33140 (Experiment 1) 33140 59.358 427.75827 2+ 2+ 853.5021520166501 0 -0.19280777703464194 99.45799457994579 Confident
|
|
|
4134 4133 Q9UL46 DEAAYGELR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19118 (Experiment 1) 19118 42.446 552.22406 2+ 2+ 1102.43321922749 0 0.314943716254065 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.83844911147011) Y5 1 0 100.0 Confident
|
|
|
4135 4134 P37837 LSFDKDAMVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26676 (Experiment 1) 26676 51.85 418.216156 3+ 3+ 1251.6281574587504 0 -1.210583989296256 100.0 Confident
|
|
|
4136 4135 P55209, Q99733 FYEEVHDLER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26027 (Experiment 1) 26027 51.104 708.794922 2+ 2+ 1415.5758607099003 0 -0.4018392893347479 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 96.33507853403141) Y2 1 0 97.8319783197832 Confident
|
|
|
4137 4136 P14314 SLEDQVEMLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39049 (Experiment 1) 39049 66.419 610.302917 2+ 2+ 1218.5914375968603 0 -0.12823997724127517 99.73045822102425 Confident
|
|
|
4138 4137 P04229, P13760, P13761, P20039, P79483, Q29974, Q30134, Q30154, Q30167, Q9TQE0 HNYGVGESFTVQR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25351 (Experiment 1) 25351 50.315 525.231812 3+ 3+ 1572.6722207062305 0 0.8795446892009536 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4139 4138 P40925 FVEGLPINDFSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43557 (Experiment 1) 43557 73.35 697.358643 2+ 2+ 1392.7037649271604 0 -0.739834539517428 99.72826086956522 Confident
|
|
|
4140 4139 P51991 IETIEVMEDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32846 (Experiment 1) 32846 59.023 617.803772 2+ 2+ 1233.5911032436902 0 1.5278520911304883 100.0 Confident
|
|
|
4141 4140 Q96AE4 IGGNEGIDVPIPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36722 (Experiment 1) 36722 63.595 668.864258 2+ 2+ 1335.71466396403 0 -0.523945837031761 100.0 Confident
|
|
|
4142 4141 P00519 LKPAPPPPPAASAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12252 (Experiment 1) 12252 32.544 466.941681 3+ 3+ 1397.8030850456103 0 0.09177017942623132 100.0 Confident
|
|
|
4143 4142 O14745 LLVVDPETDEQLQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35353 (Experiment 1) 35353 61.93 813.934387 2+ 2+ 1625.8512170064905 0 1.845397784536459 100.0 Confident
|
|
|
4144 4143 Q9NSD9 AAGASDVVLYK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24888 (Experiment 1) 24888 49.777 587.280823 2+ 2+ 1172.5478550569103 0 -0.6487441868947983 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
4145 4144 P47914 AQAAAPASVPAQAPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14631 (Experiment 1) 14631 36.239 689.378113 2+ 2+ 1376.7412130650405 0 0.3336351126755842 92.65822784810128 Confident
|
|
|
4146 4145 P62805 KTVTAMDVVYALKR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42254 (Experiment 1) 42254 71.121 558.960693 3+ 3+ 1673.8575789477604 0 1.59263199861582 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
4147 4146 P12956 ILELDQFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40125 (Experiment 1) 40125 67.893 503.28476 2+ 2+ 1004.5542471591602 0 0.7152091499224291 99.72972972972973 Confident
|
|
|
4148 4147 Q9UPN3 DASSCQEQLDEFRK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36560 (Experiment 1) 36560 63.401 571.593079 3+ 3+ 1711.7471629441104 0 5.974364768256402 92.61744966442953 Doubtful
|
|
|
4149 4148 A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7 QEYDESGPSIVHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18090 (Experiment 1) 18090 41.122 758.854309 2+ 2+ 1515.6953850714303 0 -0.8697347375413539 100.0 Confident
|
|
|
4150 4149 O15143 FAVGSGSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12403 (Experiment 1) 12403 32.796 390.703979 2+ 2+ 779.3926015676702 0 1.0282714987123562 98.6449864498645 Confident
|
|
|
4151 4150 P63272 VSNFKPGVYAVSVTGR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29893 (Experiment 1) 29893 55.604 587.628357 3+ 3+ 1759.8658351323406 0 -1.471184368997482 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
4152 4151 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33268 (Experiment 1) 33268 59.501 630.797485 2+ 2+ 1259.5798834611805 0 0.4229609611623073 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4153 4152 O14744 YSQYQQAIYK Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21406 (Experiment 1) 21406 45.299 686.302551 2+ 2+ 1370.5907824980504 0 -0.1700646708574275 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 11.237190579900766) Phosphorylation of Y (9: 5.410122164048866) 0 Y9-{Y1 Y4 Y9} 1 99.72826086956522 Confident
|
|
|
4154 4153 P07737 CYEMASHLR Phosphorylation of Y(2) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16260 (Experiment 1) 16260 38.671 623.741333 2+ 2+ 1245.4671792914 0 0.7485279758399663 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
4155 4154 P13639 CLYASVLTAQPR Phosphorylation of Y(3) Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36162 (Experiment 1) 36162 62.932 729.844055 2+ 2+ 1457.6738009293601 0 -0.16706510234814229 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4156 4155 P36873, P62136, P62140 IYGFYDECK Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33865 (Experiment 1) 33865 60.19 597.760498 2+ 2+ 1193.5063109905702 0 0.11047553378688013 99.45799457994579 Confident
|
|
|
4157 4156 P09651 NQGGYGGSSSSSSYGSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10553 (Experiment 1) 10553 29.689 847.854614 2+ 2+ 1693.6928188721301 0 1.0946430242091512 99.7289972899729 Confident
|
|
|
4158 4157 P37802, Q9UI15 GASQAGMTGYGMPR Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22391 (Experiment 1) 22391 46.717 732.295105 2+ 2+ 1462.57343526509 0 1.5170145486948583 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
4159 4158 P11940, Q9H361 IVATKPLYVALAQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36772 (Experiment 1) 36772 63.653 541.639038 3+ 3+ 1621.8956787086404 0 -0.24254097474466346 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
4160 4159 P07737 TLVLLMGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40439 (Experiment 1) 40439 68.386 437.775177 2+ 2+ 873.5357606440502 0 0.04616790741010339 99.7289972899729 Confident
|
|
|
4161 4160 P49588 ITCLCQVPQNAANR Carbamidomethylation of C(3, 5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22416 (Experiment 1) 22416 46.749 822.900085 2+ 2+ 1643.78719436463 0 -0.958376825654924 96.48648648648648 Confident
|
|
|
4162 4161 Q14103 KYHNVGLSK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6300 (Experiment 1) 6300 20.687 563.280029 2+ 2+ 1124.5379590795503 0 6.698300119252516 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.03069466882067) Y2 1 0 99.72826086956522 Doubtful
|
|
|
4163 4162 Q86SX6 DYAAYNVLDDPELR Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45941 (Experiment 1) 45941 78.651 867.373413 2+ 2+ 1732.7345461792702 0 -1.3103410144064958 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 7.4692137759741675) Phosphorylation of Y (2: 92.08400646203555) 0 Y2-{Y2 Y5} 1 92.7807486631016 Doubtful
|
|
|
4164 4163 P62861 FVNVVPTFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39986 (Experiment 1) 39986 67.72 554.31366 2+ 2+ 1106.61243074162 0 0.30337053020348465 100.0 Confident
|
|
|
4165 4164 P14625, Q58FF3 GLFDEYGSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34808 (Experiment 1) 34808 61.297 508.240723 2+ 2+ 1014.4658260775802 0 1.049689514807535 100.0 Confident
|
|
|
4166 4165 P84098 HMYHSLYLK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18432 (Experiment 1) 18432 41.578 636.286133 2+ 2+ 1270.5569802719701 0 0.5758374963610576 Phosphorylation of Y (3: Doubtfull) Phosphorylation of Y (3: 35.337280524172684) Phosphorylation of Y (3: 52.827140549273025) 0 Y3-{Y3 Y7} 1 100.0 Confident
|
|
|
4167 4166 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31448 (Experiment 1) 31448 57.41 609.984253 3+ 3+ 1826.9315330158604 0 -0.32974408473564615 100.0 Confident
|
|
|
4168 4167 P33993 RFELYFQGPSSNKPR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33204 (Experiment 1) 33204 59.429 635.971191 3+ 3+ 1904.8934468625102 0 -0.8927351058952244 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
4169 4168 P62081 ELNITAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18770 (Experiment 1) 18770 42.012 430.248535 2+ 2+ 858.4810822189004 0 1.6674663032460038 99.45652173913044 Confident
|
|
|
4170 4169 P15880 AEDKEWMPVTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22684 (Experiment 1) 22684 47.072 445.219971 3+ 3+ 1332.6383877892802 0 -0.2277448353064767 99.37888198757764 Confident
|
|
|
4171 4170 O43809 LMTEILGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34635 (Experiment 1) 34635 61.098 466.765686 2+ 2+ 931.5160878286301 0 0.783303422567989 95.6639566395664 Confident
|
|
|
4172 4171 P05455 IIEDQQESLNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15521 (Experiment 1) 15521 37.644 658.837708 2+ 2+ 1315.6619596848302 0 -0.8322364736797345 97.289972899729 Confident
|
|
|
4173 4172 P78527 HVMQPYYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13435 (Experiment 1) 13435 34.376 533.263733 2+ 2+ 1064.5113368013604 0 1.477943508612622 99.45799457994579 Confident
|
|
|
4174 4173 O15143 NSVSQISVLSGGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29230 (Experiment 1) 29230 54.839 638.34845 2+ 2+ 1274.6830294825802 0 -0.5345167201893425 100.0 Confident
|
|
|
4175 4174 P12268 AMMYSGELK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25746 (Experiment 1) 25746 50.782 515.239258 2+ 2+ 1028.46708903088 0 -3.0334984894511523 99.45799457994579 Confident
|
|
|
4176 4175 Q9H0U4 GAHGIIVVYDVTDQESYANVK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38627 (Experiment 1) 38627 65.901 760.052917 3+ 3+ 2277.1277261927603 0 4.032808629047319 100.0 Confident
|
|
|
4177 4176 P11142 LDKSQIHDIVLVGGSTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29799 (Experiment 1) 29799 55.495 613.342102 3+ 3+ 1837.0057605852803 0 -0.6978078608943535 100.0 Confident
|
|
|
4178 4177 P10809 LSDGVAVLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24676 (Experiment 1) 24676 49.532 451.271454 2+ 2+ 900.5280324113203 0 0.3574956584323021 100.0 Confident
|
|
|
4179 4178 P14625 IYFMAGSSR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30906 (Experiment 1) 30906 56.776 516.252808 2+ 2+ 1030.4906013567802 0 0.4471741314463298 99.74811083123426 Confident
|
|
|
4180 4179 P51149 ATIGADFLTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36761 (Experiment 1) 36761 63.64 518.787476 2+ 2+ 1035.56006081559 0 0.32600140870309097 100.0 Confident
|
|
|
4181 4180 Q09161 ANNYNEAVYLVR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38951 (Experiment 1) 38951 66.293 753.343018 2+ 2+ 1504.6711580770705 0 0.2156981400164951 Phosphorylation of Y (9: Doubtfull) Phosphorylation of Y (9: 14.843030457417184) Phosphorylation of Y (9: 99.82547993019197) 0 Y9-{Y4 Y9} 1 100.0 Confident
|
|
|
4182 4181 Q15283 DAIYTIPVK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32553 (Experiment 1) 32553 58.691 550.275513 2+ 2+ 1098.5362277440504 0 0.22290868341689646 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 94.58987783595113) Y4 1 0 99.01477832512316 Confident
|
|
|
4183 4182 P29144 VNESSHYDLAFTDVHFKPGQIR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35701 (Experiment 1) 35701 62.335 660.812988 4+ 4+ 2639.216965810851 0 2.224659279289469 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 97.90575916230367) Y7 1 0 100.0 Doubtful
|
|
|
4184 4183 P14324 LKEVLEYNAIGGK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28604 (Experiment 1) 28604 54.115 757.387695 2+ 2+ 1512.7589104523101 0 1.2718826361119282 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 96.50959860383944) Y7 1 0 98.68766404199475 Confident
|
|
|
4185 4184 P04075 PYQYPALTPEQK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29505 (Experiment 1) 29505 55.155 757.850769 2+ 2+ 1513.6854111588805 0 1.0384030696701816 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 10.972715810322882) Phosphorylation of Y (2: 0.0) 0 Y2-{Y2 Y4} 1 100.0 Confident
|
|
|
4186 4185 P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1 AGLQFPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33696 (Experiment 1) 33696 59.995 472.769562 2+ 2+ 943.5239500903901 0 0.6567432039700222 99.72972972972973 Confident
|
|
|
4187 4186 P10412, P16402, P16403 KASGPPVSELITK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23649 (Experiment 1) 23649 48.25 663.885071 2+ 2+ 1325.7554661468505 0 0.09257591576236822 100.0 Confident
|
|
|
4188 4187 P62241 IIDVVYNASNNELVR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41298 (Experiment 1) 41298 69.599 899.940125 2+ 2+ 1797.8662290551604 0 -0.29556890095761423 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.47643979057592) Y6 1 0 99.45945945945947 Confident
|
|
|
4189 4188 O00629 IEQLQNHENEDIYK Phosphorylation of Y(13) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18573 (Experiment 1) 18573 41.759 618.275574 3+ 3+ 1851.8040227214206 0 0.46898103256817697 Phosphorylation of Y (13: Very Confident) Phosphorylation of Y (13: 100.0) Phosphorylation of Y (13: 99.67689822294022) Y13 1 0 100.0 Confident
|
|
|
4190 4189 P26368 SIEIPRPVDGVEVPGCGK Carbamidomethylation of C(16) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35402 (Experiment 1) 35402 61.988 636.997192 3+ 3+ 1907.9774972321102 0 -4.055800772942574 100.0 Confident
|
|
|
4191 4190 P46777 EFNAEVHR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11633 (Experiment 1) 11633 31.518 501.245209 2+ 2+ 1000.4726427935202 0 3.2142783165560704 99.72972972972973 Confident
|
|
|
4192 4191 P09651 SSGPYGGGGQYFAKPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20463 (Experiment 1) 20463 44.088 543.599365 3+ 3+ 1627.7743040984703 0 1.2027874321517376 100.0 Confident
|
|
|
4193 4192 P04406 VIISAPSADAPMFVMGVNHEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42740 (Experiment 1) 42740 71.974 738.37616 3+ 3+ 2212.10204612223 0 2.0786545549351074 100.0 Confident
|
|
|
4194 4193 P07737 CYEMASHLR Carbamidomethylation of C(1) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16891 (Experiment 1) 16891 39.444 583.757141 2+ 2+ 1165.50084877065 0 -0.959048824902878 99.72826086956522 Confident
|
|
|
4195 4194 P38919 LDYGQHVVAGTPGR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17757 (Experiment 1) 17757 40.626 775.360718 2+ 2+ 1548.7086062149504 0 -1.1111903271000907 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.83844911147011) Y3 1 0 100.0 Confident
|
|
|
4196 4195 P31939 NGNYCVLQMDQSYKPDENEVR Phosphorylation of Y(4) Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37638 (Experiment 1) 37638 64.699 880.69696 3+ 3+ 2638.0829170598004 1 -6.520490359070174 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 13: 0.0) Phosphorylation of Y (4: 38.21989528795812) 0 Y4-{Y4 Y13} 1 100.0 Doubtful
|
|
|
4197 4196 P04083 NALLSLAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32085 (Experiment 1) 32085 58.153 415.261871 2+ 2+ 828.5069030439204 0 2.752514627075214 99.19354838709677 Confident
|
|
|
4198 4197 Q9NR30 EEYQLVQVEQK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26862 (Experiment 1) 26862 52.065 736.83728 2+ 2+ 1471.6595903338605 0 0.28278471004508154 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4199 4198 P52907 DHYSNGFCTVYAK Phosphorylation of Y(3) Carbamidomethylation of C(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26552 (Experiment 1) 26552 51.708 547.884705 3+ 3+ 1640.6330583161905 0 -0.47012096760114824 Phosphorylation of Y (3: Random) Phosphorylation of Y (3: 0.0, 11: 0.0) Phosphorylation of Y (3: 99.82547993019197) 0 Y3-{Y3 Y11} 1 100.0 Confident
|
|
|
4200 4199 P04632 THYSNIEANESEEVR Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16754 (Experiment 1) 16754 39.272 619.926758 3+ 3+ 1856.7578008049907 0 0.3461671279419694 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 100.0) Y3 1 0 100.0 Confident
|
|
|
4201 4200 Q8IXB1 ASNLLYGQLK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34759 (Experiment 1) 34759 61.239 593.797485 2+ 2+ 1185.5794895383603 0 0.7810143722835274 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 96.50959860383944) Y6 1 0 96.22641509433963 Confident
|
|
|
4202 4201 P62258 EAAENSLVAYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22846 (Experiment 1) 22846 47.261 597.805176 2+ 2+ 1193.5928174958503 0 2.4937706133109625 100.0 Confident
|
|
|
4203 4202 Q92841 SSQSSSQQFSGIGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19157 (Experiment 1) 19157 42.494 728.343018 2+ 2+ 1454.6749839800202 0 -2.4033354778670413 100.0 Confident
|
|
|
4204 4203 P68104, Q05639, Q5VTE0 QTVAVGVIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21459 (Experiment 1) 21459 45.381 457.787262 2+ 2+ 913.5596668927701 0 0.3322216805386323 99.73190348525469 Confident
|
|
|
4205 4204 P15153, P60763, P63000 TVFDEAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30582 (Experiment 1) 30582 56.401 475.751099 2+ 2+ 949.4868958753302 0 0.7873777247756093 99.45945945945947 Confident
|
|
|
4206 4205 P17980 AMEVDERPTEQYSDIGGLDK Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29660 (Experiment 1) 29660 55.335 778.673462 3+ 3+ 2331.9930223429 1 0.9333640263173671 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 92.32111692844677) Y12 1 0 92.64705882352942 Doubtful
|
|
|
4207 4206 P18124 SVNELIYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28393 (Experiment 1) 28393 53.869 523.251709 2+ 2+ 1044.4892775516303 0 -0.3941555132289358 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 95.63812600969305) Y7 1 0 99.46808510638297 Confident
|
|
|
4208 4207 P31146 DRPHEGTRPVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4160 (Experiment 1) 4160 16.737 440.569916 3+ 3+ 1318.6854295244202 0 1.883227262969117 97.74436090225565 Confident
|
|
|
4209 4208 P36578 SNYNLPMHK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16574 (Experiment 1) 16574 39.049 395.170441 3+ 3+ 1182.4892946349703 0 0.16783022076366355 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 97.38219895287958) Y3 1 0 97.74436090225565 Confident
|
|
|
4210 4209 Q16630 GAAPNVVYTYTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28407 (Experiment 1) 28407 53.886 670.84491 2+ 2+ 1339.6772158261504 0 -1.4524645822724733 99.73190348525469 Confident
|
|
|
4211 4210 P35579 TDLLLEPYNK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37159 (Experiment 1) 37159 64.118 603.324158 2+ 2+ 1204.6339540318402 0 -0.15826105381665062 100.0 Confident
|
|
|
4212 4211 P06576 AHGGYSVFAGVGER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27626 (Experiment 1) 27626 52.969 469.565033 3+ 3+ 1405.6738617812105 0 -0.42037584839543174 100.0 Confident
|
|
|
4213 4212 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31663 (Experiment 1) 31663 57.667 565.800415 2+ 2+ 1129.58800689893 0 -1.528657335553891 99.73614775725594 Confident
|
|
|
4214 4213 A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1 TAVCDIPPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17482 (Experiment 1) 17482 40.269 514.764404 2+ 2+ 1027.5120650773501 0 2.1271805773883936 100.0 Confident
|
|
|
4215 4214 Q14157 RYPSSISSSPQKDLTQAK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20565 (Experiment 1) 20565 44.204 691.671753 3+ 3+ 2071.9939487494203 0 -0.25019079953661766 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 99.82547993019197) Y2 1 0 100.0 Confident
|
|
|
4216 4215 P50991 TLSGMESYCVR Carbamidomethylation of C(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27840 (Experiment 1) 27840 53.219 651.795105 2+ 2+ 1301.5744076337303 0 0.9584559883757202 99.48849104859335 Confident
|
|
|
4217 4216 P13639 EDLYLKPIQR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26340 (Experiment 1) 26340 51.466 637.857727 2+ 2+ 1273.7030366511701 0 -1.6740262984495393 99.72826086956522 Confident
|
|
|
4218 4217 O00303 VIGLSSDLQQVGGASAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35917 (Experiment 1) 35917 62.605 829.448303 2+ 2+ 1656.8794974430002 0 1.540558527577971 100.0 Confident
|
|
|
4219 4218 Q15363 HEQEYMEVR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13861 (Experiment 1) 13861 35.036 650.754089 2+ 2+ 1299.4955022142203 0 -1.442284550165707 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 100.0) Y5 1 0 100.0 Confident
|
|
|
4220 4219 P07900, Q58FG0 HIYYITGETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19728 (Experiment 1) 19728 43.198 612.816956 2+ 2+ 1223.6186383208703 0 0.5880597153170535 100.0 Confident
|
|
|
4221 4220 P83881 DSLYAQGK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11214 (Experiment 1) 11214 30.888 481.204407 2+ 2+ 960.3953771667902 0 -1.1596933689523377 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 98.70759289176091) Y4 1 0 99.7289972899729 Confident
|
|
|
4222 4221 P82979 FGLNVSSISR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35864 (Experiment 1) 35864 62.543 540.295532 2+ 2+ 1078.57710786206 0 -0.5522860354300596 92.49329758713137 Confident
|
|
|
4223 4222 Q16658 YLTAEAFGFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43306 (Experiment 1) 43306 72.983 573.796204 2+ 2+ 1145.5757108797304 0 1.8684252672942256 100.0 Confident
|
|
|
4224 4223 P01889, P03989, P10319, P18463, P18464, P18465, P30460, P30461, P30462, P30464, P30466, P30475, P30479, P30480, P30481, P30483, P30484, P30485, P30486, P30487, P30488, P30490, P30491, P30492, P30493, P30495, P30498, P30685, Q04826, Q29718, Q29836, Q29940, Q31610, Q95365 DGEDQTQDTELVETRPAGDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20597 (Experiment 1) 20597 44.241 744.672302 3+ 3+ 2230.9938114707406 0 0.5663025807518456 100.0 Confident
|
|
|
4225 4224 Q15084 LAAVDATVNQVLASR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42829 (Experiment 1) 42829 72.123 764.428284 2+ 2+ 1526.8416553823001 0 0.23526350855679165 98.91304347826086 Confident
|
|
|
4226 4225 Q96EP5 IFVGGIPHNCGETELR Carbamidomethylation of C(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29850 (Experiment 1) 29850 55.554 600.30188 3+ 3+ 1797.8832029244504 0 0.337427628065573 99.24812030075188 Confident
|
|
|
4227 4226 Q00839 KAVVVCPK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6981 (Experiment 1) 6981 22.205 450.770325 2+ 2+ 899.5262585895102 0 -0.17916341896033933 99.73045822102425 Confident
|
|
|
4228 4227 O94905 VTKPNIPEAIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20646 (Experiment 1) 20646 44.296 413.246552 3+ 3+ 1236.7190210684803 0 -0.9634827438801828 100.0 Confident
|
|
|
4229 4228 P42224 SLEDLQDEYDFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41033 (Experiment 1) 41033 69.226 751.341064 2+ 2+ 1500.6620192544804 0 3.6972772439843853 92.22520107238606 Confident
|
|
|
4230 4229 A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7 FPGQLNADLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32123 (Experiment 1) 32123 58.197 565.80127 2+ 2+ 1129.58800689893 0 -0.017526077370984817 100.0 Confident
|
|
|
4231 4230 P29144 VNESSHYDLAFTDVHFKPGQIR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35709 (Experiment 1) 35709 62.346 661.060974 4+ 4+ 2639.216965810851 1 -2.092319727121608 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 100.0) Y7 1 0 100.0 Doubtful
|
|
|
4232 4231 Q00839 DIDIHEVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20043 (Experiment 1) 20043 43.601 498.758423 2+ 2+ 995.5036085686302 0 -1.3187752412650207 100.0 Confident
|
|
|
4233 4232 O43143 IIPLYSTLPPQQQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39214 (Experiment 1) 39214 66.639 931.483154 2+ 2+ 1860.9498991094704 0 0.9962384969106813 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.82547993019197) Y5 1 0 99.72826086956522 Confident
|
|
|
4234 4233 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32335 (Experiment 1) 32335 58.437 630.797852 2+ 2+ 1259.5798834611805 0 1.004764414626586 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4235 4234 Q8WUM4 TPSNELYKPLR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18778 (Experiment 1) 18778 42.022 699.344055 2+ 2+ 1396.6751808283502 0 -1.1609164885680485 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82547993019197) Y7 1 0 99.73045822102425 Confident
|
|
|
4236 4235 O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880 LLLPGELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37966 (Experiment 1) 37966 65.093 477.305725 2+ 2+ 952.5957180483204 0 1.2350779072489533 100.0 Confident
|
|
|
4237 4236 Q16658 LINRPIIVFR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35102 (Experiment 1) 35102 61.639 414.267639 3+ 3+ 1239.7815617553902 0 -0.38152118803056473 100.0 Confident
|
|
|
4238 4237 Q15056 GSNMDFREPTEEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19932 (Experiment 1) 19932 43.466 566.245911 3+ 3+ 1695.7158628158304 0 0.024008258374415902 100.0 Confident
|
|
|
4239 4238 Q92841 NFYVEHPEVAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22018 (Experiment 1) 22018 46.255 454.226166 3+ 3+ 1359.6571490879105 0 -0.3526056791145114 99.24812030075188 Confident
|
|
|
4240 4239 P31942 DGMDNQGGYGSVGR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15243 (Experiment 1) 15243 37.24 746.779968 2+ 2+ 1491.54497158778 0 0.27550197305389823 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
4241 4240 Q15819 YPEAPPSVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18986 (Experiment 1) 18986 42.274 508.2659 2+ 2+ 1014.5134449763402 0 3.7402708470899144 95.13513513513514 Confident
|
|
|
4242 4241 Q13162 LVQAFQYTDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28403 (Experiment 1) 28403 53.882 606.81665 2+ 2+ 1211.6186383208703 0 0.08960327244624773 99.45799457994579 Confident
|
|
|
4243 4242 Q9UQ80 MGVVECAK Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12654 (Experiment 1) 12654 33.189 447.214661 2+ 2+ 892.4146595352001 0 0.12245930071110575 99.72972972972973 Confident
|
|
|
4244 4243 P50914 VAYVSFGPHAGK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23863 (Experiment 1) 23863 48.542 656.807739 2+ 2+ 1311.6012876121004 0 -0.27599067654784815 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.19224555735056) Y3 1 0 99.7340425531915 Confident
|
|
|
4245 4244 P16949 SKESVPEFPLSPPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32596 (Experiment 1) 32596 58.74 514.612854 3+ 3+ 1540.8137092989602 0 1.9583048375302088 100.0 Confident
|
|
|
4246 4245 P13639 EGALCEENMR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17088 (Experiment 1) 17088 39.713 604.755859 2+ 2+ 1207.4961573130304 0 0.8331909233298739 100.0 Confident
|
|
|
4247 4246 P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3 TIGGGDDSFNTFFSETGAGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45452 (Experiment 1) 45452 77.555 669.971069 3+ 3+ 2006.8857645919009 0 2.7926695138717657 100.0 Confident
|
|
|
4248 4247 Q07955 EAGDVCYADVYR Phosphorylation of Y(7) Carbamidomethylation of C(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26947 (Experiment 1) 26947 52.163 749.289917 2+ 2+ 1496.5643100500301 0 0.64795812191609 Phosphorylation of Y (7: Doubtfull) Phosphorylation of Y (7: 28.74570798076519) Phosphorylation of Y (7: 0.0) 0 Y7-{Y7 Y11} 1 100.0 Confident
|
|
|
4249 4248 P63104 GIVDQSQQAYQEAFEISKK Phosphorylation of Y(10) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34882 (Experiment 1) 34882 61.384 750.354126 3+ 3+ 2248.0412928646606 0 -0.33062826608177354 Phosphorylation of Y (10: Very Confident) Phosphorylation of Y (10: 100.0) Phosphorylation of Y (10: 100.0) Y10 1 0 100.0 Confident
|
|
|
4250 4249 O43175 VTADVINAAEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20907 (Experiment 1) 20907 44.6 565.806885 2+ 2+ 1129.5979028762904 0 1.1613428949530702 100.0 Confident
|
|
|
4251 4250 P62318 VLHEAEGHIVTCETNTGEVYR Carbamidomethylation of C(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20300 (Experiment 1) 20300 43.898 805.38501 3+ 3+ 2413.1332225793603 0 -0.009097014086420802 100.0 Confident
|
|
|
4252 4251 P14618 LDIDSPPITAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32042 (Experiment 1) 32042 58.106 599.326599 2+ 2+ 1196.64010204144 0 -1.2155086189189261 100.0 Confident
|
|
|
4253 4252 O75367 SIAFPSIGSGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37028 (Experiment 1) 37028 63.962 546.295471 2+ 2+ 1090.57710786206 0 -0.6578813567509015 99.45945945945947 Confident
|
|
|
4254 4253 P63244 IIVDELKQEVISTSSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38341 (Experiment 1) 38341 65.56 597.003845 3+ 3+ 1787.9880448324705 0 0.9272796969573605 100.0 Confident
|
|
|
4255 4254 P25205 YVLCTAPR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20642 (Experiment 1) 20642 44.292 490.255249 2+ 2+ 978.49568673722 0 0.2634640063940392 99.73190348525469 Confident
|
|
|
4256 4255 P53621 DMSGHYQNALYLGDVSER Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37962 (Experiment 1) 37962 65.089 712.301575 3+ 3+ 2133.88268404828 0 0.09899894085592405 Phosphorylation of Y (6: Doubtfull) Phosphorylation of Y (6: 17.968109570903945) Phosphorylation of Y (6: 54.17903672815749) 0 Y6-{Y6 Y11} 1 100.0 Confident
|
|
|
4257 4256 P50990 LVPGGGATEIELAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31226 (Experiment 1) 31226 57.15 677.882324 2+ 2+ 1353.7503807664104 0 -0.21072977137011534 92.11956521739131 Confident
|
|
|
4258 4257 P30086 LYEQLSGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18344 (Experiment 1) 18344 41.465 469.252869 2+ 2+ 936.4916469026002 0 -0.49209714786170966 95.13513513513514 Confident
|
|
|
4259 4258 P15153, P60763, P63000 YLECSALTQR Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24497 (Experiment 1) 24497 49.326 620.802734 2+ 2+ 1239.5917719500303 0 -0.6901411802638161 99.72972972972973 Confident
|
|
|
4260 4259 P54819 APSVPAAEPEYPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22487 (Experiment 1) 22487 46.839 678.347229 2+ 2+ 1354.6768814729803 0 2.228652233516327 100.0 Confident
|
|
|
4261 4260 Q15717 DANLYISGLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40132 (Experiment 1) 40132 67.904 609.827209 2+ 2+ 1217.64043639461 0 -0.4684343024642813 99.7340425531915 Confident
|
|
|
4262 4261 Q13263 TVYCNVHK Phosphorylation of Y(3) Carbamidomethylation of C(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6536 (Experiment 1) 6536 21.145 550.734009 2+ 2+ 1099.4521808502602 0 1.165914572156354 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.82547993019197) Y3 1 0 99.7340425531915 Confident
|
|
|
4263 4262 O95861 LVASAYSIAQK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23349 (Experiment 1) 23349 47.875 615.808533 2+ 2+ 1229.6057042862003 0 -2.591074485599626 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 96.33507853403141) Y6 1 0 99.21671018276761 Confident
|
|
|
4264 4263 P29692 SLAGSSGPGASSGTSGDHGELVVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20287 (Experiment 1) 20287 43.883 729.021118 3+ 3+ 2184.0407020935104 0 0.3760779773957481 100.0 Confident
|
|
|
4265 4264 P78527 DQNILLGTTYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37187 (Experiment 1) 37187 64.15 647.343994 2+ 2+ 1292.6724647988801 0 0.7494224336402728 99.73262032085562 Confident
|
|
|
4266 4265 Q07020 TAVVVGTITDDVR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32902 (Experiment 1) 32902 59.085 673.370483 2+ 2+ 1344.7248942945603 0 1.1277399045374739 100.0 Confident
|
|
|
4267 4266 P09429 KHPDASVNFSEFSKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19365 (Experiment 1) 19365 42.743 430.972534 4+ 4+ 1719.8580337224305 0 1.7381708190844383 100.0 Doubtful
|
|
|
4268 4267 P63104 SVTEQGAELSNEER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17270 (Experiment 1) 17270 39.973 774.860657 2+ 2+ 1547.7063436779504 0 0.26933135268975494 95.13513513513514 Confident
|
|
|
4269 4268 Q15366 IANPVEGSTDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16063 (Experiment 1) 16063 38.425 579.791199 2+ 2+ 1157.5676653771702 0 0.15496029760923 92.40837696335078 Confident
|
|
|
4270 4269 Q9UL46 ALVHERDEAAYGELR Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17877 (Experiment 1) 17877 40.783 603.615967 3+ 3+ 1807.8254268723404 0 0.35603622635577625 Phosphorylation of Y (11: Very Confident) Phosphorylation of Y (11: 100.0) Phosphorylation of Y (11: 100.0) Y11 1 0 100.0 Confident
|
|
|
4271 4270 P68104, Q05639, Q5VTE0 IGGIGTVPVGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26731 (Experiment 1) 26731 51.913 513.308167 2+ 2+ 1024.60292868708 0 -1.1178659283571768 100.0 Confident
|
|
|
4272 4271 P49321 KPTDGASSSNCVTDISHLVR Carbamidomethylation of C(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28594 (Experiment 1) 28594 54.104 536.764893 4+ 4+ 2143.0327802621005 0 -1.0778121318175518 100.0 Doubtful
|
|
|
4273 4272 P62826 NLQYYDISAK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30808 (Experiment 1) 30808 56.661 647.788635 2+ 2+ 1293.5642333970404 0 -1.1703886174814155 Phosphorylation of Y (4: Random) Phosphorylation of Y (4: 0.0, 5: 0.0) Phosphorylation of Y (4: 0.3484331132862888) 0 Y4-{Y4 Y5} 1 100.0 Confident
|
|
|
4274 4273 Q9NWQ8 ENDYESISDLQQGR Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30462 (Experiment 1) 30462 56.261 867.354919 2+ 2+ 1732.6941379192701 0 0.661290919772849 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 100.0) Y4 1 0 100.0 Confident
|
|
|
4275 4274 Q9UN86 NSSYVHGGVDASGKPQEAVYGQNDIHHK Phosphorylation of Y(20) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17355 (Experiment 1) 17355 40.085 769.597473 4+ 4+ 3073.36794013083 1 -3.4148456377745484 Phosphorylation of Y (20: Doubtfull) Phosphorylation of Y (20: 11.191516047985935) Phosphorylation of Y (20: 15.10956321165745) 0 Y20-{Y4 Y20} 1 100.0 Doubtful
|
|
|
4276 4275 O43242 ISLADIAQK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34205 (Experiment 1) 34205 60.6 479.782166 2+ 2+ 957.5494961318902 0 0.2948573220897079 100.0 Confident
|
|
|
4277 4276 P26640 DPGVITYDLPTPPGEK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41420 (Experiment 1) 41420 69.787 889.912048 2+ 2+ 1777.8175475272403 0 -4.4973123376864175 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 98.86914378029078) Y7 1 0 99.73045822102425 Doubtful
|
|
|
4278 4277 O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880 ESYSVYVYK Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29907 (Experiment 1) 29907 55.621 609.260986 2+ 2+ 1216.5053215385904 0 1.7213734707586628 Phosphorylation of Y (8: Doubtfull) Phosphorylation of Y (8: 16.606058476426963) Phosphorylation of Y (8: 1.3122566787488257) 0 Y8-{Y3 Y6 Y8} 1 97.289972899729 Confident
|
|
|
4279 4278 Q06830 KQGGLGPMNIPLVSDPK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38743 (Experiment 1) 38743 66.045 584.322205 3+ 3+ 1749.9447405518504 0 0.025697988018301636 100.0 Confident
|
|
|
4280 4279 Q5H9M0 EKQMLVDK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32286 (Experiment 1) 32286 58.382 495.767609 2+ 2+ 989.5215671318904 0 -0.9097656616390101 91.35135135135135 Confident
|
|
|
4281 4280 GSTP1_HUMAN, P09211 FQDGDLTLYQSNTILR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44436 (Experiment 1) 44436 75.252 982.461792 2+ 2+ 1962.9088221431302 0 0.10632640853029678 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 99.82547993019197) Y9 1 0 100.0 Confident
|
|
|
4282 4281 Q14697 VVIIGAGKPAAVVLQTK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32916 (Experiment 1) 32916 59.1 555.353271 3+ 3+ 1663.0396269128607 0 -0.9863461462004329 97.76119402985076 Confident
|
|
|
4283 4282 P52272 MGLAMGGGGGASFDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33236 (Experiment 1) 33236 59.466 692.310364 2+ 2+ 1382.60710474434 0 -0.6714310431590624 100.0 Confident
|
|
|
4284 4283 Q02790 VGEVCHITCKPEYAYGSAGSPPK Phosphorylation of Y(13) Carbamidomethylation of C(5, 9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21117 (Experiment 1) 21117 44.878 863.051086 3+ 3+ 2586.1284107002402 0 1.1655945170171456 Phosphorylation of Y (13: Doubtfull) Phosphorylation of Y (13: 4.891373200721844) Phosphorylation of Y (13: 0.0) 0 Y13-{Y13 Y15} 1 100.0 Confident
|
|
|
4285 4284 Q9NZ08 VSVYAVPDK Phosphorylation of Y(4) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21237 (Experiment 1) 21237 45.055 529.25177 2+ 2+ 1056.4892775516303 0 -0.27443004561300555 Phosphorylation of Y (4: Very Confident) Phosphorylation of Y (4: 100.0) Phosphorylation of Y (4: 95.47657512116317) Y4 1 0 99.46091644204851 Confident
|
|
|
4286 4285 P08238 HLEINPDHPIVETLR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30191 (Experiment 1) 30191 55.954 594.988464 3+ 3+ 1781.94243205273 0 0.6333722520657016 100.0 Confident
|
|
|
4287 4286 Q14974 VAAGLQIK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19249 (Experiment 1) 19249 42.607 400.255005 2+ 2+ 798.4963383602203 0 -1.100914245944141 99.73262032085562 Confident
|
|
|
4288 4287 P63220 RMGESDDSILR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18823 (Experiment 1) 18823 42.077 426.874481 3+ 3+ 1277.60339926289 0 -1.3943683803769908 100.0 Confident
|
|
|
4289 4288 ALDOA_RABIT, P04075 AAQEEYVKR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6399 (Experiment 1) 6399 20.871 587.269958 2+ 2+ 1172.5227029382304 0 2.2648307936670107 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.82547993019197) Y6 1 0 99.73474801061008 Confident
|
|
|
4290 4289 P31948 TLLSDPTYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27100 (Experiment 1) 27100 52.342 533.281677 2+ 2+ 1064.5502244078803 0 -1.3345101345398866 99.72972972972973 Confident
|
|
|
4291 4290 P62333 GCLLYGPPGTGK Phosphorylation of Y(5) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30678 (Experiment 1) 30678 56.511 650.294556 2+ 2+ 1298.5730242589302 0 1.1800877329893373 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.67689822294022) Y5 1 0 99.74293059125964 Confident
|
|
|
4292 4291 Q15233 AAPGAEFAPNKR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13347 (Experiment 1) 13347 34.236 410.219574 3+ 3+ 1227.6360197205101 0 0.7092784193508755 100.0 Confident
|
|
|
4293 4292 Q8N183 YYYIPQYK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36423 (Experiment 1) 36423 63.245 609.268677 2+ 2+ 1216.5205776799103 0 1.8246387894541454 Phosphorylation of Y (2: Random) Phosphorylation of Y (1: 0.0, 2: 0.0) Phosphorylation of Y (2: 0.16155088852988692) 0 Y2-{Y1 Y2 Y3 Y7} 1 100.0 Confident
|
|
|
4294 4293 P52758 AAYQVAALPK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24507 (Experiment 1) 24507 49.337 556.280701 2+ 2+ 1110.5474611340903 0 -0.5501425598653138 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 92.08400646203555) Y3 1 0 99.19137466307278 Confident
|
|
|
4295 4294 P62158 VFDKDGNGYISAAELR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33409 (Experiment 1) 33409 59.664 585.957947 3+ 3+ 1753.8635130256903 1 -8.456023604682699 99.24812030075188 Doubtful
|
|
|
4296 4295 Q01844 QDHPSSMGVYGQESGGFSGPGENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25231 (Experiment 1) 25231 50.177 827.351563 3+ 3+ 2479.04586412694 0 -5.239392708843929 97.74436090225565 Doubtful
|
|
|
4297 4296 P25685 DGSDVIYPAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22483 (Experiment 1) 22483 46.834 546.769775 2+ 2+ 1091.5247379360303 0 0.23696482392129795 92.7807486631016 Confident
|
|
|
4298 4297 Q969X5 EYVAYSHTGR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10472 (Experiment 1) 10472 29.544 631.763916 2+ 2+ 1261.5128665305203 0 0.32649537251664257 Phosphorylation of Y (5: Doubtfull) Phosphorylation of Y (5: 19.70223358679372) Phosphorylation of Y (5: 98.42931937172776) 0 Y5-{Y2 Y5} 1 99.50124688279301 Confident
|
|
|
4299 4298 P53621 VLTIDPTEFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40523 (Experiment 1) 40523 68.513 581.820923 2+ 2+ 1161.6281403754103 0 -0.7281522406919696 100.0 Confident
|
|
|
4300 4299 P62241 ISSLLEEQFQQGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36818 (Experiment 1) 36818 63.71 753.894165 2+ 2+ 1505.7725727629704 0 0.7987224356841397 100.0 Confident
|
|
|
4301 4300 P63244 LTRDETNYGIPQR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17080 (Experiment 1) 17080 39.702 821.883484 2+ 2+ 1641.7511993029202 0 0.7396208698798251 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 100.0) Y8 1 0 100.0 Confident
|
|
|
4302 4301 P29401 ILATPPQEDAPSVDIANIR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40358 (Experiment 1) 40358 68.27 1010.535034 2+ 2+ 2019.0636693842202 0 -4.034637429841351 99.72826086956522 Confident
|
|
|
4303 4302 P00492 VIGGDDLSTLTGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35092 (Experiment 1) 35092 61.627 638.343323 2+ 2+ 1274.6717960925405 0 0.23261299511937872 100.0 Confident
|
|
|
4304 4303 P62942 GVQVETISPGDGR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21276 (Experiment 1) 21276 45.118 657.834961 2+ 2+ 1313.65754301073 0 -1.6523451100222921 100.0 Confident
|
|
|
4305 4304 P07900 ELHINLIPNKQDR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27795 (Experiment 1) 27795 53.168 398.224548 4+ 4+ 1588.86853883648 0 0.34358533576117506 100.0 Doubtful
|
|
|
4306 4305 P40227 IITEGFEAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25993 (Experiment 1) 25993 51.063 539.793823 2+ 2+ 1077.5706254992904 0 2.285662247618102 100.0 Confident
|
|
|
4307 4306 P51531, P51532 LTQVLNTHYVAPR Phosphorylation of Y(9) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26295 (Experiment 1) 26295 51.414 531.27063 3+ 3+ 1590.7919419160903 0 -1.1803866676323915 Phosphorylation of Y (9: Very Confident) Phosphorylation of Y (9: 100.0) Phosphorylation of Y (9: 100.0) Y9 1 0 100.0 Confident
|
|
|
4308 4307 E9PAV3, Q13765, Q9BZK3 NILFVITKPDVYK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42511 (Experiment 1) 42511 71.524 517.304565 3+ 3+ 1548.8915656968402 0 0.1932470748411658 92.14285714285715 Doubtful
|
|
|
4309 4308 Q14160 HCSLQAVPEEIYR Phosphorylation of Y(12) Carbamidomethylation of C(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29371 (Experiment 1) 29371 55.002 561.250793 3+ 3+ 1680.7331067106304 0 -1.518695512950693 Phosphorylation of Y (12: Very Confident) Phosphorylation of Y (12: 100.0) Phosphorylation of Y (12: 99.82547993019197) Y12 1 0 100.0 Confident
|
|
|
4310 4309 P23528 AVLFCLSEDKK Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31367 (Experiment 1) 31367 57.316 655.34436 2+ 2+ 1308.6747732980004 0 -0.4625288482594886 100.0 Confident
|
|
|
4311 4310 P22695 VTSEELHYFVQNHFTSAR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41304 (Experiment 1) 41304 69.606 749.007507 3+ 3+ 2244.000096759021 0 0.26472396029301515 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
4312 4311 P01903, P01906 VEHWGLDEPLLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39609 (Experiment 1) 39609 67.201 479.258026 3+ 3+ 1434.75071511958 0 1.0665664675096567 99.41176470588235 Confident
|
|
|
4313 4312 P13796 VYALPEDLVEVNPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44964 (Experiment 1) 44964 76.473 833.410767 2+ 2+ 1664.8062545675507 0 0.43585898485228547 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
4314 4313 P53396 FGGALDAAAK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20375 (Experiment 1) 20375 43.981 460.745667 2+ 2+ 919.4763311916304 0 0.48820314286852123 100.0 Confident
|
|
|
4315 4314 P13639 VFDAIMNFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44073 (Experiment 1) 44073 74.275 542.778259 2+ 2+ 1083.5423025764703 0 -0.3109096429684105 100.0 Confident
|
|
|
4316 4315 Q8WXX5 ELGLDEGVDSLK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36645 (Experiment 1) 36645 63.501 637.826599 2+ 2+ 1273.6401616110902 0 -1.1888363654254928 99.73045822102425 Confident
|
|
|
4317 4316 Q7L5N7 HLDEYASIASSSK Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18291 (Experiment 1) 18291 41.394 744.32373 2+ 2+ 1486.6341038620105 0 -0.8039476805393923 Phosphorylation of Y (5: Very Confident) Phosphorylation of Y (5: 100.0) Phosphorylation of Y (5: 99.47643979057592) Y5 1 0 99.72826086956522 Confident
|
|
|
4318 4317 O14818, Q8TAA3 LYQTDPSGTYHAWK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24330 (Experiment 1) 24330 49.129 582.924377 3+ 3+ 1745.7450512933203 0 3.574122035901252 Phosphorylation of Y (2: Doubtfull) Phosphorylation of Y (2: 7.894767180625688) Phosphorylation of Y (10: 99.47643979057592) 0 Y2-{Y2 Y10} 1 99.24812030075188 Confident
|
|
|
4319 4318 O14672 AIDTIYQTTDFSGIR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42156 (Experiment 1) 42156 70.972 890.905701 2+ 2+ 1779.8080454727003 0 -6.283681851622055 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.65095986038395) Y6 1 0 99.73262032085562 Doubtful
|
|
|
4320 4319 P00519 NKPTVYGVSPNYDKWEMER Phosphorylation of Y(12) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31106 (Experiment 1) 31106 57.011 798.360107 3+ 3+ 2392.05589738298 0 1.0831450497736586 Phosphorylation of Y (12: Doubtfull) Phosphorylation of Y (12: 5.76319562311595) Phosphorylation of Y (6: 1.3961605584642234) 0 Y12-{Y6 Y12} 1 100.0 Confident
|
|
|
4321 4320 P42704 ALYEHLTAK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17404 (Experiment 1) 17404 40.16 563.271606 2+ 2+ 1124.5267256895102 0 1.716205968146255 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 99.47643979057592) Y3 1 0 99.45652173913044 Confident
|
|
|
4322 4321 Q14978 NKPGPYSSVPPPSAPPPKK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11612 (Experiment 1) 11612 31.475 675.679138 3+ 3+ 2024.0132276420204 0 1.1627611152666655 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4323 4322 P09874 GIYFADMVSK Phosphorylation of Y(3) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44703 (Experiment 1) 44703 75.897 605.764099 2+ 2+ 1209.5141124004804 0 -0.3857392052815592 Phosphorylation of Y (3: Very Confident) Phosphorylation of Y (3: 100.0) Phosphorylation of Y (3: 90.95315024232633) Y3 1 0 97.8319783197832 Confident
|
|
|
4324 4323 P38919, P60842, Q14240 GIYAYGFEKPSAIQQR Phosphorylation of Y(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32521 (Experiment 1) 32521 58.655 636.640076 3+ 3+ 1906.8978635366104 0 0.28014945111243184 Phosphorylation of Y (5: Random) Phosphorylation of Y (3: 0.0, 5: 0.0) Phosphorylation of Y (5: 27.675950908829478) 0 Y5-{Y3 Y5} 1 97.74436090225565 Confident
|
|
|
4325 4324 P26640 LHEEGIIYR Phosphorylation of Y(8) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20850 (Experiment 1) 20850 44.531 605.287354 2+ 2+ 1208.55908844695 0 0.8810859492523281 Phosphorylation of Y (8: Very Confident) Phosphorylation of Y (8: 100.0) Phosphorylation of Y (8: 99.82547993019197) Y8 1 0 100.0 Confident
|
|
|
4326 4325 Q9UMS4 ATVLTTER ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13308 (Experiment 1) 13308 34.169 445.750549 2+ 2+ 889.4868958753302 0 -0.39350351550154905 99.1891891891892 Confident
|
|
|
4327 4326 P19338 ALVATPGKK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8223 (Experiment 1) 8223 24.921 442.781219 2+ 2+ 883.5491022090703 0 -1.3744271087422228 99.72972972972973 Confident
|
|
|
4328 4327 P60660 HVLVTLGEK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18982 (Experiment 1) 18982 42.269 498.298279 4+ 2+ 994.5811306133403 0 0.8774401195846122 100.0 Confident
|
|
|
4329 4328 P23528 HELQANCYEEVKDR Carbamidomethylation of C(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14036 (Experiment 1) 14036 35.339 597.609741 3+ 3+ 1789.8053465265702 0 1.1418127866453662 96.71052631578947 Confident
|
|
|
4330 4329 P68104, Q05639, Q5VTE0 LPLQDVYK Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28784 (Experiment 1) 28784 54.33 528.26239 2+ 2+ 1054.5100129962104 0 0.20261730989276847 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.82517482517483) Y7 1 0 100.0 Confident
|
|
|
4331 4330 Q14566 IQETQAELPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19072 (Experiment 1) 19072 42.379 592.818787 2+ 2+ 1183.6197009500302 0 2.800287133153219 99.18478260869566 Confident
|
|
|
4332 4331 Q9UHX1 SVFEAFGK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36042 (Experiment 1) 36042 62.769 442.728973 2+ 2+ 883.4439684341903 0 -0.6497964617774583 99.73045822102425 Confident
|
|
|
4333 4332 P09874 GIYFADMVSK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41082 (Experiment 1) 41082 69.305 565.78125 2+ 2+ 1129.5477818797303 0 0.14598103916645955 96.19565217391303 Confident
|
|
|
4334 4333 A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7 AVFPSIVGRPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29420 (Experiment 1) 29420 55.057 400.240051 3+ 3+ 1197.69822605425 0 0.08123901456768667 100.0 Confident
|
|
|
4335 4334 O14929 LLVTDMSDAEQYR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36853 (Experiment 1) 36853 63.753 770.869873 2+ 2+ 1539.7239083183904 0 0.8333112377529254 100.0 Confident
|
|
|
4336 4335 P62805 ISGLIYEETR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31092 (Experiment 1) 31092 56.994 630.796997 2+ 2+ 1259.5798834611805 0 -0.3506632495040093 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 99.83844911147011) Y6 1 0 100.0 Confident
|
|
|
4337 4336 P31943, P55795 DLNYCFSGMSDHR Carbamidomethylation of C(5) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32645 (Experiment 1) 32645 58.795 534.555237 3+ 3+ 1600.6398614246002 0 2.5068722329559567 100.0 Confident
|
|
|
4338 4337 O94903 APLEVAQEH ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16493 (Experiment 1) 16493 38.949 497.254395 2+ 2+ 992.4927095317603 0 1.5359713030031372 100.0 Confident
|
|
|
4339 4338 P27708 VLGTSPEAIDSAENR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24768 (Experiment 1) 24768 49.639 779.889648 2+ 2+ 1557.7634646312504 0 0.8196263256805784 91.32791327913279 Confident
|
|
|
4340 4339 P22090, P62701, Q8TD47 GNKPWISLPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31699 (Experiment 1) 31699 57.708 389.892456 3+ 3+ 1166.6560268891 0 -0.41745642485783885 98.51851851851852 Confident
|
|
|
4341 4340 P60709, P63261 GYSFTTTAER Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21113 (Experiment 1) 21113 44.872 606.750366 2+ 2+ 1211.4859830763403 0 0.16150799255545856 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
4342 4341 P20290 VQASLAANTFTITGHAETK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31265 (Experiment 1) 31265 57.195 654.009827 3+ 3+ 1959.0061545081005 0 0.7630326762984392 100.0 Confident
|
|
|
4343 4342 P53621 TLDLPIYVTR Phosphorylation of Y(7) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45860 (Experiment 1) 45860 78.479 635.827393 2+ 2+ 1269.63700441448 0 2.5389438460307914 Phosphorylation of Y (7: Very Confident) Phosphorylation of Y (7: 100.0) Phosphorylation of Y (7: 99.03069466882067) Y7 1 0 99.7289972899729 Confident
|
|
|
4344 4343 P31948 EGLQNMEAR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17669 (Experiment 1) 17669 40.518 524.248535 2+ 2+ 1046.4814932250601 0 0.9764856237191194 99.45945945945947 Confident
|
|
|
4345 4344 P13796 VYALPEDLVEVNPK Phosphorylation of Y(2) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44840 (Experiment 1) 44840 76.211 833.912842 2+ 2+ 1664.8062545675507 1 0.9129121847609198 Phosphorylation of Y (2: Very Confident) Phosphorylation of Y (2: 100.0) Phosphorylation of Y (2: 100.0) Y2 1 0 100.0 Confident
|
|
|
4346 4345 P61978 DYDDMSPR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18030 (Experiment 1) 18030 41.017 499.698334 2+ 2+ 997.3811104774502 0 1.0051964028315887 100.0 Confident
|
|
|
4347 4346 P31930 ADLTEYLSTHYK Phosphorylation of Y(11) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35096 (Experiment 1) 35096 61.632 507.561005 3+ 3+ 1519.6595903338603 0 1.0476687264289857 Phosphorylation of Y (11: Doubtfull) Phosphorylation of Y (11: 5.275914931706089) Phosphorylation of Y (6: 98.08027923211169) 0 Y11-{Y6 Y11} 1 99.25925925925925 Confident
|
|
|
4348 4347 P53396 EILIPVFK ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45554 (Experiment 1) 45554 77.784 479.802368 2+ 2+ 957.5899043918903 0 0.29040557666356864 96.22641509433963 Confident
|
|
|
4349 4348 P25789 VEIATLTR ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25563 (Experiment 1) 25563 50.57 451.768829 2+ 2+ 901.5232813840503 0 -0.195141440164142 99.7289972899729 Confident
|
|
|
4350 4349 Q9H6Z4 DTGQLYAALHHR Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26291 (Experiment 1) 26291 51.409 731.333557 2+ 2+ 1460.6561767192704 0 -2.471952724010381 Phosphorylation of Y (6: Very Confident) Phosphorylation of Y (6: 100.0) Phosphorylation of Y (6: 100.0) Y6 1 0 100.0 Confident
|
|
|
4351 4350 P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257 ESYSIYVYK Phosphorylation of Y(6) ProteinPilot formatted MGF of data 42.mgf File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35269 (Experiment 1) 35269 61.833 616.267639 2+ 2+ 1230.5209716027305 0 -0.2000237312796789 Phosphorylation of Y (6: Random) Phosphorylation of Y (6: 0.0, 8: 0.0) Phosphorylation of Y (6: 26.201045899998782) 0 Y6-{Y3 Y6 Y8} 1 99.72972972972973 Confident
|
