view KM Y PS/test-data/psm.tabular @ 5:c6ba972aa356 draft

Uploaded
author jfb
date Tue, 17 Sep 2019 14:29:08 -0400
parents e21ef020d1a6
children
line wrap: on
line source

	Protein(s)	Sequence	Variable Modifications	Fixed Modifications	Spectrum File	Spectrum Title	Spectrum Scan Number	RT	m/z	Measured Charge	Identification Charge	Theoretical Mass	Isotope Number	Precursor m/z Error [ppm]	Localization Confidence	Probabilistic PTM score	D-score	Confident Phosphosites	#Confident Phosphosites	Ambiguous Phosphosites	#Ambiguous Phosphosites	Confidence [%]	Validation
1	P30740	LGVQDLFNSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42979 (Experiment 1)	42979	72.404	604.32019	2+	2+	1206.6244519773002	0	1.1377169445543516								100.0	Confident
2	P15259, P18669, Q8N0Y7	HYGGLTGLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15926 (Experiment 1)	15926	38.245	530.282898	2+	2+	1058.5508931142201	0	0.32996752546837377								99.73045822102425	Confident
3	P49327	AGLYGLPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31918 (Experiment 1)	31918	57.964	464.230042	2+	2+	925.4422677895602	1	-0.09872263809433697	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65034965034964)	Y4	1		0	99.73614775725594	Confident
4	Q9NZT2	GTGTVGRAQNYQK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21349 (Experiment 1)	21349	45.224	730.334473	2+	2+	1458.6616560225305	0	-4.972324537127415	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Doubtful
5	P68104, Q05639, Q5VTE0	IGGIGTVPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26949 (Experiment 1)	26949	52.168	513.309326	2+	2+	1024.60292868708	0	1.1400344498829633								100.0	Confident
6	P07900	IMKDILEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20653 (Experiment 1)	20653	44.304	495.28952	2+	2+	988.5627036678802	0	1.8003628530197229								100.0	Confident
7	P49368	IPGGIIEDSCVLR		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38940 (Experiment 1)	38940	66.281	714.878845	2+	2+	1427.7442498401501	0	-0.7782947530783138								97.55434782608695	Confident
8	O75937	LLLDQEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21774 (Experiment 1)	21774	45.918	493.779602	2+	2+	985.5444107514504	0	0.2433423567884188								99.73474801061008	Confident
9	O43390	STAYEDYYYHPPPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25835 (Experiment 1)	25835	50.883	613.586731	3+	3+	1837.7348805324402	0	1.8921930883410392	Phosphorylation of Y (4: Random)	Phosphorylation of Y (8: 0.0, 9: 0.0)	Phosphorylation of Y (8: 0.0)		0	Y4-{Y4 Y7 Y8 Y9}	1	100.0	Confident
10	P46781	LFEGNALLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37446 (Experiment 1)	37446	64.463	516.795837	2+	2+	1031.57637958607	0	0.7173827502509798								99.73890339425587	Confident
11	P48643, P50991	SIHDALCVIR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29815 (Experiment 1)	29815	55.513	395.21344	3+	3+	1182.6179271282201	0	0.4752466681080597								99.38650306748467	Confident
12	O75534	EAFGFIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38122 (Experiment 1)	38122	65.287	484.746124	2+	2+	967.4763311916302	0	1.4067948118756286								99.73753280839895	Confident
13	P27348, P31946, P31947, P61981, P62258, P63104, Q04917	NLLSVAYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32924 (Experiment 1)	32924	59.11	454.26532	2+	2+	906.5174677276202	0	-1.519661622029727								99.73333333333333	Confident
14	P18621	YSLDPENPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24829 (Experiment 1)	24829	49.708	582.283264	2+	2+	1162.5506183307004	0	1.1650148132105416								100.0	Confident
15	GSTP1_HUMAN, P09211	ASCLYGQLPK	Phosphorylation of Y(5)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26922 (Experiment 1)	26922	52.134	608.775513	2+	2+	1215.5359104742201	0	0.46206886097144845	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
16	P07195	GLTSVINQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22443 (Experiment 1)	22443	46.784	480.279297	2+	2+	958.5447451046202	0	-0.7329461550348265								100.0	Confident
17	P0DMV8	AQIHDLVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29700 (Experiment 1)	29700	55.38	489.275574	3+	3+	1464.80487595076	0	0.011342486083281108								100.0	Confident
18	P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1	AGLQFPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34131 (Experiment 1)	34131	60.511	472.769287	2+	2+	943.5239500903901	0	0.07506408861235064								100.0	Confident
19	P26373	STESLQANVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14394 (Experiment 1)	14394	35.891	616.814819	2+	2+	1231.6156781987502	0	-0.4808023986747297								100.0	Confident
20	P62995	AAQDRDQIYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9039 (Experiment 1)	9039	26.698	439.197662	3+	3+	1314.5717783889702	0	-0.4719128891534078	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
21	P22626	YHTINGHNAEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8123 (Experiment 1)	8123	24.694	470.900421	3+	3+	1409.6800097908101	0	-0.40786472431578064								99.28057553956835	Confident
22	P17844	NFYQEHPDLAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21019 (Experiment 1)	21019	44.746	735.314148	2+	2+	1468.6136432009503	0	0.0679066442111905	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.16055846422339)	Y3	1		0	96.24664879356568	Doubtful
23	P23921	LNSAIIYDR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28290 (Experiment 1)	28290	53.749	572.771484	2+	2+	1143.5325393459402	0	-3.600270641154372	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.7340425531915	Confident
24	P14324	ATPEQYQILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28044 (Experiment 1)	28044	53.452	595.824951	2+	2+	1189.6342883850102	0	0.8900955793063253								99.45945945945947	Confident
25	P00390	GIYAVGDVCGK	Phosphorylation of Y(3)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26504 (Experiment 1)	26504	51.655	609.764526	2+	2+	1217.5151750296402	0	-0.554281907818625	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
26	P14866	SSSGLLEWESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37035 (Experiment 1)	37035	63.97	611.800781	2+	2+	1221.5877321154103	0	-0.5909183426772361								100.0	Confident
27	P48643	MLVIEQCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24471 (Experiment 1)	24471	49.295	511.269989	2+	2+	1019.5143735764702	1	7.534443622841497								99.1869918699187	Doubtful
28	P08238	LGIHEDSTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9811 (Experiment 1)	9811	28.228	571.284607	2+	2+	1140.5523496662001	0	2.0229889125561833								97.56756756756756	Confident
29	Q9NRZ9	KQEIFYTAIVNR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34711 (Experiment 1)	34711	61.184	521.26355	3+	3+	1560.77014384235	0	-0.8461757117854006	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
30	Q13162	TREEECHFYAGGQVYPGEASR	Phosphorylation of Y(15)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23112 (Experiment 1)	23112	47.582	841.685974	3+	3+	2522.0322018162806	0	1.5408712981796213	Phosphorylation of Y (15: Doubtfull)	Phosphorylation of Y (15: 13.010422045779276)	Phosphorylation of Y (9: 97.73828756058158)		0	Y15-{Y9 Y15}	1	92.5925925925926	Doubtful
31	Q99729	EVYQQQQYGSGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13284 (Experiment 1)	13284	34.129	750.347046	2+	2+	1498.68006936046	0	-0.3533657523326055								100.0	Confident
32	P84103	DSCPLDCK		Carbamidomethylation of C(3, 7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13000 (Experiment 1)	13000	33.729	497.702148	2+	2+	993.3895669861702	0	0.17689318582979516								97.8891820580475	Confident
33	Q9Y619	TYSQVGFR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21268 (Experiment 1)	21268	45.104	519.225586	2+	2+	1036.4379106851102	0	-1.243791872556536	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 90.92495636998254)	Y2	1		0	92.43243243243244	Confident
34	P30041	LPFPIIDDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44500 (Experiment 1)	44500	75.404	543.303833	2+	2+	1084.5916952970401	0	1.3047682526574569								100.0	Confident
35	P07900	ELHINLIPNKQDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27794 (Experiment 1)	27794	53.167	530.630066	3+	3+	1588.86853883648	0	-0.10694010045463341								96.71052631578947	Confident
36	Q9H4M9, Q9NZN3, Q9NZN4	LLPLEEHYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27510 (Experiment 1)	27510	52.824	625.301941	2+	2+	1248.5903885752302	0	-0.8471970796711754	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 98.60383944153578)	Y8	1		0	98.91304347826086	Confident
37	Q6P2Q9	TNHIYVSSDDIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21740 (Experiment 1)	21740	45.87	491.222595	3+	3+	1470.6391892424504	0	4.591528871355824	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 95.63812600969305)	Y5	1		0	97.74436090225565	Confident
38	O75533	GAEYVSAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9233 (Experiment 1)	9233	27.131	466.698029	2+	2+	931.3800614558202	0	1.5466240469973638	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 85.29886914378028)	Y4	1		0	96.48648648648648	Confident
39	P61247	TSYAQHQQVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6110 (Experiment 1)	6110	20.31	406.538483	3+	3+	1216.5948831845203	0	-1.0360508701704279								100.0	Confident
40	P62917	ASGNYATVISHNPETKK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13614 (Experiment 1)	13614	34.66	632.967102	3+	3+	1895.8778563680203	0	0.853247570548678	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
41	P07900, P08238, Q58FF6, Q58FF7	VILHLKEDQTEYLEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29147 (Experiment 1)	29147	54.746	672.352844	3+	3+	2014.0371202832105	0	-0.20707557735279472								100.0	Confident
42	Q9Y295	IGFVGFPSVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43817 (Experiment 1)	43817	73.805	554.313538	2+	2+	1106.6124307416203	0	0.08327846687974895								96.75675675675676	Confident
43	Q8NC51	PGHLQEGFGCVVTNR		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25175 (Experiment 1)	25175	50.112	557.606873	3+	3+	1669.7994733004903	0	-0.4087112743590119								100.0	Confident
44	P24534	SIQADGLVWGSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37284 (Experiment 1)	37284	64.262	674.348938	2+	2+	1346.6830294825802	0	0.2176794853329661								100.0	Confident
45	Q14566	VSGVDGYETEGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25174 (Experiment 1)	25174	50.111	691.333069	2+	2+	1380.6521232771202	0	-0.3892555982674392								100.0	Confident
46	P55209	KYAVLYQPLFDKR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36279 (Experiment 1)	36279	63.074	574.299377	3+	3+	1719.8749432640602	0	0.7884021407948746	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 4.524113279641968)	Phosphorylation of Y (6: 0.7558777175368706)		0	Y6-{Y2 Y6}	1	100.0	Confident
47	P06276, P68104, Q05639, Q5VTE0	QLIVGVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21517 (Experiment 1)	21517	45.499	435.7742	2+	2+	869.5334521449302	0	0.4531264412793118								100.0	Confident
48	E9PAV3, Q13765	IEDLSQQAQLAAAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28978 (Experiment 1)	28978	54.551	807.921509	2+	2+	1613.8260648878106	0	1.485405515120204								99.7289972899729	Confident
49	P11142	DAGTIAGLNVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42119 (Experiment 1)	42119	70.92	600.340454	2+	2+	1198.66698549562	0	-0.525059496655302								98.93617021276596	Confident
50	Q96AG4	LQQLPADFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31143 (Experiment 1)	31143	57.054	572.808472	2+	2+	1143.60365696307	0	-1.1049900247621283								100.0	Confident
51	P78371	ILIANTGMDTDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27875 (Experiment 1)	27875	53.258	646.331177	2+	2+	1290.6489524729802	0	-0.8907241517271113								99.73333333333333	Confident
52	P55209, Q99733	FYEEVHDLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25060 (Experiment 1)	25060	49.978	446.210449	3+	3+	1335.6095301891503	0	-0.009404819514532673								100.0	Confident
53	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43621 (Experiment 1)	43621	73.47	586.326111	3+	3+	1755.9559568585505	0	0.3108288334089308								100.0	Confident
54	Q7KZF4	SSHYDELLAAEAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28897 (Experiment 1)	28897	54.46	514.559692	3+	3+	1540.6559019357505	0	0.8710780665557134	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.51534733441034)	Y4	1		0	100.0	Confident
55	P62899	EYTINIHKR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11985 (Experiment 1)	11985	32.09	418.539398	3+	3+	1252.5965365848303	0	-0.1369725634175551	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.70759289176091)	Y2	1		0	100.0	Confident
56	Q02878	FVIATSTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21187 (Experiment 1)	21187	44.98	433.752563	2+	2+	865.4909186266102	0	-0.3983378150775732								99.73118279569893	Confident
57	P07900, Q14568	ELISNSSDALDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23600 (Experiment 1)	23600	48.191	646.321777	2+	2+	1290.6303252033804	0	-1.0243625507100564								99.45799457994579	Confident
58	P16401	KATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24054 (Experiment 1)	24054	48.78	447.597443	3+	3+	1339.7711162109902	0	-0.45920067436193274								100.0	Confident
59	P27635, Q96L21	VHIGQVIMSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36198 (Experiment 1)	36198	62.976	418.244904	3+	3+	1251.7121618662302	0	0.5744112607890343								98.49624060150376	Confident
60	Q14103	DLKDYFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32675 (Experiment 1)	32675	58.827	508.260712	2+	2+	1014.5022115863003	0	4.583771009439568								100.0	Confident
61	Q8WWY3	IYEYVESR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21437 (Experiment 1)	21437	45.35	569.747437	2+	2+	1137.4743557634804	0	5.235068854042567	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 4: 0.0)	Phosphorylation of Y (2: 71.29144851657941)		0	Y2-{Y2 Y4}	1	99.72972972972973	Doubtful
62	Q99623	FNASQLITQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34211 (Experiment 1)	34211	60.607	589.32074	2+	2+	1176.6251206836403	0	1.5325996367072108								100.0	Confident
63	P62191, P62195, Q8NB90	GVLLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31587 (Experiment 1)	31587	57.58	619.813354	2+	2+	1237.6107896666401	0	1.1014616181275079	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	99.7289972899729	Confident
64	P26641	LDPGSEETQTLVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25667 (Experiment 1)	25667	50.691	722.864136	2+	2+	1443.7205371901102	0	-4.716025626614718								99.73045822102425	Doubtful
65	O94776	TLLADQGEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25916 (Experiment 1)	25916	50.974	558.306641	2+	2+	1114.5982372294602	0	0.44047222099201877								99.45799457994579	Confident
66	Q92598	MFEELGQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28452 (Experiment 1)	28452	53.94	505.241486	2+	2+	1008.4698659122	0	-1.431833877827951								99.48453608247422	Confident
67	P28066	ITSPLMEPSSIEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34212 (Experiment 1)	34212	60.608	716.37439	2+	2+	1430.7326820969404	0	1.0783265865726896								99.45652173913044	Confident
68	B2RPK0, P09429, P26583	MSSYAFFVQTCR		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41923 (Experiment 1)	41923	70.557	748.837341	2+	2+	1495.6588059640305	0	0.8834385265217706								100.0	Confident
69	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25915 (Experiment 1)	25915	50.973	523.252197	2+	2+	1044.4892775516303	0	0.5384736579269738	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
70	P26368	ELLTSFGPLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43318 (Experiment 1)	43318	73.001	552.819092	2+	2+	1103.62266107215	0	0.8773169113545851								99.45652173913044	Confident
71	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34159 (Experiment 1)	34159	60.543	630.796875	2+	2+	1259.5798834611805	0	-0.5440693022156452	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
72	P61326, Q96A72	IGSLIDVNQSKDPEGLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30717 (Experiment 1)	30717	56.556	614.331482	3+	3+	1839.9690407233902	0	1.9402571287983736								100.0	Confident
73	P21127, Q9UQ88	IEEGTYGVVYR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26673 (Experiment 1)	26673	51.846	683.309326	2+	2+	1364.6013471817503	0	2.013648915882647	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 10: 0.0)	Phosphorylation of Y (6: 98.60383944153578)		0	Y6-{Y6 Y10}	1	99.7289972899729	Confident
74	P32119	GLFIIDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41593 (Experiment 1)	41593	70.05	431.754852	2+	2+	861.4960040070503	0	-0.9877594052163768								97.6	Confident
75	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32593 (Experiment 1)	32593	58.737	616.267334	2+	2+	1230.5209716027305	0	-0.6949384724032491	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 29.623691721910546)	Phosphorylation of Y (3: 62.882144033976495)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
76	Q8TCJ2	ESDYFTPQGEFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38121 (Experiment 1)	38121	65.285	778.308777	2+	2+	1554.6028037337305	0	0.12677016892552195	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
77	P30041	VVFVFGPDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40800 (Experiment 1)	40800	68.891	504.281464	2+	2+	1006.5487678559002	0	-0.38945450026624295								100.0	Confident
78	TRYP_PIG	VATVSLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23032 (Experiment 1)	23032	47.485	421.757507	2+	2+	841.5021520166501	0	-2.004643493349334								99.73045822102425	Confident
79	P09382	SFVLNLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38611 (Experiment 1)	38611	65.882	439.260071	2+	2+	876.5069030439201	0	-1.4956692692705729								99.18478260869566	Confident
80	Q14444	DGYQQNFK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12831 (Experiment 1)	12831	33.491	540.214233	2+	2+	1078.4120898600902	0	1.6874873439076907	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.65095986038395)	Y3	1		0	99.45799457994579	Confident
81	P62158	DTDSEEEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12242 (Experiment 1)	12242	32.525	547.236023	2+	2+	1092.4571118686802	0	0.34829380060429543								96.4769647696477	Confident
82	Q53GQ0	SYAEELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18499 (Experiment 1)	18499	41.667	455.729187	2+	2+	909.4443623570103	0	-0.5938727737098363								92.43243243243244	Confident
83	Q9NR30	TFHHVYSGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5827 (Experiment 1)	5827	19.683	385.83725	3+	3+	1154.4910088871302	0	-0.940194812686852	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	99.37888198757764	Confident
84	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28612 (Experiment 1)	28612	54.125	600.288086	3+	3+	1797.84107693648	0	0.7505641208417713	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
85	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGRPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29317 (Experiment 1)	29317	54.94	599.856445	2+	2+	1197.69822605425	0	0.09253225258847216								100.0	Confident
86	Q02878	VLATVTKPVGGDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13444 (Experiment 1)	13444	34.39	428.922485	3+	3+	1283.7449014631502	0	0.5627565560113915								100.0	Confident
87	O75746, Q9UJS0	KIYSTLAGTR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15678 (Experiment 1)	15678	37.872	595.302856	2+	2+	1188.5903885752302	0	0.6471425733225004	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.67689822294022)	Y3	1		0	100.0	Confident
88	P11908, P21108, P60891	VYAILTHGIFSGPAISR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45204 (Experiment 1)	45204	77.022	627.991943	3+	3+	1880.9549844899102	0	-0.5227720102262337	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
89	P02786	VEYHFLSPYVSPK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36698 (Experiment 1)	36698	63.565	549.260193	3+	3+	1644.7589104523104	0	-0.0976178095092125	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 28.694997620669156)	Phosphorylation of Y (3: 15.545863386177523)		0	Y3-{Y3 Y9}	1	100.0	Confident
90	O60506	LKDYAFIHFDER	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35662 (Experiment 1)	35662	62.289	545.252197	3+	3+	1632.7337583336305	0	0.6133348656290125	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.60383944153578)	Y4	1		0	99.4186046511628	Confident
91	P13639	IKPVLMMNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22363 (Experiment 1)	22363	46.685	537.314636	2+	2+	1072.6136936949201	0	0.9541638783854479								100.0	Confident
92	Q92614	REDMAPHIYAVAQTAYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29146 (Experiment 1)	29146	54.745	691.31958	3+	3+	2070.9346600514905	0	1.0851471979056435	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 5.529757514608989)	Phosphorylation of Y (9: 25.040387722132472)		0	Y9-{Y9 Y16}	1	100.0	Confident
93	P23284	VLEGMEVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29701 (Experiment 1)	29701	55.382	516.280457	2+	2+	1030.5481162329004	0	-1.6998159792413712								100.0	Confident
94	O14979, Q14103, Q99729	FGEVVDCTIK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28450 (Experiment 1)	28450	53.937	584.288757	2+	2+	1166.5641602198602	0	-1.0261640665059493								100.0	Confident
95	P30044	LLADPTGAFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34132 (Experiment 1)	34132	60.513	545.301086	2+	2+	1088.5866099166003	0	0.9253151473059585								99.73262032085562	Confident
96	P13639	IMGPNYTPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20074 (Experiment 1)	20074	43.639	539.273438	2+	2+	1076.5324661687603	0	-0.13268071003413973								99.18478260869566	Confident
97	P61247	ACQSIYPLHDVFVR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39669 (Experiment 1)	39669	67.278	568.955872	3+	3+	1703.8453608637503	0	0.24942527234712486								100.0	Confident
98	O95373	AIFQTIQNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28207 (Experiment 1)	28207	53.656	545.804382	2+	2+	1089.5930922793702	0	1.0248984702391264								99.72972972972973	Confident
99	O75608	ASFPQGPIGGANR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25665 (Experiment 1)	25665	50.689	636.328796	2+	2+	1270.6418333769402	0	0.9473801794685359								99.7289972899729	Confident
100	P62995	AAQDRDQIYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9151 (Experiment 1)	9151	26.949	439.198059	3+	3+	1314.5717783889702	0	0.432007707471799	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
101	Q9NUU7, Q9UMR2	LKPQLLQGVYAMGFNRPSK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41948 (Experiment 1)	41948	70.608	743.054199	3+	3+	2226.1384452384805	0	1.0418098285039168	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.30191972076788)	Y10	1		0	99.24812030075188	Confident
102	P07737	CYEMASHLR	Phosphorylation of Y(2)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16264 (Experiment 1)	16264	38.675	416.162781	3+	3+	1245.4671792914	0	-0.5331979948212491	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
103	P10696	VQHASPAGAYAHTVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10539 (Experiment 1)	10539	29.665	560.285339	3+	3+	1677.8335503100907	0	0.3791459284331951								100.0	Confident
104	P00505	EFSIYMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36001 (Experiment 1)	36001	62.713	509.749725	2+	2+	1017.4841189940103	0	0.763191151956956								96.22641509433963	Confident
105	P42677	DLLHPSPEEEKRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12662 (Experiment 1)	12662	33.199	526.614136	3+	3+	1576.8209199377206	0	-0.2160583113022681								97.74436090225565	Confident
106	P23396	KPLPDHVSIVEPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20315 (Experiment 1)	20315	43.914	486.948456	3+	3+	1457.8242144130104	0	-0.4626178434339644								100.0	Confident
107	P29401	LGQSDPAPLQHQMDIYQK	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28614 (Experiment 1)	28614	54.129	716.996216	3+	3+	2147.9711051298605	0	-1.9928146800740238	Phosphorylation of Y (16: Very Confident)	Phosphorylation of Y (16: 100.0)	Phosphorylation of Y (16: 100.0)	Y16	1		0	100.0	Confident
108	P62266	ANPFGGASHAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9756 (Experiment 1)	9756	28.138	528.765198	2+	2+	1055.5148419586703	0	0.9466476397427135								99.7289972899729	Confident
109	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33489 (Experiment 1)	33489	59.759	630.797485	2+	2+	1259.5798834611805	0	0.4229609611623073	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
110	P10412, P16402, P16403	SGVSLAALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28870 (Experiment 1)	28870	54.429	423.258484	2+	2+	844.5018176634801	0	0.7057192474423357								99.46666666666667	Confident
111	P27695	EGYSGVGLLSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34577 (Experiment 1)	34577	61.033	609.280945	2+	2+	1216.5489176860701	0	-1.2971172470148709	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
112	Q96FW1	LLTSGYLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28871 (Experiment 1)	28871	54.431	525.802551	2+	2+	1049.5869442697701	0	3.427911252789689								96.4769647696477	Confident
113	P07900, P08238, Q14568	HNDDEQYAWESSAGGSFTVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35665 (Experiment 1)	35665	62.294	752.658447	3+	3+	2254.9515527359404	0	0.8675317605022779								100.0	Confident
114	P01911, P01912, Q5Y7A7, Q9GIY3	HNYGVVESFTVQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32255 (Experiment 1)	32255	58.347	539.247131	3+	3+	1614.7191708986504	0	0.2427464677111352	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
115	O00487	AVAVVVDPIQSVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36277 (Experiment 1)	36277	63.072	662.895203	2+	2+	1323.7762015914302	0	-0.2628808905843702								100.0	Confident
116	Q14444	EKPVCGTTYK	Phosphorylation of Y(9)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6358 (Experiment 1)	6358	20.788	631.777405	2+	2+	1261.5413897774802	0	-0.8964471345754867	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 94.58987783595113)	Y9	1		0	93.76693766937669	Confident
117	P19338	EAMEDGEIDGNKVTLDWAKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34576 (Experiment 1)	34576	61.032	587.287109	4+	4+	2345.1209265601606	0	-0.6795766072306796								100.0	Doubtful
118	P07900	NPDDITNEEYGEFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36752 (Experiment 1)	36752	63.63	917.395264	2+	2+	1832.7740888846006	0	1.0280103834701506								100.0	Confident
119	Q9UKD2	SPSDEYKDNLHQVSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10613 (Experiment 1)	10613	29.792	609.602966	3+	3+	1825.7883726572807	0	-0.7130634523787324	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82758620689656)	Y6	1		0	99.24812030075188	Confident
120	Q9Y2X3	TQLYEYLQNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38069 (Experiment 1)	38069	65.221	704.319519	2+	2+	1406.6231452554903	0	0.9511394500752492	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 6: 0.0)	Phosphorylation of Y (4: 0.16155088852988692)		0	Y4-{Y4 Y6}	1	100.0	Confident
121	P06748	ADKDYHFKVDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21401 (Experiment 1)	21401	45.292	644.055969	4+	4+	2572.1942426127903	0	0.20476483988193472								100.0	Doubtful
122	P14625, Q58FF3	GLFDEYGSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33873 (Experiment 1)	33873	60.199	548.222717	2+	2+	1094.4321565983303	0	-1.1633323747931765	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.73684210526315	Confident
123	P53675, Q00610	GQFSTDELVAEVEKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40470 (Experiment 1)	40470	68.434	569.956909	3+	3+	1706.8475286083806	0	0.8006408075141892								96.2406015037594	Confident
124	P13796	VYALPEDLVEVNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43461 (Experiment 1)	43461	73.206	793.426819	2+	2+	1584.8399240468007	0	-0.5287065934088726								100.0	Confident
125	Q6UUV9	SQYLQLGPSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29646 (Experiment 1)	29646	55.319	614.790588	2+	2+	1227.56490210338	0	1.399635451499415	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
126	P06733, P13929	VNQIGSVTESIQACK		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31169 (Experiment 1)	31169	57.086	817.412781	2+	2+	1632.8141203051202	0	-1.9030977345361844								100.0	Confident
127	P23246	FAQHGTFEYEYSQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24132 (Experiment 1)	24132	48.878	588.264648	3+	3+	1761.7746980212903	0	-1.4638637861404789								100.0	Confident
128	P0DMV8, P11142, P17066, P34931, P48741, P54652	TTPSYVAFTDTER	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31168 (Experiment 1)	31168	57.085	784.337036	2+	2+	1566.6603186098505	0	-0.5096935567195194	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
129	P31949	ISSPTETER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9918 (Experiment 1)	9918	28.403	510.254364	2+	2+	1018.4931034545803	0	1.0500771739857175								99.7289972899729	Confident
130	P17987	YPVNSVNILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33344 (Experiment 1)	33344	59.59	573.829651	2+	2+	1145.6444591458903	0	0.25261901183638563								97.86666666666667	Confident
131	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34631 (Experiment 1)	34631	61.092	954.45752	2+	2+	1906.8978635366104	0	1.374358374370048	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 10.436287809638344)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y5}	1	100.0	Confident
132	O15144	YFQFQEEGKEGENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23965 (Experiment 1)	23965	48.67	587.600464	3+	3+	1759.7801773245506	0	-0.34872038058997407								98.7012987012987	Confident
133	P26639	IYGISFPDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42538 (Experiment 1)	42538	71.584	608.786133	2+	2+	1215.5576914646201	0	0.017741662339480883	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
134	Q1KMD3	EGCTEVSLLR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29315 (Experiment 1)	29315	54.938	582.290649	2+	2+	1162.56522284902	0	1.30709581902052								99.73045822102425	Confident
135	P18085, P61204, P84077, P84085	ILMVGLDAAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38067 (Experiment 1)	38067	65.219	544.313416	2+	2+	1086.6107164894604	0	1.4353671178364644								100.0	Confident
136	P04406	VIPELNGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21661 (Experiment 1)	21661	45.745	435.257721	2+	2+	868.5018176634801	0	-1.0667198634877189								97.289972899729	Confident
137	P19338	EAMEDGEIDGNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15509 (Experiment 1)	15509	37.626	654.276123	2+	2+	1306.5347105663802	0	2.279241660049499								98.6449864498645	Confident
138	P06733	DATNVGDEGGFAPNILENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41833 (Experiment 1)	41833	70.417	980.966248	2+	2+	1959.9173990733505	0	0.27727415558261215								100.0	Confident
139	P53701	TYSVPAHQER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8622 (Experiment 1)	8622	25.82	634.276245	2+	2+	1266.5394156315303	0	-1.1655516368211654	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.7289972899729	Confident
140	P05141	AAYFGIYDTAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39807 (Experiment 1)	39807	67.469	650.286499	2+	2+	1298.5584197406101	0	0.019472775731016422	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 33.59790818475573)	Phosphorylation of Y (7: 10.131012094362879)		0	Y7-{Y3 Y7}	1	100.0	Confident
141	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28292 (Experiment 1)	28292	53.751	609.260071	2+	2+	1216.5053215385904	0	0.21955143382241052	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 35.432414957046376)	Phosphorylation of Y (3: 3.4904013961605584)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
142	Q9NR30	LLDSVPPTAISHFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34237 (Experiment 1)	34237	60.637	508.952148	3+	3+	1523.8347790967102	0	-0.10773581827294523								100.0	Confident
143	Q08211	LETHMTPEMFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30215 (Experiment 1)	30215	55.981	464.553467	3+	3+	1390.6373422434604	0	0.8821067077582139								100.0	Confident
144	Q9UJZ1	APVPGTPDSLSSGSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20655 (Experiment 1)	20655	44.306	757.875366	2+	2+	1513.7372498834102	0	-0.7064593506472471								98.91598915989161	Confident
145	Q96A33	LNQENEHIYNLWCSGR	Phosphorylation of Y(9)	Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38147 (Experiment 1)	38147	65.316	704.970703	3+	3+	2111.8884381350604	0	0.8707057371024091	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
146	Q86XP3	SEYTQPTPIQCQGVPVALSGR	Phosphorylation of Y(3)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39200 (Experiment 1)	39200	66.621	790.038513	3+	3+	2367.0930111676903	0	0.2946827138162504	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
147	Q9Y2X3	TQLYEYLQNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37862 (Experiment 1)	37862	64.964	704.318115	2+	2+	1406.6231452554903	0	-1.0422758926838664	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 6: 0.0)	Phosphorylation of Y (4: 1.1308562197092082)		0	Y4-{Y4 Y6}	1	100.0	Confident
148	Q02790	VGEVCHITCKPEYAYGSAGSPPK	Phosphorylation of Y(13)	Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20156 (Experiment 1)	20156	43.735	863.05011	3+	3+	2586.1284107002402	0	0.03472155539364804	Phosphorylation of Y (15: Doubtfull)	Phosphorylation of Y (15: 6.531290984664615)	Phosphorylation of Y (13: 0.0)		0	Y15-{Y13 Y15}	1	100.0	Confident
149	P15144	SEYMEGNVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15425 (Experiment 1)	15425	37.515	582.72406	2+	2+	1163.4318393285	0	1.4824687667529992	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.65095986038395)	Y3	1		0	100.0	Confident
150	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24554 (Experiment 1)	24554	49.391	420.23526	3+	3+	1257.68296991293	0	0.7778876025428992								99.24812030075188	Confident
151	Q7L5N7	HLDEYASIASSSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18145 (Experiment 1)	18145	41.193	496.552094	3+	3+	1486.6341038620105	0	0.23410610851716038	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
152	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36699 (Experiment 1)	36699	63.567	964.384521	2+	2+	1926.7560694694905	0	-0.8193836511202574	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 14: 0.0)	Phosphorylation of Y (10: 3.311793214862682)		0	Y10-{Y10 Y14}	1	100.0	Confident
153	P62805	ISGLIYEETR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30998 (Experiment 1)	30998	56.883	590.815002	2+	2+	1179.6135529404305	0	1.606364926501868								100.0	Confident
154	P78527	SIGEYDVLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33346 (Experiment 1)	33346	59.592	566.258545	2+	2+	1130.5009048644902	0	1.441218196627768	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
155	P50991	AYILNLVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40803 (Experiment 1)	40803	68.894	467.292542	2+	2+	932.5695033004804	0	1.099704075718369								97.84946236559139	Confident
156	P13796	GSVSDEEMMELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32949 (Experiment 1)	32949	59.137	691.800171	2+	2+	1381.58536624025	0	0.3055985475674535								100.0	Confident
157	P23284	HYGPGWVSMANAGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29725 (Experiment 1)	29725	55.41	777.833496	2+	2+	1553.6486488106805	0	2.436424343695637	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
158	P62249	EIKDILIQYDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37786 (Experiment 1)	37786	64.875	469.2612	3+	3+	1404.76127980328	0	0.3486306097997088								99.29078014184397	Confident
159	Q96RP9	EYGCPCITGKPK	Phosphorylation of Y(2)	Carbamidomethylation of C(4, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14477 (Experiment 1)	14477	36.023	497.21167	3+	3+	1488.61423744791	0	-0.7085162188394	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.30191972076788)	Y2	1		0	99.24812030075188	Confident
160	P62241	IIDVVYNASNNELVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39392 (Experiment 1)	39392	66.889	859.959106	2+	2+	1717.8998985344103	0	2.18646454324762								100.0	Confident
161	P57721, Q15366	LVVPASQCGSLIGK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31801 (Experiment 1)	31801	57.83	714.897156	2+	2+	1427.7806353488702	0	-0.6128727397653555								99.45652173913044	Confident
162	Q9Y490	LAQAAQSSVATITR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21515 (Experiment 1)	21515	45.494	708.895203	2+	2+	1415.7732414693105	0	1.842022533791373								95.39295392953929	Confident
163	Q06323	KKGEDEDKGPPCGPVNCNEK		Carbamidomethylation of C(12, 17)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7601 (Experiment 1)	7601	23.688	565.257629	4+	4+	2257.01033056536	0	-3.9452795315776292								100.0	Doubtful
164	P04406	VPTANVSVVDLTCR		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36196 (Experiment 1)	36196	62.974	510.936523	3+	3+	1529.7871772812903	0	0.3668547558197566								100.0	Confident
165	P35579	ALELDSNLYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36173 (Experiment 1)	36173	62.946	637.294495	2+	2+	1272.5751324339103	0	-0.5455618717719145	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.86914378029078)	Y9	1		0	99.45652173913044	Confident
166	P83881	GKDSLYAQGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7733 (Experiment 1)	7733	23.924	573.763245	2+	2+	1145.5118039013603	0	0.11604527839169737	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
167	P54886	GDECGLALGR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22521 (Experiment 1)	22521	46.88	524.247009	2+	2+	1046.48149322506	0	-1.934350340566906								99.74358974358975	Confident
168	Q9UPU5	MSEHYWTPQSNVSNETSTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25913 (Experiment 1)	25913	50.972	788.660828	3+	3+	2361.957305540521	1	-0.0024434705038485654	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
169	P53999	EQISDIDDAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27680 (Experiment 1)	27680	53.03	630.807312	2+	2+	1259.5993594282702	0	0.5640696402759153								100.0	Confident
170	P63241, Q9GZV4	IVEMSTSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11488 (Experiment 1)	11488	31.303	447.732941	2+	2+	893.4528188657303	0	-1.6637114886832371								100.0	Confident
171	P07900	KHLEINPDHSIIETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28894 (Experiment 1)	28894	54.457	639.018738	3+	3+	1914.0323096862903	0	1.0823446408425292								100.0	Confident
172	P13796, P13797	ALENDPDCR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9614 (Experiment 1)	9614	27.884	545.234924	2+	2+	1088.45567240004	0	-0.3460283970645723								98.73096446700508	Confident
173	O60256	VQVYQEPNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12165 (Experiment 1)	12165	32.386	606.776306	2+	2+	1211.5336019751003	0	3.672776607584572	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.86914378029078)	Y4	1		0	99.73333333333333	Confident
174	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37038 (Experiment 1)	37038	63.973	473.279388	2+	2+	944.5443511818	0	-0.13534860158567702								100.0	Confident
175	Q96A65	KFLDTSHYSTAGSSSVR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18714 (Experiment 1)	18714	41.941	641.626282	3+	3+	1921.8571209234403	0	-0.05419762971650865	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 96.33507853403141)	Y8	1		0	98.49624060150376	Confident
176	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33729 (Experiment 1)	33729	60.033	932.892578	2+	2+	1863.7750310922602	0	-2.3732718428268598	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 13.639845744958045)		0	Y6-{Y6 Y11}	1	100.0	Confident
177	P49327	GTPLISPLIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39480 (Experiment 1)	39480	67.015	519.831299	2+	2+	1037.64848189717	0	-0.4201657457345377								100.0	Confident
178	P62263	VKADRDESSPYAAMLAAQDVAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34817 (Experiment 1)	34817	61.307	623.810608	4+	4+	2491.2125355292205	0	0.31684447633045415								100.0	Doubtful
179	P10809	TVIIEQSWGSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33621 (Experiment 1)	33621	59.91	672.861694	2+	2+	1343.7085159544301	0	0.2371304714955769								100.0	Confident
180	P07203	DYTQMNELQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24826 (Experiment 1)	24826	49.705	689.278015	2+	2+	1376.5431806826302	0	-1.235796088095876	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	99.7289972899729	Confident
181	P61158	DYEEIGPSICR	Phosphorylation of Y(2)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30719 (Experiment 1)	30719	56.558	709.779846	2+	2+	1417.5584963936	0	-9.409397586489202	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Doubtful
182	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16262 (Experiment 1)	16262	38.673	514.763855	2+	2+	1027.5120650773501	0	1.0606709983766187								100.0	Confident
183	P07900, P08238, Q58FF7, Q58FF8	IRYESLTDPSKLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24301 (Experiment 1)	24301	49.096	452.98996	4+	4+	1807.9315925855103	0	-0.47377007631926316								100.0	Doubtful
184	P11021	TWNDPSVQQDIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27182 (Experiment 1)	27182	52.437	715.84906	2+	2+	1429.6837577585702	0	-0.1331930008670059								100.0	Confident
185	P31943	GLPWSCSADEVQR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34210 (Experiment 1)	34210	60.606	752.846619	2+	2+	1503.6776268323104	0	0.7028223163992806								100.0	Confident
186	P46782	AQCPIVER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12936 (Experiment 1)	12936	33.641	486.750336	2+	2+	971.4858503295102	0	0.2760521361927986								99.73045822102425	Confident
187	P43487	ICANHYITPMMELKPNAGSDR	Phosphorylation of Y(6)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37286 (Experiment 1)	37286	64.266	625.280518	4+	4+	2497.09533675015	0	-0.9478206513685942	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Doubtful
188	P49773	MVVNEGSDGGQSVYHVHLHVLGGR	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29225 (Experiment 1)	29225	54.834	876.413513	3+	3+	2626.2111692377603	0	2.8678940997016023	Phosphorylation of Y (14: Very Confident)	Phosphorylation of Y (14: 100.0)	Phosphorylation of Y (14: 100.0)	Y14	1		0	100.0	Confident
189	P61077, P62837	SQWSPALTISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34997 (Experiment 1)	34997	61.521	609.329529	2+	2+	1216.6451874218803	0	-0.5599229070486461								99.73333333333333	Confident
190	P22314	LDQPMTEIVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31805 (Experiment 1)	31805	57.835	644.833557	2+	2+	1287.6492868261503	0	2.5388323101889587								100.0	Confident
191	O14950, P19105	GNFNYIEFTR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41414 (Experiment 1)	41414	69.778	670.78772	2+	2+	1339.5598167229405	0	0.7978263894026244	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
192	P14618	KGVNLPGAAVDLPAVSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35300 (Experiment 1)	35300	61.868	589.000061	3+	3+	1763.9781488551105	0	0.11587122576816226								91.72932330827068	Doubtful
193	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	IIAPPERK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9814 (Experiment 1)	9814	28.231	462.287384	2+	2+	922.5600012459402	0	0.23126359568061527								92.40837696335078	Confident
194	P26641	STFVLDEFKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35689 (Experiment 1)	35689	62.321	621.329529	2+	2+	1240.6451874218803	0	-0.5491088850498944								100.0	Confident
195	P14625	SILFVPTSAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39808 (Experiment 1)	39808	67.47	594.343872	2+	2+	1186.6710082469	0	1.8363304368332398								100.0	Confident
196	P62266	KGHAVGDIPGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13281 (Experiment 1)	13281	34.126	402.562897	3+	3+	1204.66765420196	0	-0.6562965122433619								100.0	Confident
197	P0DMV8, P11142, P17066, P34931, P54652	ITITNDKGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8427 (Experiment 1)	8427	25.404	509.288025	2+	2+	1016.5614577979202	0	0.03855230782354811								99.45799457994579	Confident
198	P19338	EALNSCNKR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4347 (Experiment 1)	4347	16.948	546.268921	2+	2+	1090.51894136294	0	3.9794692414154236								90.83557951482479	Confident
199	Q9BY44	LYQYPNFAGPHAALANK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33266 (Experiment 1)	33266	59.499	652.311401	3+	3+	1953.9138479539204	0	-0.7533994975749788	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.68655920921578)	Phosphorylation of Y (2: 75.1194685766576)		0	Y2-{Y2 Y4}	1	99.24812030075188	Confident
200	Q00534	HLETFEHPNVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18816 (Experiment 1)	18816	42.068	493.26001	3+	3+	1476.7473610746406	0	7.325145700557746								100.0	Doubtful
201	P42166, P42167	PEFLEDPSVLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41198 (Experiment 1)	41198	69.466	687.861633	2+	2+	1373.7078472480905	0	0.6293553737332883								99.46380697050938	Confident
202	P52566	TLLGDGPVVTDPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31804 (Experiment 1)	31804	57.834	656.361023	2+	2+	1310.7081816012603	0	-0.5245089966535967								100.0	Confident
203	P46778	HGVVPLATYMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30477 (Experiment 1)	30477	56.279	622.334412	2+	2+	1242.6543126369404	0	-0.03339889476844018								100.0	Confident
204	P26038	SGYLAGDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11654 (Experiment 1)	11654	31.554	405.703033	2+	2+	809.3919328613301	0	-0.5173670181227665								100.0	Confident
205	ALDOA_RABIT, P04075	ADDGRPFPQVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26507 (Experiment 1)	26507	51.658	448.241699	3+	3+	1341.7040992803304	0	-0.6184760394028438								100.0	Confident
206	P62753	LIEVDDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19905 (Experiment 1)	19905	43.431	494.751007	2+	2+	987.4872897981502	0	0.17308530265481267								100.0	Confident
207	Q99729	EVYQQQQYGSGGR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11622 (Experiment 1)	11622	31.495	790.33136	2+	2+	1578.64639988121	0	1.1180039354238922	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 8.243795040643178)	Phosphorylation of Y (3: 92.65734265734265)		0	Y3-{Y3 Y8}	1	100.0	Confident
208	Q9Y3U8	EELSNVLAAMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44359 (Experiment 1)	44359	75.041	616.81842	2+	2+	1231.6230720783103	0	-0.636339163666476								100.0	Confident
209	P50502, Q8IZP2	VAAIEALNDGELQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33955 (Experiment 1)	33955	60.297	735.890869	2+	2+	1469.7725727629704	0	-3.6606493565452896								100.0	Confident
210	Q96AE4	IGGDAGTSLNSNDYGYGGQK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23940 (Experiment 1)	23940	48.64	1027.428955	2+	2+	2052.84259305811	0	0.3718060242401615	Phosphorylation of Y (14: Random)	Phosphorylation of Y (14: 0.0, 16: 0.0)	Phosphorylation of Y (14: 0.0)		0	Y14-{Y14 Y16}	1	100.0	Confident
211	P62263	VKADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33627 (Experiment 1)	33627	59.916	858.06842	3+	3+	2571.1788660499706	0	1.7731910341088515	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
212	Q06323	TENLLGSYFPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43991 (Experiment 1)	43991	74.117	634.830322	2+	2+	1267.6448530687103	0	0.9750628079935478								99.74489795918367	Confident
213	E9PAV3, Q13765	DIELVMSQANVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39305 (Experiment 1)	39305	66.768	731.372681	2+	2+	1460.7293280520005	0	1.0124905627774337								96.7479674796748	Confident
214	P52565	YKEALLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16797 (Experiment 1)	16797	39.325	475.276764	2+	2+	948.53926580136	0	-0.30585851968360794								98.72122762148338	Confident
215	P04075	PYQYPALTPEQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29726 (Experiment 1)	29726	55.412	757.850342	2+	2+	1513.6854111588805	0	0.4749670200896767	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 15.214780343797543)	Phosphorylation of Y (2: 0.16155088852988692)		0	Y2-{Y2 Y4}	1	100.0	Confident
216	Q96T37	IEAVYVSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22024 (Experiment 1)	22024	46.261	508.744354	2+	2+	1015.4739618406602	0	0.18990456703514658	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 91.97207678883072)	Y5	1		0	97.5609756097561	Confident
217	Q8IZD4	KITSSSAIYDNPNLIKPIPVKPSENQQQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28808 (Experiment 1)	28808	54.358	837.184509	4+	4+	3344.7129698179006	0	-1.2063291401229552	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Doubtful
218	P30626	ALTTMGFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30218 (Experiment 1)	30218	55.984	448.736267	2+	2+	895.4585729525102	0	-0.6595029054539918								99.46091644204851	Confident
219	Q00610	NNLAGAEELFAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40553 (Experiment 1)	40553	68.551	652.833496	2+	2+	1303.6520637074705	0	0.28748449301399137								93.22493224932249	Confident
220	Q12906	VPTWGPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35586 (Experiment 1)	35586	62.199	463.267303	2+	2+	924.5181364339601	0	2.068607441539196								99.72972972972973	Confident
221	O15144	DNTINLIHTFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38040 (Experiment 1)	38040	65.185	448.574463	3+	3+	1342.6993482530604	0	1.6432427015817863								99.29577464788733	Confident
222	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29987 (Experiment 1)	29987	55.716	677.842834	2+	2+	1353.6693671719202	0	1.2893082449772573	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
223	Q9NWQ8	ENDYESISDLQQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30473 (Experiment 1)	30473	56.273	578.572937	3+	3+	1732.6941379192701	0	1.6383327384726198	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
224	B2RXH8, B7ZW38, O60812, P07910	KSDVEAIFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26265 (Experiment 1)	26265	51.38	562.304199	2+	2+	1122.5920892198603	0	1.5612983685076642								100.0	Confident
225	Q06830	DISLSDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27374 (Experiment 1)	27374	52.663	510.718201	2+	2+	1019.4212575614604	0	0.5790916175729687	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
226	O60869	INEKPQVIADYESGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23714 (Experiment 1)	23714	48.337	573.629272	3+	3+	1717.8635130256903	0	1.4373844746010258								100.0	Confident
227	O00194, O95716, P20336, P20337, P20338, P20340, P51159, P59190, P61006, P61018, P61026, P61106, P62820, Q14964, Q15286, Q15771, Q5JT25, Q6IQ22, Q7Z6P3, Q86YS6, Q8IZ41, Q92928, Q92930, Q96AX2, Q96DA2, Q96E17, Q9BZG1, Q9H082, Q9H0U4, Q9NP90, Q9NRW1	LQIWDTAGQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34710 (Experiment 1)	34710	61.183	658.833069	2+	2+	1315.6520637074702	0	-0.3632490102485918								100.0	Confident
228	P04406	VVDLMAHMASK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27682 (Experiment 1)	27682	53.033	601.306335	2+	2+	1200.5995001827605	0	-1.1500916533236956								100.0	Confident
229	P61247	LIPDSIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23113 (Experiment 1)	23113	47.583	421.752472	2+	2+	841.4909186266102	0	-0.6254378328199289								99.49622166246851	Confident
230	Q9UBQ7	GDVVNQDDLYQALASGK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41311 (Experiment 1)	41311	69.619	936.925049	2+	2+	1871.8302374692603	0	2.832463575769311	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 88.04523424878836)	Y10	1		0	90.27027027027027	Doubtful
231	P50502, Q8IZP2, Q8NFI4	AIDLFTDAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44524 (Experiment 1)	44524	75.462	553.807983	2+	2+	1105.6019256275704	0	-0.46276053523580385								96.7479674796748	Confident
232	Q9NZ63	NAEDCLYELPENIR	Phosphorylation of Y(7)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42453 (Experiment 1)	42453	71.417	908.383423	2+	2+	1814.7546300008503	0	-1.286313361319644	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 82.02443280977312)	Y7	1		0	95.39295392953929	Confident
233	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	QLFHPEQLITGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36671 (Experiment 1)	36671	63.533	705.89093	2+	2+	1409.7666995368902	0	0.43032834204477116								99.73333333333333	Confident
234	P23368	VTEYLYANK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23111 (Experiment 1)	23111	47.581	590.768005	2+	2+	1179.5213059559003	0	0.1278932623688187	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 10.33452891645359)	Phosphorylation of Y (6: 22.358248209033547)		0	Y6-{Y4 Y6}	1	99.73890339425587	Confident
235	P38159	SDLYSSGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9838 (Experiment 1)	9838	28.267	482.692261	2+	2+	963.3698906949401	0	0.08118158157466422	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 88.30715532286213)	Y4	1		0	96.7479674796748	Confident
236	P22102	AIAFLQQPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34993 (Experiment 1)	34993	61.516	522.303711	2+	2+	1042.5923640033802	0	0.4834957412997696								100.0	Confident
237	P28074	AIYQATYR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17105 (Experiment 1)	17105	39.735	533.241333	2+	2+	1064.4692108133902	0	-1.0293143238965765	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 7: 0.0)	Phosphorylation of Y (3: 99.82547993019197)		0	Y3-{Y3 Y7}	1	100.0	Confident
238	P04406	LVINGNPITIFQERDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44082 (Experiment 1)	44082	74.288	681.041504	3+	3+	2040.1003892461104	0	1.1224749223064148								100.0	Confident
239	Q16698	VAGHPNIVINNAAGNFISPTER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35582 (Experiment 1)	35582	62.193	764.402161	3+	3+	2290.18182745429	0	1.232400473870203								100.0	Confident
240	P40227, Q92526	QADLYISEGLHPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29122 (Experiment 1)	29122	54.716	500.259674	3+	3+	1497.7575914051702	0	-0.26573232586178436								99.28057553956835	Confident
241	Q99460	SGMYTVAMAYCGSGNNK	Phosphorylation of Y(4)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35323 (Experiment 1)	35323	61.896	945.864868	2+	2+	1889.7147564181603	0	0.2255334383575793	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 10: 0.0)	Phosphorylation of Y (4: 95.28795811518324)		0	Y4-{Y4 Y10}	1	99.1891891891892	Doubtful
242	O00148, Q13838	GSYVSIHSSGFR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22500 (Experiment 1)	22500	46.854	459.538849	3+	3+	1375.5921794803803	0	1.8410658585282058	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.03069466882067)	Y3	1		0	100.0	Confident
243	P13796	NEALIALLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45067 (Experiment 1)	45067	76.722	506.811493	2+	2+	1011.6076797143501	0	0.7432276066135707								99.73190348525469	Confident
244	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21412 (Experiment 1)	21412	45.306	506.908508	3+	3+	1517.7014551458406	0	1.4726240770465153	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.65095986038395)	Y11	1		0	100.0	Confident
245	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35800 (Experiment 1)	35800	62.464	630.798096	2+	2+	1259.5798834611805	0	1.3915765198696306	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
246	P40925	GEFVTTVQQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20657 (Experiment 1)	20657	44.308	582.80603	2+	2+	1163.5934862021902	0	3.4495851526196515								100.0	Confident
247	P61254, Q9UNX3	FNPFVTSDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34992 (Experiment 1)	34992	61.514	541.766968	2+	2+	1081.5192586327703	0	0.11484053776431268								100.0	Confident
248	O00571, O15523, P17844, Q92841	MLDMGFEPQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42952 (Experiment 1)	42952	72.36	668.82373	2+	2+	1335.63152858703	0	1.0305262092469032								100.0	Confident
249	P52209	TIFQGIAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30973 (Experiment 1)	30973	56.854	474.779572	2+	2+	947.5440168286304	0	0.6047417862023142								99.73684210526315	Confident
250	P27635, Q96L21	GAFGKPQGTVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10860 (Experiment 1)	10860	30.237	396.88739	3+	3+	1187.6411051009502	0	-0.6420804444595076								100.0	Confident
251	P49411	GTVVTGTLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19081 (Experiment 1)	19081	42.391	516.788208	2+	2+	1031.5611234447501	0	0.7155950383985096								99.72972972972973	Confident
252	Q02878	AIPQLQGYLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39802 (Experiment 1)	39802	67.463	579.835693	2+	2+	1157.65569253593	0	0.9834954809482186								100.0	Confident
253	P33991	DYIAYAHSTIMPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33261 (Experiment 1)	33261	59.494	539.908325	3+	3+	1616.7058293336302	0	-1.6569045122021346	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 6.766660331122675)	Phosphorylation of Y (2: 0.17452006980802792)		0	Y2-{Y2 Y5}	1	100.0	Confident
254	P68431, Q16695, Q71DI3	KSAPATGGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4039 (Experiment 1)	4039	16.602	458.266632	2+	2+	914.5185303567803	0	0.1971664734562798								100.0	Confident
255	Q16658	YLAPSGPSGTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21744 (Experiment 1)	21744	45.874	595.823914	2+	2+	1189.6342883850102	0	-0.8503500354652295								97.8319783197832	Confident
256	Q9HCS7	AAEIYGVTHTR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17602 (Experiment 1)	17602	40.424	433.20285	3+	3+	1296.58636582395	0	0.272986593445268	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
257	P07195	LIAPVAEEEATVPNNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29728 (Experiment 1)	29728	55.414	565.638611	3+	3+	1693.8886651443706	0	3.1459851361226847								98.7012987012987	Confident
258	P11142	TVTNAVVTVPAYFNDSQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41091 (Experiment 1)	41091	69.316	661.337402	3+	3+	1980.9905044439602	0	-0.06443729915072922								94.8905109489051	Confident
259	P07900, P08238, Q14568, Q58FF8	ADLINNLGTIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39801 (Experiment 1)	39801	67.46	621.856323	2+	2+	1241.6979512707305	0	0.11400998606800582								100.0	Confident
260	P62917	ASGNYATVISHNPETKK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13783 (Experiment 1)	13783	34.918	632.967102	3+	3+	1895.8778563680203	0	0.853247570548678	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
261	P61247	TSYAQHQQVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6114 (Experiment 1)	6114	20.323	609.306763	2+	2+	1216.5948831845203	0	3.35618758103707								99.45945945945947	Confident
262	P52272	MVPAGMGAGLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27978 (Experiment 1)	27978	53.375	594.796448	2+	2+	1187.5790990913501	0	-0.635532118797961								98.92183288409704	Confident
263	P62158	VFDKDGNGYISAAELR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31565 (Experiment 1)	31565	57.553	612.284546	3+	3+	1833.8298435464403	0	1.0697941225639298	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
264	Q99623	IVQAEGEAEAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11678 (Experiment 1)	11678	31.591	608.315247	2+	2+	1214.6142812164205	0	1.3643026605486293								92.99191374663073	Confident
265	P08238	HLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30328 (Experiment 1)	30328	56.109	446.492859	4+	4+	1781.94243205273	0	-0.05706696658627241								100.0	Doubtful
266	P62263	ADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37860 (Experiment 1)	37860	64.961	782.345459	3+	3+	2344.0154891229804	0	-0.40115400351024033	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
267	Q9P258	DVACGANHTLVLDSQKR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18477 (Experiment 1)	18477	41.637	628.651001	3+	3+	1882.9319440220204	0	-0.4085054826206806								100.0	Confident
268	P50990	HFSGLEEAVYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28973 (Experiment 1)	28973	54.546	694.306091	2+	2+	1386.5969305076505	0	0.5030627599724282	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
269	P40926	IQEAGTEVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13503 (Experiment 1)	13503	34.495	537.295898	2+	2+	1072.5764391557204	0	0.7481085001342006								99.72972972972973	Confident
270	P50395	MTGSEFDFEEMKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33420 (Experiment 1)	33420	59.676	536.234497	3+	3+	1605.6803292542504	0	0.8282113046330443								99.28057553956835	Confident
271	P20292	TGTLAFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23488 (Experiment 1)	23488	48.046	447.7388	2+	2+	893.4606811274903	0	2.642104210010737								93.01075268817205	Confident
272	P23526	SKFDNLYGCR	Phosphorylation of Y(7)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19403 (Experiment 1)	19403	42.788	670.278137	2+	2+	1338.54278675981	0	-0.7949629624948115	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
273	P61313	SLQSVAEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17543 (Experiment 1)	17543	40.348	509.76181	2+	2+	1017.5090878718904	0	-0.02040709351833744								100.0	Confident
274	P47756	STLNEIYFGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39398 (Experiment 1)	39398	66.895	626.286987	2+	2+	1250.5584197406104	0	0.799415113726335	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
275	P52597	YGDSEFTVQSTTGHCVHMR		Carbamidomethylation of C(15)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22600 (Experiment 1)	22600	46.972	553.746277	4+	4+	2210.9473363859806	0	3.9123426351725548								100.0	Doubtful
276	P62805	RISGLIYEETR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25662 (Experiment 1)	25662	50.686	446.245239	3+	3+	1335.7146639640305	0	-0.5799232860519776								100.0	Confident
277	P54577	IDVGEAEPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17862 (Experiment 1)	17862	40.763	493.250275	2+	2+	984.4876241513202	0	-1.6493475452666861								99.7289972899729	Confident
278	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43625 (Experiment 1)	43625	73.476	895.9505	2+	2+	1789.88464239309	0	1.0071287998046068								100.0	Confident
279	P78527	FVPLLPGNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37139 (Experiment 1)	37139	64.095	506.800537	2+	2+	1011.5865503469502	0	-0.028887669858773817								99.73190348525469	Confident
280	P62888	KSEIEYYAMLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35890 (Experiment 1)	35890	62.575	482.582184	3+	3+	1444.7272027936804	0	-1.7131381622032704								100.0	Confident
281	Q9Y6E2	NYAQVFNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21797 (Experiment 1)	21797	45.953	532.23407	2+	2+	1062.4535607492503	0	0.02472326335053438	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
282	Q06323	QPHVGDYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8784 (Experiment 1)	8784	26.183	526.222229	2+	2+	1050.4284086305702	0	1.4218687950521736	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.72826086956522	Confident
283	P04843	DVPAYSQDTFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27683 (Experiment 1)	27683	53.035	635.801025	2+	2+	1269.5877321154103	0	-0.1848447720140766								100.0	Confident
284	P49736	IFASIAPSIYGHEDIKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32913 (Experiment 1)	32913	59.097	480.010803	4+	4+	1916.0155969929904	0	-0.7764716291085746								100.0	Doubtful
285	P36873, P62136, P62140	AHQVVEDGYEFFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35901 (Experiment 1)	35901	62.587	547.263306	3+	3+	1638.7678217357006	0	0.162544491087567								100.0	Confident
286	P16298, Q08209	HLTEYFTFK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37262 (Experiment 1)	37262	64.237	633.28302	2+	2+	1264.5529404373503	0	-1.1474879800452384	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.50959860383944)	Y5	1		0	98.9247311827957	Confident
287	O00299, Q96NY7, Q9NZA1, Q9Y696	IGNCPFSQR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18635 (Experiment 1)	18635	41.843	539.758606	2+	2+	1077.5025630228101	0	0.08896900685600857								96.4769647696477	Confident
288	P62826	LVLVGDGGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23960 (Experiment 1)	23960	48.664	508.292816	2+	2+	1014.57095985246	0	0.11726895047285106								100.0	Confident
289	P61088, Q5JXB2	WSPALQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35169 (Experiment 1)	35169	61.716	485.774323	2+	2+	969.53960015453	0	-5.668328560467586								96.75675675675676	Doubtful
290	P16070	NLQNVDMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15903 (Experiment 1)	15903	38.213	481.242371	2+	2+	960.4698659122002	0	0.33575003344404036								93.6	Confident
291	Q6UXN9	YTHAANTVVYSSNK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11544 (Experiment 1)	11544	31.375	545.579407	3+	3+	1633.7137511650405	0	1.61323218883926	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 6.3894912415474625)	Phosphorylation of Y (10: 96.33507853403141)		0	Y10-{Y1 Y10}	1	97.74436090225565	Confident
292	P32119	LSEDYGVLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27771 (Experiment 1)	27771	53.14	552.255981	2+	2+	1102.4947568548903	0	2.401257700687475	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.16055846422339)	Y5	1		0	99.7289972899729	Confident
293	P04083	CATSKPAFFAEK		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20711 (Experiment 1)	20711	44.369	452.892761	3+	3+	1355.6543722065906	0	1.5319271590059313								100.0	Confident
294	P26038	KTQEQLALEMAELTAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41313 (Experiment 1)	41313	69.622	611.324951	3+	3+	1830.9509481311006	0	1.1316789916251657								100.0	Confident
295	Q9BQ48	GNEYQPSNIK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11732 (Experiment 1)	11732	31.681	615.263855	2+	2+	1228.5125321773503	0	0.5078222439726523	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 84.81675392670157)	Y4	1		0	96.2059620596206	Confident
296	P78527	HGDLPDIQIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27959 (Experiment 1)	27959	53.354	568.309814	2+	2+	1134.6033226099003	0	1.5418167470548565								99.73045822102425	Confident
297	O43423, O95626, P39687, Q92688	IKDLSTIEPLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28306 (Experiment 1)	28306	53.768	419.587738	3+	3+	1255.7387534535503	0	2.0902672434146563								96.37681159420289	Confident
298	P04899, P08754, P63096	EIYTHFTCATDTK	Phosphorylation of Y(3)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23135 (Experiment 1)	23135	47.606	833.845276	2+	2+	1665.6745887750005	0	0.8456560279006894	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
299	P52272	INEILSNALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35587 (Experiment 1)	35587	62.2	557.826843	2+	2+	1113.6393737654503	0	-0.21574707761150336								100.0	Confident
300	Q06323	TENLLGSYFPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43839 (Experiment 1)	43839	73.853	634.830139	2+	2+	1267.6448530687103	0	0.6867965231496259								98.91598915989161	Confident
301	P61247	LMELHGEGSSSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13449 (Experiment 1)	13449	34.396	666.317688	2+	2+	1330.6187149738603	0	1.5818999617483738								99.1869918699187	Confident
302	P08238, Q58FF7	RAPFDLFENKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31584 (Experiment 1)	31584	57.575	455.582764	3+	3+	1363.7248347249106	0	1.1910580769292647								96.2962962962963	Confident
303	P50395	FKIPGSPPESMGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28456 (Experiment 1)	28456	53.944	468.241425	3+	3+	1401.70747040861	0	-3.5770657355852307								94.73684210526316	Confident
304	P50990	FAEAFEAIPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38499 (Experiment 1)	38499	65.753	575.798096	2+	2+	1149.58185888933	0	-0.19088541088980396								100.0	Confident
305	P25398	LGEWVGLCK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37058 (Experiment 1)	37058	63.998	531.276428	2+	2+	1060.5375515492	0	0.7072755986415429								100.0	Confident
306	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35303 (Experiment 1)	35303	61.873	631.303833	2+	2+	1259.5798834611805	1	7.8272122248334	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.95287958115183)	Y6	1		0	99.73118279569893	Doubtful
307	P12955	AVYEAVLR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27352 (Experiment 1)	27352	52.636	500.747009	2+	2+	999.4790472211002	0	0.41722211280742916	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
308	P09651, P22626, Q32P51	KIFVGGIKEDTEEHHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18715 (Experiment 1)	18715	41.942	502.771057	4+	4+	2007.0537734068607	0	0.6706465979338566								100.0	Doubtful
309	P11940, Q9H361	GFGFVSFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43882 (Experiment 1)	43882	73.93	523.258545	2+	2+	1044.5028802926402	0	-0.32796994426646014								100.0	Confident
310	P60866	DTGKTPVEPEVAIHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18201 (Experiment 1)	18201	41.269	412.972046	4+	4+	1647.8580337224305	0	0.6322528315192607								100.0	Doubtful
311	Q13263	LTEDKADVQSIIGLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35249 (Experiment 1)	35249	61.81	595.996033	3+	3+	1784.9632270669601	0	1.7016543807275297								91.72932330827068	Doubtful
312	P14866	LCFSTAQHAS		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20577 (Experiment 1)	20577	44.217	561.256409	2+	2+	1120.4971432892003	0	0.9993456453838881								98.91598915989161	Confident
313	P30086	GNDISSGTVLSDYVGSGPPK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37343 (Experiment 1)	37343	64.338	677.308472	3+	3+	2028.9041306855102	0	-0.2677685883066507	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 98.42931937172776)	Y13	1		0	100.0	Confident
314	P38646	VQQTVQDLFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37342 (Experiment 1)	37342	64.337	645.841125	2+	2+	1289.6727991520502	0	-3.9499385559626607								100.0	Confident
315	P10768	SGYHQSASEHGLVVIAPDTSPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26108 (Experiment 1)	26108	51.198	796.705383	3+	3+	2387.090702668571	0	1.513288995573314	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.67689822294022)	Y3	1		0	100.0	Confident
316	P30101	TVAYTEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8864 (Experiment 1)	8864	26.374	470.242371	2+	2+	938.4709114580203	0	-0.7681050601717164								98.93617021276596	Confident
317	P59998	ELLLQPVTISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41509 (Experiment 1)	41509	69.923	634.882751	2+	2+	1267.7499868435902	0	0.757796233420699								98.9501312335958	Confident
318	P52272	LGSTVFVANLDYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41358 (Experiment 1)	41358	69.702	713.883423	2+	2+	1425.7503807664104	0	1.339366110107231								99.45652173913044	Confident
319	Q06830	TIAQDYGVLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28455 (Experiment 1)	28455	53.943	594.288086	2+	2+	1186.5635051210502	0	-1.5868159953869803	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 86.38743455497382)	Y6	1		0	92.9539295392954	Confident
320	P62995	RPHTPTPGIYMGRPTYGSSR	Phosphorylation of Y(16, 10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22128 (Experiment 1)	22128	46.39	797.687622	3+	3+	2390.03921538055	0	0.7610416031229049	Phosphorylation of Y (10: Very Confident, 16: Very Confident)		Phosphorylation of Y (10: 99.65095986038395, 16: 99.65095986038395)	Y10, Y16	2		0	99.37888198757764	Confident
321	P52272	FESPEVAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19349 (Experiment 1)	19349	42.724	532.25592	2+	2+	1062.4981888350203	0	-0.8471186949391571								100.0	Confident
322	P14618	GDYPLEAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28893 (Experiment 1)	28893	54.454	510.261963	2+	2+	1018.5083595959002	0	0.9930893891998691								99.72972972972973	Confident
323	P62244	HGYIGEFEIIDDHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34998 (Experiment 1)	34998	61.523	567.605652	3+	3+	1699.7954334658702	0	-0.1802109439010991								100.0	Confident
324	Q06830, Q13162	GLFIIDDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41839 (Experiment 1)	41839	70.425	460.75824	2+	2+	919.5014833103103	0	0.4815500201330074								99.73333333333333	Confident
325	P10599, THIO_HUMAN	VGEFSGANK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11144 (Experiment 1)	11144	30.775	454.727448	2+	2+	907.4399456829101	0	0.4369470562368573								100.0	Confident
326	Q9BZZ5	DAYQVILDGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43677 (Experiment 1)	43677	73.558	610.83429	2+	2+	1219.6448530687103	0	7.509456089406097								92.22520107238606	Doubtful
327	P36578	SNYNLPMHK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16356 (Experiment 1)	16356	38.788	395.170135	3+	3+	1182.4892946349703	0	-0.6065193245821036	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	100.0	Confident
328	Q9GZR7	VQHVIHYQVPR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15653 (Experiment 1)	15653	37.836	485.914246	3+	3+	1454.7183830530103	0	1.7325079819397964	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
329	Q16629	GHYAYDCHR	Phosphorylation of Y(3)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6585 (Experiment 1)	6585	21.253	420.153564	3+	3+	1257.43865604444	0	0.16387274845295596	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0)	Phosphorylation of Y (3: 2.4432809773123907)		0	Y3-{Y3 Y5}	1	100.0	Confident
330	P41091, Q2VIR3	HILILQNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20319 (Experiment 1)	20319	43.918	489.80896	2+	2+	977.6022004110903	0	1.1909303121301151								99.46091644204851	Confident
331	P62269	IPDWFLNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45126 (Experiment 1)	45126	76.855	530.782593	2+	2+	1059.5501648382303	0	0.4410735753794921								99.7340425531915	Confident
332	P62829	VHPAVVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13049 (Experiment 1)	13049	33.797	445.781921	2+	2+	889.5497709154101	0	-0.540453471658705								99.45799457994579	Confident
333	P63104	YLAEVAAGDDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14370 (Experiment 1)	14370	35.847	427.222168	3+	3+	1278.6455813447003	0	-0.7074730376363576								100.0	Confident
334	P62937, PPIA_HUMAN	KITIADCGQLE		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27514 (Experiment 1)	27514	52.829	624.318909	2+	2+	1246.62273772514	0	0.4223334027290332								98.93048128342245	Confident
335	P09651, Q32P51	SSGPYGGGGQYFAK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24138 (Experiment 1)	24138	48.886	728.301697	2+	2+	1454.5867597467704	0	1.4288876353990476	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 9.688517651233688)	Phosphorylation of Y (11: 99.82547993019197)		0	Y11-{Y5 Y11}	1	99.72826086956522	Confident
336	Q08211	GISHVIVDEIHER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26096 (Experiment 1)	26096	51.184	501.935944	3+	3+	1502.7841405061804	0	1.2366091122294092								100.0	Confident
337	P26038	EDAVLEYLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41151 (Experiment 1)	41151	69.401	540.285583	2+	2+	1078.5546410819802	0	1.8249496714478335								98.6449864498645	Confident
338	Q9UBQ7	GDVVNQDDLYQALASGK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41481 (Experiment 1)	41481	69.872	936.924011	2+	2+	1871.8302374692603	0	1.7245809962618321	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
339	P11310	IYQIYEGTSQIQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32570 (Experiment 1)	32570	58.71	839.896667	2+	2+	1677.7763514216003	0	1.446397149297357	Phosphorylation of Y (5: Random)	Phosphorylation of Y (2: 0.0, 5: 0.0)	Phosphorylation of Y (5: 82.16813727284932)		0	Y5-{Y2 Y5}	1	100.0	Confident
340	Q92945	DAFADAVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24075 (Experiment 1)	24075	48.805	496.743286	2+	2+	991.4723084403502	0	-0.29127106286590215								99.7340425531915	Confident
341	P62241	ADGYVLEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20095 (Experiment 1)	20095	43.664	476.242126	2+	2+	950.4709114580203	0	-1.2728715445594243								98.7146529562982	Confident
342	O60361, P15531, P22392	GDFCIQVGR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31040 (Experiment 1)	31040	56.933	526.253479	2+	2+	1050.49166398594	0	0.7041102692411855								99.45652173913044	Confident
343	Q15717	DANLYISGLPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42532 (Experiment 1)	42532	71.571	649.814209	2+	2+	1297.6067669153601	0	5.461707119847888	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82578397212544)	Y5	1		0	100.0	Doubtful
344	O00267	TPHYGSQTPLHDGSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9736 (Experiment 1)	9736	28.1	578.252502	3+	3+	1731.7366118679402	0	-0.5391346448367605	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.38219895287958)	Y4	1		0	99.24812030075188	Confident
345	Q99623	ESVFTVEGGHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20310 (Experiment 1)	20310	43.908	406.535217	3+	3+	1216.5836497944802	0	0.14086939322127368								99.24812030075188	Confident
346	P13639	VNFTVDQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32572 (Experiment 1)	32572	58.713	546.295532	2+	2+	1090.57710786206	0	-0.5462202446474956								100.0	Confident
347	Q9Y224	LTALDYHNPAGFNCKDETEFR	Phosphorylation of Y(6)	Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33349 (Experiment 1)	33349	59.597	860.040649	3+	3+	2577.099553100111	0	0.21878794419408057	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.38219895287958)	Y6	1		0	97.74436090225565	Confident
348	P04406	VIPELNGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21831 (Experiment 1)	21831	46.0	435.258301	2+	2+	868.5018176634801	0	0.26582256673846166								99.45799457994579	Confident
349	P84090	ADTQTYQPYNK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11206 (Experiment 1)	11206	30.874	704.791077	2+	2+	1407.5707753294603	0	-2.251912687248272	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 9: 0.0)	Phosphorylation of Y (6: 66.37895263549714)		0	Y6-{Y6 Y9}	1	96.24664879356568	Confident
350	P06733	IGAEVYHNLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18395 (Experiment 1)	18395	41.527	612.295105	2+	2+	1222.5747385110903	0	0.7500925346946685	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
351	Q00610	LLYNNVSNFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34652 (Experiment 1)	34652	61.116	648.839905	2+	2+	1295.66223446835	0	2.329237954458527								100.0	Confident
352	P07900, P08238, Q14568, Q58FF8	YIDQEELNK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19348 (Experiment 1)	19348	42.723	616.268066	2+	2+	1230.5169488514503	0	3.7566706561652405	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 99.65095986038395)	Y1	1		0	99.45799457994579	Confident
353	Q14566	LGFSEYCR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27898 (Experiment 1)	27898	53.284	516.234192	2+	2+	1030.4542158480601	0	-0.37268118503464154								100.0	Confident
354	P23193	DTYVSSFPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28718 (Experiment 1)	28718	54.249	576.24176	2+	2+	1150.4696047362102	0	-0.5533003035755126	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
355	P0DME0, Q01105	EFHLNESGDPSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18409 (Experiment 1)	18409	41.549	482.888275	3+	3+	1445.64228686941	0	0.48923014387617275								97.74436090225565	Confident
356	P23743	RPHGDIYGINQALGATAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27434 (Experiment 1)	27434	52.735	654.659424	3+	3+	1960.9520243677905	0	2.249638794708066	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
357	P07900, P08238, Q58FF6, Q58FF7	VILHLKEDQTEYLEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29169 (Experiment 1)	29169	54.771	504.516266	4+	4+	2014.0371202832105	0	-0.5758733006780193								88.23529411764706	Doubtful
358	P25705	LTDADAMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11739 (Experiment 1)	11739	31.691	432.710999	2+	2+	863.4058686733104	0	1.8215343969283837								99.45652173913044	Confident
359	O76094	ELYGQVLYR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33600 (Experiment 1)	33600	59.886	610.789856	2+	2+	1219.5638394742202	0	1.080235344532531	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 16.720558547877676)	Phosphorylation of Y (3: 99.82547993019197)		0	Y3-{Y3 Y8}	1	99.73614775725594	Confident
360	P00519	LGGGQYGEVYEGVWKK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33160 (Experiment 1)	33160	59.38	617.289734	3+	3+	1848.8447653345906	0	1.407911876932177	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 17.367359723167326)	Phosphorylation of Y (10: 3.4904013961605584)		0	Y10-{Y6 Y10}	1	100.0	Confident
361	Q13422	SGLIYLTNHIAPHAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35517 (Experiment 1)	35517	62.117	581.963562	3+	3+	1741.8665038386803	1	-0.574292862801945	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.95287958115183)	Y5	1		0	100.0	Confident
362	P62753	DIPGLTDTTVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36755 (Experiment 1)	36755	63.633	642.843689	2+	2+	1283.6721304457103	0	0.5402721165322206								100.0	Confident
363	P62906	KYDAFLASESLIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39390 (Experiment 1)	39390	66.886	495.605377	3+	3+	1483.7922455783903	0	1.3828367704099551								100.0	Confident
364	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13718 (Experiment 1)	13718	34.822	601.28833	2+	2+	1199.5587540937802	1	-0.001552301849927169	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
365	P50914	ALVDGPCTQVR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21014 (Experiment 1)	21014	44.74	608.310852	2+	2+	1214.60775636734	0	-0.4975257807006744								100.0	Confident
366	P12004	SEGFDTYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18406 (Experiment 1)	18406	41.545	527.697327	2+	2+	1053.3804553786404	0	-0.33571531206026256	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.33507853403141)	Y7	1		0	99.19354838709677	Confident
367	P61247	NCLTNFHGMDLTR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34135 (Experiment 1)	34135	60.517	526.909912	3+	3+	1577.7078814147699	0	0.015932384805531934								100.0	Confident
368	Q53FD0	ELILDKVYTHPK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36276 (Experiment 1)	36276	63.071	768.390015	2+	2+	1534.7796458968903	0	-9.219731910327269	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 97.55671902268762)	Y8	1		0	97.55434782608695	Doubtful
369	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27770 (Experiment 1)	27770	53.138	565.21521	2+	2+	1128.4165065341901	0	-0.565684929677775	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 20.308660229654866)	Phosphorylation of Y (2: 99.83844911147011)		0	Y2-{Y2 Y6}	1	100.0	Confident
370	P08238	KHLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24556 (Experiment 1)	24556	49.394	478.516693	4+	4+	1910.0373950667304	0	0.14161787029687875								100.0	Doubtful
371	P31946	YLIPNATQPESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26696 (Experiment 1)	26696	51.873	680.859253	2+	2+	1359.7034305739905	0	0.3837008775473079								100.0	Confident
372	P50991	IDDVVNTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15493 (Experiment 1)	15493	37.603	466.243744	2+	2+	930.4770594676202	0	-4.4229901794802515								99.7289972899729	Doubtful
373	P62241	QWYESHYALPLGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39702 (Experiment 1)	39702	67.325	567.259399	3+	3+	1698.7555564073702	0	0.47667350647745427	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 9.990620534539762)	Phosphorylation of Y (7: 0.1743680488412962)		0	Y7-{Y3 Y7}	1	100.0	Confident
374	P37840, Q16143	EGVLYVGSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26844 (Experiment 1)	26844	52.044	516.243713	2+	2+	1030.4736274874904	0	-0.7306825675226457	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.54604200323102)	Y5	1		0	99.45799457994579	Confident
375	P60709, P62736, P63261, P63267, P68032, P68133	DSYVGDEAQSKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10114 (Experiment 1)	10114	28.844	452.216064	3+	3+	1353.6160721215704	0	7.585279743509487								100.0	Doubtful
376	P35237, P50452	TGTQYLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24394 (Experiment 1)	24394	49.203	476.265564	2+	2+	950.51853035678	0	-2.0527270268073337								98.64864864864865	Confident
377	P61106	IYQNIQDGSLDLNAAESGVQHKPSAPQGGR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30409 (Experiment 1)	30409	56.202	808.387268	4+	4+	3229.5153326405107	0	1.4329452799993259	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Doubtful
378	P22626	GGGGNFGPGPGSNFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24077 (Experiment 1)	24077	48.807	689.31897	2+	2+	1376.6221605615199	0	0.8896505105684462								100.0	Confident
379	P09651	SSGPYGGGGQYFAKPR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20312 (Experiment 1)	20312	43.91	570.254333	3+	3+	1707.7406346192204	0	0.31271456729062	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 8.490395398958714)	Phosphorylation of Y (5: 0.0)		0	Y5-{Y5 Y11}	1	100.0	Confident
380	P62249	GGGHVAQIYAIR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22215 (Experiment 1)	22215	46.502	441.218262	3+	3+	1320.6339847227102	0	-0.7767299741904657	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 94.4153577661431)	Y9	1		0	97.9020979020979	Confident
381	P50990	TVGATALPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17206 (Experiment 1)	17206	39.876	443.261536	2+	2+	884.50796567308	0	0.6242292603335033								100.0	Confident
382	Q96SB3	ETQAQYQALER	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16431 (Experiment 1)	16431	38.876	708.812134	2+	2+	1415.6082234673404	0	1.052183317254671	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.38219895287958)	Y6	1		0	97.289972899729	Confident
383	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26846 (Experiment 1)	26846	52.046	523.252441	2+	2+	1044.4892775516303	0	1.0047882433962936	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
384	P78527	DILETHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25331 (Experiment 1)	25331	50.292	498.777618	2+	2+	995.5399940773502	0	0.690678046582456								93.78378378378378	Confident
385	P11142	MVNHFIAEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32571 (Experiment 1)	32571	58.712	618.320007	2+	2+	1234.6168644990605	0	6.951600286247587								100.0	Doubtful
386	P15954	SHYEEGPGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5244 (Experiment 1)	5244	18.627	542.210938	2+	2+	1082.4070044796501	0	0.2937849433620993	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	99.73684210526315	Confident
387	P42768	LYGLQAGR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21346 (Experiment 1)	21346	45.221	479.230988	2+	2+	956.44808144599	0	-0.6869121343995315	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 97.5767366720517)	Y2	1		0	98.91598915989161	Confident
388	Q9BZZ5	PTVEELYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25661 (Experiment 1)	25661	50.684	543.746582	2+	2+	1085.4794411439202	0	-0.7632939114139082	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
389	O75179	EHYPVSSPSSPSPPAQPGGVSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20918 (Experiment 1)	20918	44.612	767.351196	3+	3+	2299.02703978285	0	2.049833423143654	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.50959860383944)	Y3	1		0	97.8102189781022	Confident
390	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34387 (Experiment 1)	34387	60.812	630.796692	2+	2+	1259.5798834611805	0	-0.8341783811929855	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
391	P08574	GLLSSLDHTSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34570 (Experiment 1)	34570	61.024	433.572937	3+	3+	1297.6990138998904	0	-1.56244157748781								98.49624060150376	Confident
392	P05141, P12236	QIFLGGVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31244 (Experiment 1)	31244	57.171	488.776733	2+	2+	975.5389314481902	0	-0.01880389607646082								99.72826086956522	Confident
393	P28906	LGILDFTEQDVASHQSYSQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43419 (Experiment 1)	43419	73.148	756.040161	3+	3+	2265.0913406840405	0	3.224228675981349								91.72932330827068	Doubtful
394	P47914	AQAAAPASVPAQAPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14807 (Experiment 1)	14807	36.496	689.377991	2+	2+	1376.7412130650405	0	0.15666395789724288								100.0	Confident
395	P16949	SKESVPEFPLSPPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32834 (Experiment 1)	32834	59.008	514.612122	3+	3+	1540.8137092989602	0	0.5358735325981945								100.0	Confident
396	Q02790	VGEVCHITCKPEYAYGSAGSPPK	Phosphorylation of Y(13)	Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20713 (Experiment 1)	20713	44.373	863.052185	3+	3+	2586.1284107002402	0	2.438985280054955	Phosphorylation of Y (13: Random)	Phosphorylation of Y (13: 0.0, 15: 0.0)	Phosphorylation of Y (13: 81.57699630212718)		0	Y13-{Y13 Y15}	1	92.53731343283582	Doubtful
397	Q16658	YSVQTADHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8821 (Experiment 1)	8821	26.285	538.760071	2+	2+	1075.5046711977902	0	0.8518349976003444								95.13513513513514	Confident
398	O43175	AGTGVDNVDLEAATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27773 (Experiment 1)	27773	53.143	744.869507	2+	2+	1487.72159981927	0	1.9206401754409599								100.0	Confident
399	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	KESYSIYVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27512 (Experiment 1)	27512	52.826	680.31427	2+	2+	1358.6159346167303	0	-1.4313587504936467	Phosphorylation of Y (7: Random)	Phosphorylation of Y (7: 0.0, 9: 0.0)	Phosphorylation of Y (7: 0.16155088852988692)		0	Y7-{Y4 Y7 Y9}	1	100.0	Confident
400	A5A3E0, P0CG38, P0CG39, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3	AGFAGDDAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14791 (Experiment 1)	14791	36.474	488.727631	2+	2+	975.4410083120702	0	-0.3061476204007756								100.0	Confident
401	P26583	IKSEHPGLSIGDTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14454 (Experiment 1)	14454	35.987	518.282288	3+	3+	1551.8256709649902	0	-0.40927835441564636								100.0	Confident
402	P55084	NVVVVDGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21680 (Experiment 1)	21680	45.786	478.78006	2+	2+	955.54507945779	0	0.5092200731097135								92.48704663212435	Confident
403	P23458	ERFYESRCR	Phosphorylation of Y(4)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40630 (Experiment 1)	40630	68.651	692.28656	2+	2+	1381.55983380628	1	-3.3403174766381385	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 93.89179755671903)	Y4	1		0	92.99191374663073	Confident
404	P0DMV8, P17066	IINEPTAAAIAYGLDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43480 (Experiment 1)	43480	73.233	844.455627	2+	2+	1686.8940848779803	0	1.5490408048758448								100.0	Confident
405	P13639	KEDLYLKPIQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22948 (Experiment 1)	22948	47.381	741.889465	2+	2+	1481.7643301859202	0	0.031595311194961805	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
406	O14979	DLTEYLSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38889 (Experiment 1)	38889	66.221	538.737549	2+	2+	1075.4587056993403	0	1.7071115415024662	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
407	Q9BTY7	LLPFLAPGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44222 (Experiment 1)	44222	74.641	527.824402	2+	2+	1053.63350053937	0	0.710963282934779								99.47780678851174	Confident
408	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27308 (Experiment 1)	27308	52.583	523.252136	2+	2+	1044.4892775516303	0	0.4218950113966914	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
409	P68104, Q5VTE0	YYVTIIDAPGHR	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34651 (Experiment 1)	34651	61.115	742.8479	2+	2+	1483.68607986522	0	-3.2528752681395665	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.0)		0	Y1-{Y1 Y2}	1	100.0	Confident
410	P43246	DIYQDLNR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24478 (Experiment 1)	24478	49.303	558.739197	2+	2+	1115.4648537089402	0	-0.9061845420147633	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	99.74358974358975	Confident
411	Q92598	AGGIETIANEFSDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42535 (Experiment 1)	42535	71.574	740.356445	2+	2+	1478.7001360987	0	-1.2149756719295102								100.0	Confident
412	P62158	DTDSEEEIREAFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33341 (Experiment 1)	33341	59.587	532.908447	3+	3+	1595.7063436779504	0	-1.7714571082072883								96.99248120300751	Confident
413	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44590 (Experiment 1)	44590	75.64	625.278748	2+	2+	1248.5427696764702	0	0.13865010613878317	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
414	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44141 (Experiment 1)	44141	74.436	935.933594	2+	2+	1869.85097291384	0	0.887965782182974	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
415	P02786	LLNENSYVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26924 (Experiment 1)	26924	52.137	602.821594	2+	2+	1203.6247863304702	0	3.1922779726133954								99.7289972899729	Confident
416	Q9HB71	KAELLDNEKPAAVVAPITTGYTVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34313 (Experiment 1)	34313	60.723	632.855835	4+	4+	2527.3897545318605	0	1.7696008199682143								100.0	Doubtful
417	Q8N163	VVTQNICQYR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20509 (Experiment 1)	20509	44.14	640.824646	2+	2+	1279.63430546835	0	0.3383126533062779								99.73474801061008	Confident
418	P01911, P01912, P04440, P20039, Q5Y7A7, Q95IE3	FDSDVGEFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29042 (Experiment 1)	29042	54.626	536.241028	2+	2+	1070.4668887067403	0	0.5728394093980367								100.0	Confident
419	P17844, Q92841	STCIYGGAPK	Phosphorylation of Y(5)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13367 (Experiment 1)	13367	34.264	567.238647	2+	2+	1132.4624111807902	0	0.2907820926098347	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.30191972076788)	Y5	1		0	99.74811083123426	Confident
420	P22626	RGFGFVTFDDHDPVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37218 (Experiment 1)	37218	64.186	617.960449	3+	3+	1850.8587619984203	0	0.4075781079734149								99.26470588235294	Confident
421	P35579	ALEEAMEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16436 (Experiment 1)	16436	38.882	524.752991	2+	2+	1047.4906609264303	0	0.7319067454616576								96.19565217391303	Confident
422	P12004	SEGFDTYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18632 (Experiment 1)	18632	41.84	527.698853	2+	2+	1053.3804553786404	0	2.5560929454998647	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
423	P49736	AGIVTSLQAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25062 (Experiment 1)	25062	49.981	508.298431	2+	2+	1014.5821932425001	0	0.1139329595339632								97.5609756097561	Confident
424	P07900	NPDDITNEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35643 (Experiment 1)	35643	62.266	957.377869	2+	2+	1912.7404194053506	0	0.399874154322035	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 7.166341886207292)	Phosphorylation of Y (10: 0.9693053311793215)		0	Y10-{Y10 Y14}	1	100.0	Confident
425	P13051	TLYSFFSPSPAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45624 (Experiment 1)	45624	77.949	726.832581	2+	2+	1451.6486317273402	0	1.3602456583564408	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
426	P21964	GSSCFECTHYQSFLEYR	Phosphorylation of Y(16)	Carbamidomethylation of C(4, 7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38885 (Experiment 1)	38885	66.217	750.960022	3+	3+	2249.8547550482804	0	1.5453803850170094	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 4.690677236065243)	Phosphorylation of Y (10: 96.50959860383944)		0	Y16-{Y10 Y16}	1	97.74436090225565	Confident
427	Q96GX9	HGDEIYIAPSGVQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25257 (Experiment 1)	25257	50.206	797.369263	2+	2+	1592.7235875727504	0	0.2417284792910565	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
428	P27797	IDDPTDSKPEDWDKPEHIPDPDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27309 (Experiment 1)	27309	52.586	690.822449	4+	4+	2759.256233732661	0	1.612718030623517								100.0	Doubtful
429	Q6UXV4	KVYATSQQIFGAVK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31725 (Experiment 1)	31725	57.739	540.610168	3+	3+	1618.8120086543306	0	-2.055731412400343	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.42931937172776)	Y3	1		0	99.24812030075188	Confident
430	Q04837	DVAYQYVK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23363 (Experiment 1)	23363	47.892	533.236755	2+	2+	1064.4579774233503	0	0.9185825211102518	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 7.442311830823952)	Phosphorylation of Y (6: 2.9668411867364743)		0	Y6-{Y4 Y6}	1	99.45652173913044	Confident
431	P62917	ASGNYATVISHNPETK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17817 (Experiment 1)	17817	40.706	590.268311	3+	3+	1767.7828933540202	0	0.1187288136508116	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
432	P13639	CLYASVLTAQPR	Phosphorylation of Y(3)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35972 (Experiment 1)	35972	62.677	729.846741	2+	2+	1457.6738009293601	0	3.5131725220977543	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
433	P36578	KLDELYGTWR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33879 (Experiment 1)	33879	60.205	454.21524	3+	3+	1359.6224169795003	0	1.0814415190533426	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
434	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35496 (Experiment 1)	35496	62.093	616.267944	2+	2+	1230.5209716027305	0	0.2948910098438913	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 8: 0.0)	Phosphorylation of Y (6: 3.664921465968586)		0	Y6-{Y3 Y6 Y8}	1	100.0	Confident
435	O75368	IGFEEKDIAANEENRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20318 (Experiment 1)	20318	43.917	621.647217	3+	3+	1861.9170051505305	0	1.5102098692588553								100.0	Confident
436	O00571, O15523, P17844	TIVFVETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29045 (Experiment 1)	29045	54.629	468.774597	2+	2+	935.5327834385903	0	1.981369594671177								99.7289972899729	Confident
437	P61353	NIDDGTSDRPYSHALVAGIDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28499 (Experiment 1)	28499	53.994	568.780029	4+	4+	2271.0879866391006	0	1.3289397988162528								100.0	Doubtful
438	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37948 (Experiment 1)	37948	65.069	952.980042	2+	2+	1903.9444793758603	0	0.551790724667021	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
439	P36578	NIPGITLLNVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44467 (Experiment 1)	44467	75.325	634.882324	2+	2+	1267.7499868435902	0	0.0852305937785191								100.0	Confident
440	P62899	SAINEVVTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19747 (Experiment 1)	19747	43.222	494.775269	2+	2+	987.5349086969104	0	1.087736901864986								99.74811083123426	Confident
441	Q6PI48	FYSLPQSPQQFK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37010 (Experiment 1)	37010	63.941	775.360352	2+	2+	1548.7013955761904	0	3.0666416954609446	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.06138933764136)	Y2	1		0	99.45799457994579	Confident
442	P61604	VLLPEYGGTK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28024 (Experiment 1)	28024	53.427	578.786377	2+	2+	1155.5576914646201	0	0.44023321933665654	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
443	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30058 (Experiment 1)	30058	55.797	452.23053	3+	3+	1353.6693671719202	0	0.28999056297061243	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.90575916230367)	Y4	1		0	97.77777777777777	Confident
444	P15311, P26038, P35241	QLFDQVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32316 (Experiment 1)	32316	58.415	488.776489	2+	2+	975.5389314481904	0	-0.5180093185201874								99.7289972899729	Confident
445	P11142	SQIHDIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27431 (Experiment 1)	27431	52.732	741.407776	2+	2+	1480.79979057032	0	0.8150015955256751								100.0	Confident
446	Q12906	AYAALAALEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35768 (Experiment 1)	35768	62.427	510.789063	2+	2+	1019.5651461960304	0	-1.5398990951128015								100.0	Confident
447	P16949, Q93045	DLSLEEIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33805 (Experiment 1)	33805	60.12	537.787415	2+	2+	1073.5604547384103	0	-0.16518795354072396								100.0	Confident
448	P11586	GVPTGFILPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46009 (Experiment 1)	46009	78.762	585.35675	2+	2+	1168.69682907192	0	1.8091516734051876								100.0	Confident
449	P62851	DKLNNLVLFDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38881 (Experiment 1)	38881	66.213	440.250061	3+	3+	1317.7292513990103	0	-0.6797643093831126								100.0	Confident
450	Q8TEM1	AVDPTSGQLYGLAR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34656 (Experiment 1)	34656	61.12	764.366028	2+	2+	1526.71302288905	0	2.9306577553037303	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
451	P50991	VIDPATATSVDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32835 (Experiment 1)	32835	59.011	679.371399	2+	2+	1356.72489429456	0	2.4660885666041406								100.0	Confident
452	Q15233	FACHSASLTVR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16164 (Experiment 1)	16164	38.55	416.877319	3+	3+	1247.60809072051	0	1.6286824912596582								99.24812030075188	Confident
453	P09496	LEALDANSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17068 (Experiment 1)	17068	39.688	494.756775	2+	2+	987.4985231881903	0	0.4789003775486571								98.7012987012987	Confident
454	P61247	TSYAQHQQVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5328 (Experiment 1)	5328	18.823	433.194702	3+	3+	1296.5612137052703	0	0.8178733165715791	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
455	ALDOA_RABIT, P04075	ALSDHHIYLEGTLLKPNMVTPGHACTQK	Phosphorylation of Y(8)	Carbamidomethylation of C(25)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34860 (Experiment 1)	34860	61.358	643.115112	5+	5+	3210.5355401332404	0	1.1312241763141746	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Doubtful
456	Q9BXJ9	MVYYLDPSSQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34056 (Experiment 1)	34056	60.422	705.804199	2+	2+	1409.5938192731603	0	0.018272217801473253	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (4: 0.0)		0	Y3-{Y3 Y4}	1	96.19565217391303	Confident
457	Q15052	VIEAYCTSANFQQGHGSSTR	Phosphorylation of Y(5)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20234 (Experiment 1)	20234	43.823	764.994568	3+	3+	2291.9630596273005	0	-0.5163553548825212	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
458	P08238	YHTSQSGDEMTSLSEYVSR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32501 (Experiment 1)	32501	58.63	752.974792	3+	3+	2255.9042073385003	0	-0.7351896031492223	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 39.46515752045704)	Phosphorylation of Y (16: 100.0)		0	Y16-{Y1 Y16}	1	100.0	Confident
459	P62805	TVTAMDVVYALKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46538 (Experiment 1)	46538	79.632	516.261963	3+	3+	1545.7626159337606	0	0.9321282944083704	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
460	O75564	GDPGEGEEVAWEQAAVAFDAVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.13 min, Period: 1, Cycle(s): 1866 (Experiment 1)	1866	7.735	806.390015	2+	3+	2415.134268125181	1	4.380460216636593								100.0	Doubtful
461	Q12906	VLGMDPLPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33796 (Experiment 1)	33796	60.109	528.791992	2+	2+	1055.56851732431	0	0.8639908217153958								100.0	Confident
462	Q9NSD9	AAGASDVVLYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24660 (Experiment 1)	24660	49.512	587.282471	2+	2+	1172.5478550569103	0	2.1574072593299425	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.03069466882067)	Y10	1		0	99.74489795918367	Confident
463	Q13347	GHFGPINSVAFHPDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28147 (Experiment 1)	28147	53.577	560.614624	3+	3+	1678.8215886440603	0	0.2699154385525216								100.0	Confident
464	P27635, Q96L21	EHVIEALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16832 (Experiment 1)	16832	39.372	483.771576	2+	2+	965.5294293936502	0	-0.8581803920879082								99.73474801061008	Confident
465	P62249	TLLVADPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24951 (Experiment 1)	24951	49.85	442.76239	2+	2+	883.51271670035	0	-2.8114707014795384								96.7479674796748	Confident
466	P19338	GIAYIEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38206 (Experiment 1)	38206	65.387	470.760315	2+	2+	939.5065686907503	0	-0.5221596870971656								99.73753280839895	Confident
467	P61247	APAMFNIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34058 (Experiment 1)	34058	60.424	460.244843	2+	2+	918.4745573698201	0	0.625424624300242								99.74811083123426	Confident
468	P11142	RFDDAVVQSDMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22190 (Experiment 1)	22190	46.471	470.894012	3+	3+	1409.6609141390104	0	-0.5008480847537458								100.0	Confident
469	P40926	SQETECTYFSTPLLLGKK	Phosphorylation of Y(8)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42275 (Experiment 1)	42275	71.158	728.344299	3+	3+	2181.0064875790704	1	0.5609738133655694	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
470	Q07955	TKDIEDVFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30530 (Experiment 1)	30530	56.34	419.883331	3+	3+	1256.6288686514004	0	-0.5597201172030698								97.74436090225565	Confident
471	P60174	IIYGGSVTGATCK	Phosphorylation of Y(3)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20494 (Experiment 1)	20494	44.123	703.824829	2+	2+	1405.63126741104	0	2.7262932766630508	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
472	Q8NBX0	SAIYGFGDQSNLRK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26322 (Experiment 1)	26322	51.445	818.376892	2+	2+	1634.7453856464901	0	-3.7602216239709865	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
473	Q9H910	TSDIFGSPVTATSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33080 (Experiment 1)	33080	59.287	719.862366	2+	2+	1437.7099725064104	0	0.14347186681438748								90.29649595687331	Doubtful
474	P61019, Q8WUD1	LQIWDTAGQESFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41753 (Experiment 1)	41753	70.303	775.884583	5+	2+	1549.7525060247303	0	1.357833724717046								99.73684210526315	Confident
475	P62241	LLACIASRPGQCGR		Carbamidomethylation of C(4, 12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20230 (Experiment 1)	20230	43.819	520.269592	3+	3+	1557.7868004418099	0	0.09364232828272975								100.0	Confident
476	P78527	YFEGVSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21081 (Experiment 1)	21081	44.83	463.733276	2+	2+	925.4545331178902	0	-2.73222207855772								99.19137466307278	Confident
477	Q15717	SLFSSIGEVESAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42639 (Experiment 1)	42639	71.777	677.349976	2+	2+	1352.6823607762406	0	2.2427822079526276								99.73262032085562	Confident
478	P05204	LSAKPAPPKPEPKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6512 (Experiment 1)	6512	21.095	396.992096	4+	4+	1583.9399128715904	0	-0.39971739434513787								100.0	Doubtful
479	P49411	ILAEGGGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8722 (Experiment 1)	8722	26.045	408.234833	2+	2+	814.4548674710602	0	0.3008016095988919								91.42091152815013	Confident
480	P00492	DLNHVCVISETGK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23884 (Experiment 1)	23884	48.568	491.245636	3+	3+	1470.7136779878604	0	0.9503820031825181								92.61744966442953	Doubtful
481	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10181 (Experiment 1)	10181	28.999	405.50766	3+	3+	1213.5016331404804	0	-0.39665565963341237	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
482	Q92598	RGPFELEAFYSDPQGVPYPEAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46268 (Experiment 1)	46268	79.219	859.729431	3+	3+	2576.1624706265006	0	1.5481534464789615	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 15.99213183977579)	Phosphorylation of Y (10: 88.64963792265893)		0	Y10-{Y10 Y18}	1	100.0	Confident
483	P60842	ATQALVLAPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26652 (Experiment 1)	26652	51.821	570.840942	2+	2+	1139.6662572196303	0	0.9405840372039045								100.0	Confident
484	O14950, P19105, P24844	EAFNMIDQNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29565 (Experiment 1)	29565	55.225	619.285583	2+	2+	1236.5557207944803	0	0.7204047395900818								100.0	Confident
485	Q7L5N7	IGIEEFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33463 (Experiment 1)	33463	59.728	453.749969	2+	2+	905.4858332461704	0	-0.49386182208512186								98.69109947643979	Confident
486	P07858	HYGYNSYSVSNSEK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16681 (Experiment 1)	16681	39.182	572.227234	3+	3+	1713.6671948954406	0	-4.265359522381006	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 4: 0.0)	Phosphorylation of Y (2: 0.0)		0	Y2-{Y2 Y4 Y7}	1	100.0	Doubtful
487	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13635 (Experiment 1)	13635	34.699	600.786743	2+	2+	1199.5587540937802	0	0.14894854490373122	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
488	P49354	NYQVWHHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10957 (Experiment 1)	10957	30.42	407.176971	3+	3+	1218.5083902867702	0	0.5675772752409471	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.60383944153578)	Y2	1		0	96.71052631578947	Confident
489	P22626	NYYEQWGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26929 (Experiment 1)	26929	52.142	584.228943	2+	2+	1166.4433899883702	0	-0.0487154841755345	Phosphorylation of Y (3: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (3: 5.5846422338568935)		0	Y3-{Y2 Y3}	1	100.0	Confident
490	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30532 (Experiment 1)	30532	56.343	609.260071	2+	2+	1216.5053215385904	0	0.21955143382241052	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 6.436646792675202)	Phosphorylation of Y (6: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
491	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33793 (Experiment 1)	33793	60.105	977.536194	2+	2+	1953.0571274518006	0	0.36193791888834415								100.0	Confident
492	P25789	LLDEVFFSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45120 (Experiment 1)	45120	76.837	613.817383	2+	2+	1225.6230549949705	0	-2.314957261334867								99.73262032085562	Confident
493	P16333	ETVYCIGQR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18969 (Experiment 1)	18969	42.255	603.255798	2+	2+	1204.49477393823	0	1.880738171920887	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
494	P07339	LSPEDYTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30050 (Experiment 1)	30050	55.787	533.276917	2+	2+	1064.5389910178403	0	0.2719493430351848								93.6	Confident
495	P67936	IQALQQQADEAEDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20490 (Experiment 1)	20490	44.119	807.886414	2+	2+	1613.7645272604104	0	-3.8694609376525033								100.0	Confident
496	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39142 (Experiment 1)	39142	66.54	621.324097	3+	3+	1860.9498991094704	0	0.30176964868485207	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.50959860383944)	Y5	1		0	97.74436090225565	Confident
497	P55209	KYAVLYQPLFDKR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35765 (Experiment 1)	35765	62.424	574.298523	3+	3+	1719.8749432640602	0	-0.6986283305951987	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 22.355510347592308)	Phosphorylation of Y (2: 3.315881326352531)		0	Y2-{Y2 Y6}	1	100.0	Confident
498	Q13404	YPEAPPFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33460 (Experiment 1)	33460	59.725	538.282227	2+	2+	1074.5498304850603	0	0.06556162987293812								98.73737373737373	Confident
499	P11586	AAEEIGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16830 (Experiment 1)	16830	39.37	415.734985	2+	2+	829.4545331178902	0	1.0631164775092035								97.289972899729	Confident
500	P25685, Q9UDY4	VSLEEIYSGCTK	Phosphorylation of Y(7)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32503 (Experiment 1)	32503	58.634	733.314087	2+	2+	1464.6207622969903	0	-4.869124955822071	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Doubtful
501	Q9NR30	AAVIGDVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29839 (Experiment 1)	29839	55.541	457.278992	2+	2+	912.5392658013602	0	4.554423075572348								100.0	Confident
502	P04406	VPTANVSVVDLTCR		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36357 (Experiment 1)	36357	63.167	765.901367	2+	2+	1529.7871772812903	0	0.6552970047535274								100.0	Confident
503	O75347	RLEAAYLDLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30531 (Experiment 1)	30531	56.342	449.917358	3+	3+	1346.7306483813402	0	-0.29915246153063846								100.0	Confident
504	P15311, P26038, P35241	KAPDFVFYAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36027 (Experiment 1)	36027	62.748	437.568054	3+	3+	1309.6819072837702	0	0.3239998348158699								100.0	Confident
505	P15311, P26038, P35241	NISFNDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11069 (Experiment 1)	11069	30.622	483.255768	2+	2+	964.4977949122003	0	-0.8399746015484002								96.4769647696477	Confident
506	Q12768	DYAQLGPR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19345 (Experiment 1)	19345	42.719	500.219482	2+	2+	998.4222606209701	0	2.1495064725103514	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	99.73474801061008	Confident
507	Q13185	KVEEAEPEEFVVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26192 (Experiment 1)	26192	51.295	554.614258	3+	3+	1660.8195825250407	0	0.8186324209120367								100.0	Confident
508	P10696	VQHASPAGAYAHTVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10684 (Experiment 1)	10684	29.92	560.285278	3+	3+	1677.8335503100907	0	0.2702727901316677								100.0	Confident
509	P78371	EALLSSAVDHGSDEVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25985 (Experiment 1)	25985	51.053	552.940674	3+	3+	1655.8002440627906	0	-0.031023958337215045								100.0	Confident
510	Q5JTH9	VLDPASSDFTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27687 (Experiment 1)	27687	53.038	604.302551	2+	2+	1206.58806646858	0	2.054105920241502								99.46091644204851	Confident
511	P60842, Q14240	GYDVIAQAQSGTGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23814 (Experiment 1)	23814	48.475	737.836914	2+	2+	1473.6500882793205	0	6.225524959241597	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Doubtful
512	P46940	LQQTYAALNSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17529 (Experiment 1)	17529	40.33	658.815674	2+	2+	1315.6173315990602	0	-0.40719467308143686	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
513	P33991	DYIAYAHSTIMPR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33481 (Experiment 1)	33481	59.749	809.360413	2+	2+	1616.7058293336302	0	0.2741256306777139	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 9.197281465312287)	Phosphorylation of Y (2: 15.095986038394415)		0	Y2-{Y2 Y5}	1	99.5049504950495	Confident
514	P06576	AHGGYSVFAGVGER	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28908 (Experiment 1)	28908	54.472	496.220764	3+	3+	1485.6401923019605	0	0.1815708330669709	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
515	P18583	KKEADSVYGEWVPVEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28800 (Experiment 1)	28800	54.349	648.646301	3+	3+	1942.9077595139706	0	4.7864453299372585	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.65095986038395)	Y8	1		0	99.37888198757764	Doubtful
516	O00571, O15523	DREEALHQFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14689 (Experiment 1)	14689	36.328	434.218567	3+	3+	1299.6319969692304	0	1.4390855771814468								97.74436090225565	Confident
517	P04083	DITSDTSGDFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25149 (Experiment 1)	25149	50.082	607.269592	2+	2+	1212.5258601348403	0	-1.0119617686074867								100.0	Confident
518	Q9UMS4	TVPEELVKPEELSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29085 (Experiment 1)	29085	54.675	533.294067	3+	3+	1596.8610534142006	0	-0.42616534225523844								99.37888198757764	Confident
519	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27856 (Experiment 1)	27856	53.236	609.259521	2+	2+	1216.5053215385904	0	-0.6831831240813536	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 33.54964448179688)	Phosphorylation of Y (3: 0.34904013961605584)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
520	Q13263	KLIYFQLHR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33444 (Experiment 1)	33444	59.704	649.343384	2+	2+	1296.6743929827103	0	-1.6770115286280958	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 84.99127399650959)	Y4	1		0	92.99191374663073	Confident
521	P78527	YNFPVEVEVPMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44926 (Experiment 1)	44926	76.403	804.890259	2+	2+	1607.7653792075505	0	0.3639372150759687								92.11956521739131	Confident
522	P49207	AFLIEEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29385 (Experiment 1)	29385	55.018	489.268768	2+	2+	976.5229470308802	0	0.036825871156711286								99.1891891891892	Confident
523	O75083	AHDGGIYAISWSPDSTHLLSASGDK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42219 (Experiment 1)	42219	71.064	667.055542	4+	4+	2664.1857252522204	0	2.7497338090944803	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Doubtful
524	O43390, O60506	TGYTLDVTTGQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26903 (Experiment 1)	26903	52.112	656.330322	2+	2+	1310.6466439738601	0	-0.4212111133755707								100.0	Confident
525	P37837	LVPVLSAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26940 (Experiment 1)	26940	52.156	413.773712	2+	2+	825.5323895157703	0	0.5819012566415521								99.46091644204851	Confident
526	P13639	VFSGLVSTGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36209 (Experiment 1)	36209	62.988	554.323547	2+	2+	1106.6335601090204	0	-0.9191759158460969								100.0	Confident
527	ALDOA_RABIT, P04075	ALANSLACQGK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16809 (Experiment 1)	16809	39.342	566.79303	2+	2+	1131.5706425826302	0	0.7626102997742515								100.0	Confident
528	P42704	VYLQNEYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18558 (Experiment 1)	18558	41.738	568.754761	2+	2+	1135.4950912080603	0	-0.10737639460346152	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 30.81684666379549)	Phosphorylation of Y (7: 78.88307155322862)		0	Y7-{Y2 Y7}	1	91.05691056910568	Confident
529	P31942	DGMDNQGGYGSVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18454 (Experiment 1)	18454	41.607	706.795593	2+	2+	1411.57864106703	0	-1.4204940025239279								100.0	Confident
530	Q08945	NMSGSLYEMVSR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40928 (Experiment 1)	40928	69.068	727.297485	2+	2+	1452.5778519391904	0	1.7634680182360227	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.72826086956522	Confident
531	O15067	ELSDPAGAIIYTSR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40847 (Experiment 1)	40847	68.951	786.871155	2+	2+	1571.7232532195803	0	2.8618787564262216	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.30191972076788)	Y11	1		0	99.45945945945947	Confident
532	HBA_HUMAN, P69905	TYFPHFDLSHGSAQVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34177 (Experiment 1)	34177	60.564	459.228577	4+	4+	1832.8845828234405	0	0.3371466580849001								100.0	Doubtful
533	P12268	FVPYLIAGIQHSCQDIGAK		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43586 (Experiment 1)	43586	73.402	706.367798	3+	3+	2116.07754562655	0	1.8965476848486782								99.25373134328358	Confident
534	P07195	IVVVTAGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22880 (Experiment 1)	22880	47.301	457.295837	2+	2+	912.5756513100803	0	1.6070107562921037								99.73333333333333	Confident
535	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33032 (Experiment 1)	33032	59.232	630.797974	2+	2+	1259.5798834611805	0	1.1981704671579947	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
536	P30101	GFPTIYFSPANKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40614 (Experiment 1)	40614	68.63	775.375183	2+	2+	1548.7377810849107	0	-1.2690733985571918	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
537	P63244	FSPNSSNPIIVSCGWDK		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40570 (Experiment 1)	40570	68.572	954.456726	2+	2+	1906.8883478745402	0	5.527359108331491								99.1869918699187	Doubtful
538	P23246	DKLESEMEDAYHEHQANLLR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33325 (Experiment 1)	33325	59.568	627.778015	4+	4+	2507.0788176555307	0	1.6472717808077264	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Doubtful
539	Q00839	YNILGTNTIMDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39962 (Experiment 1)	39962	67.689	691.853821	2+	2+	1381.6911516381303	0	1.4001736345970104								90.2439024390244	Doubtful
540	Q9H6Z4	DTGQLYAALHHR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26442 (Experiment 1)	26442	51.582	487.893127	3+	3+	1460.6561767192704	0	0.9393324814259234	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
541	P12268	HGFCGIPITDTGR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29209 (Experiment 1)	29209	54.815	477.566284	3+	3+	1429.6772329094902	0	-0.14679281339404993								100.0	Confident
542	P10412, P16402, P16403	ASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31488 (Experiment 1)	31488	57.458	599.837646	2+	2+	1197.6605031328502	0	0.19666452543145976								100.0	Confident
543	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	QVHPDTGISSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8061 (Experiment 1)	8061	24.572	390.203461	3+	3+	1167.5884008217504	0	0.13051125793343699								100.0	Confident
544	P13639	CLYASVLTAQPR	Phosphorylation of Y(3)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36099 (Experiment 1)	36099	62.84	486.898651	3+	3+	1457.6738009293601	0	0.22090173820586126	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
545	Q00610	HDVVFLITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32993 (Experiment 1)	32993	59.189	536.313599	2+	2+	1070.61243074162	0	0.19981294424867108								92.36842105263158	Confident
546	Q13547	YYAVNYPLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35015 (Experiment 1)	35015	61.542	619.785461	2+	2+	1237.5532747905202	0	2.4962537640899862	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.17452006980802792)		0	Y2-{Y1 Y2 Y6}	1	100.0	Confident
547	P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0	FDSDVGEYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20254 (Experiment 1)	20254	43.846	584.221069	2+	2+	1166.4281338470503	0	-0.4696684574402634	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
548	P31942	VHIDIGADGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19683 (Experiment 1)	19683	43.137	526.778259	2+	2+	1051.54105670651	0	0.8621850214430236								99.74424552429667	Confident
549	P30041	DFTPVCTTELGR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34611 (Experiment 1)	34611	61.071	698.332031	2+	2+	1394.65001510214	0	-0.36231732065670524								100.0	Confident
550	P23396	FVADGIFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37633 (Experiment 1)	37633	64.694	448.747589	2+	2+	895.4803539429104	0	0.30208914128129366								99.72826086956522	Confident
551	P22087	NLVPGESVYGEK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26360 (Experiment 1)	26360	51.487	686.310852	2+	2+	1370.6119118654503	0	-3.4683864814390666	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 86.75282714054927)	Y9	1		0	96.4769647696477	Confident
552	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27556 (Experiment 1)	27556	52.88	565.21582	2+	2+	1128.4165065341901	0	0.513549394153862	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 6: 0.0)	Phosphorylation of Y (2: 99.82547993019197)		0	Y2-{Y2 Y6}	1	99.45652173913044	Confident
553	Q02543	SSGEIVYCGQVFEK	Phosphorylation of Y(7)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35807 (Experiment 1)	35807	62.472	841.861023	2+	2+	1681.7058889032805	0	0.9527490761219691	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
554	Q8NFH5	ASTSDYQVISDR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20883 (Experiment 1)	20883	44.57	711.299683	2+	2+	1420.5871536695902	0	-1.6452976286633165	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
555	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21749 (Experiment 1)	21749	45.882	673.307861	2+	2+	1344.6002845525904	0	0.6568424472980522	Phosphorylation of Y (9: Random)	Phosphorylation of Y (7: 0.0, 9: 0.0)	Phosphorylation of Y (9: 0.16155088852988692)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
556	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21367 (Experiment 1)	21367	45.25	633.324585	2+	2+	1264.6339540318404	0	0.5234558219727818								99.7289972899729	Confident
557	P61619	GQYNTYPIK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21341 (Experiment 1)	21341	45.208	582.260986	2+	2+	1162.5059902449302	0	1.2269611335003694	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 10.223945022714512)	Phosphorylation of Y (3: 10.471204188481675)		0	Y3-{Y3 Y6}	1	98.94736842105263	Confident
558	P15144	SEVYGPMK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16950 (Experiment 1)	16950	39.525	495.703186	2+	2+	989.3929346386403	0	-1.1252409107211185	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 73.82875605815832)	Y4	1		0	91.32791327913279	Confident
559	O95478	PQNEYIELHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20055 (Experiment 1)	20055	43.615	460.209564	3+	3+	1377.6078295445202	0	-0.7003651920158513	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.33507853403141)	Y5	1		0	97.74436090225565	Confident
560	O00567	VVSLSEYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22043 (Experiment 1)	22043	46.284	516.74231	2+	2+	1031.4688764602201	0	1.1520321679065966	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.68411867364746)	Y7	1		0	98.92761394101876	Confident
561	P54136	VLTAEELNAAQTSVAYGCIK	Phosphorylation of Y(16)	Carbamidomethylation of C(18)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40686 (Experiment 1)	40686	68.73	740.022278	3+	3+	2217.0388503365107	0	2.7721147937421398	Phosphorylation of Y (16: Very Confident)	Phosphorylation of Y (16: 100.0)	Phosphorylation of Y (16: 99.82547993019197)	Y16	1		0	100.0	Confident
562	P47756	SPWSNKYDPPLEDGAMPSAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34361 (Experiment 1)	34361	60.781	740.012451	3+	3+	2217.0160675688003	0	-0.24502700475298442								99.42528735632183	Confident
563	P26639	IYGISFPDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42395 (Experiment 1)	42395	71.332	608.785767	2+	2+	1215.5576914646201	0	-0.5834546965120141	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 94.18416801292408)	Y2	1		0	99.20424403183023	Confident
564	P40227	ALQFLEEVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41316 (Experiment 1)	41316	69.629	538.803284	2+	2+	1075.5913609438705	0	0.607014583731337								99.72826086956522	Confident
565	P08238, P14625, Q58FF6, Q58FF7, Q58FF8	ELISNASDALDKIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36020 (Experiment 1)	36020	62.74	772.918823	2+	2+	1543.8205855845501	0	1.6220887746564647								92.53333333333333	Confident
566	Q9BZZ5	PTVEELYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25435 (Experiment 1)	25435	50.417	543.747131	2+	2+	1085.4794411439202	0	0.24636683700030976	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
567	A5A3E0, P0CG38, P0CG39, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3	AGFAGDDAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14617 (Experiment 1)	14617	36.214	488.727783	2+	2+	975.4410083120702	0	0.004863961180341345								100.0	Confident
568	P22234	TKEVYELLDSPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31161 (Experiment 1)	31161	57.076	493.596741	3+	3+	1477.76642475337	0	1.329593335467106								100.0	Confident
569	P12268	KYEQGFITDPVVLSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37714 (Experiment 1)	37714	64.791	607.66626	3+	3+	1819.9720008455104	0	2.715178719432894								100.0	Confident
570	P11172	GLQEVGLPLHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29966 (Experiment 1)	29966	55.69	406.903412	3+	3+	1217.68805529337	0	0.2877884403725333								92.14285714285715	Doubtful
571	P14550	GLEVTAYSPLGSSDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37683 (Experiment 1)	37683	64.756	776.386841	2+	2+	1550.75765097482	0	0.9519049555766711								100.0	Confident
572	O15143	EVEERPAPTPWGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20529 (Experiment 1)	20529	44.163	528.268433	3+	3+	1581.7787207725703	0	2.9964824236543377								100.0	Confident
573	Q92688	ELVLDNCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20499 (Experiment 1)	20499	44.128	495.750183	2+	2+	989.4851816231701	0	0.636856656605723								100.0	Confident
574	P08238	YHTSQSGDEMTSLSEYVSR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32738 (Experiment 1)	32738	58.9	752.974121	3+	3+	2255.9042073385003	0	-1.6263210378639275	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 18.391501264688678)	Phosphorylation of Y (16: 100.0)		0	Y16-{Y1 Y16}	1	100.0	Confident
575	P52565	AEEYEFLTPVEEAPK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42518 (Experiment 1)	42518	71.541	916.40509	2+	2+	1830.7964777294908	0	-0.4641302898972191	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 93.01919720767889)	Y4	1		0	96.2059620596206	Confident
576	O00148, Q13838	DFLLKPELLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43887 (Experiment 1)	43887	73.937	415.251373	3+	3+	1242.7336085034601	0	-1.0587181527926814								92.14285714285715	Doubtful
577	P26583	KHPDSSVNFAEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23212 (Experiment 1)	23212	47.696	531.59613	3+	3+	1591.7630707084306	0	2.1883146330907284								100.0	Confident
578	O43143	HRLDLGEDYPSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17840 (Experiment 1)	17840	40.735	496.247925	3+	3+	1485.72120589645	0	0.49686419782011687								100.0	Confident
579	P60842	GFKDQIYDIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45664 (Experiment 1)	45664	78.023	527.916992	3+	3+	1580.7276103240304	0	0.9700243581850455	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.28057553956835	Confident
580	P49458	LYLADPMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34007 (Experiment 1)	34007	60.364	475.75	2+	2+	949.4942897548901	0	-9.293332985813796								99.73333333333333	Doubtful
581	Q02790	VGEVCHITCKPEYAYGSAGSPPK	Phosphorylation of Y(13)	Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21288 (Experiment 1)	21288	45.134	863.048645	3+	3+	2586.1284107002402	0	-1.662746568351768	Phosphorylation of Y (13: Random)	Phosphorylation of Y (13: 0.0, 15: 0.0)	Phosphorylation of Y (13: 13.974114890345257)		0	Y13-{Y13 Y15}	1	100.0	Confident
582	Q15084	GESPVDYDGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16915 (Experiment 1)	16915	39.477	576.251648	2+	2+	1150.4890807033	0	-0.29295953108743394								99.73333333333333	Confident
583	P61978	TDYNASVSVPDSSGPER	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23316 (Experiment 1)	23316	47.832	930.886047	2+	2+	1859.7574664518204	0	0.04007717089454771	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
584	P51812	GAMAATYSALNR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24613 (Experiment 1)	24613	49.458	653.286438	2+	2+	1304.5584368239502	0	-0.08706560999341827	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
585	P00558	IQLINNMLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40398 (Experiment 1)	40398	68.326	601.335388	2+	2+	1200.6536439306003	0	2.1445114971874015								98.94736842105263	Confident
586	Q9UQ80	AFFSEVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32408 (Experiment 1)	32408	58.522	492.741943	2+	2+	983.4712458111903	0	-1.9409156546941957								99.72972972972973	Confident
587	A6NIZ1, P61224	VKDTDDVPMILVGNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35512 (Experiment 1)	35512	62.112	548.627502	3+	3+	1642.86000786838	0	0.40630570726380383								100.0	Confident
588	P13796	AECMLQQAER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19475 (Experiment 1)	19475	42.881	618.280029	2+	2+	1234.5434418586203	0	1.668508686405224								99.45799457994579	Confident
589	O43242	EMIDIYSTR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32694 (Experiment 1)	32694	58.849	604.256958	2+	2+	1206.4991906123303	0	0.14269928382461583	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
590	Q9P107	AQEAEALYQACVR	Phosphorylation of Y(8)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26849 (Experiment 1)	26849	52.051	794.846741	2+	2+	1587.6752574813404	0	2.3096235575697697	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 97.38219895287958)	Y8	1		0	99.72826086956522	Confident
591	Q92785	HRGPGLASGQLYSYPAR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20885 (Experiment 1)	20885	44.573	637.308594	3+	3+	1908.8995948721104	0	2.2792398256315205	Phosphorylation of Y (12: Random)	Phosphorylation of Y (12: 0.0, 14: 0.0)	Phosphorylation of Y (12: 20.331588132635254)		0	Y12-{Y12 Y14}	1	99.24812030075188	Confident
592	P17844, Q92841	STCIYGGAPK	Phosphorylation of Y(5)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13516 (Experiment 1)	13516	34.518	567.238281	2+	2+	1132.4624111807902	0	-0.35444916648609115	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
593	Q9Y265	AVLLAGPPGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26242 (Experiment 1)	26242	51.354	540.824524	2+	2+	1079.63389446219	0	0.5552674598350275								100.0	Confident
594	P31146	DAGPLLISLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43885 (Experiment 1)	43885	73.934	513.812805	2+	2+	1025.6120963884503	0	-1.0113810059652828								100.0	Confident
595	Q9BZM2	QTCMCDKNMVLCLMNQTYR		Carbamidomethylation of C(3, 5, 12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19700 (Experiment 1)	19700	43.161	823.02301	3+	3+	2465.0452192294	1	-0.5564952690250679								99.37888198757764	Confident
596	P13796	IGNFSTDIKDSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20592 (Experiment 1)	20592	44.235	442.229584	3+	3+	1323.6670450652703	0	-0.09230928862350568								100.0	Confident
597	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGRPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29191 (Experiment 1)	29191	54.796	400.239807	3+	3+	1197.69822605425	0	-0.5283951767680435								100.0	Confident
598	P20039, Q30134	YFYNQEEYVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31702 (Experiment 1)	31702	57.711	705.820984	2+	2+	1409.6251802532904	0	1.5831327447168497								100.0	Confident
599	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33560 (Experiment 1)	33560	59.84	978.039978	2+	2+	1953.0571274518006	1	2.516929084773741								98.64864864864865	Doubtful
600	Q13151	AVPKEDIYSGGGGGGSR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12813 (Experiment 1)	12813	33.464	562.920959	3+	3+	1685.7410285420399	0	0.011284902525971287	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
601	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19147 (Experiment 1)	19147	42.481	636.766357	2+	2+	1271.5183458337801	0	-0.1450825530408638	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
602	P12270	FKVESEQQYFEIEKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29663 (Experiment 1)	29663	55.338	680.652954	3+	3+	2038.9401222714107	0	-1.513089822312376	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.60383944153578)	Y9	1		0	96.71052631578947	Confident
603	Q96AE4	IQFKPDDGTTPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18373 (Experiment 1)	18373	41.499	501.919067	3+	3+	1502.7365216074202	0	-0.763739982171903								100.0	Confident
604	Q9UPU5	MSEHYWTPQSNVSNETSTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25936 (Experiment 1)	25936	50.997	788.325317	3+	3+	2361.957305540521	0	-1.3462871235239275	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.33507853403141)	Y5	1		0	96.2406015037594	Confident
605	P62942	GVQVETISPGDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21456 (Experiment 1)	21456	45.376	657.835327	2+	2+	1313.65754301073	0	-1.0959754779328792								100.0	Confident
606	Q7L1Q6	YFTEAGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24740 (Experiment 1)	24740	49.607	464.742096	2+	2+	927.4701831820303	0	-0.5853949323074404								99.72826086956522	Confident
607	P49327	SLLVNPEGPTLMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40597 (Experiment 1)	40597	68.611	713.889221	2+	2+	1425.7649852847303	0	-0.7677784455246631								100.0	Confident
608	P53396	LYRPGSVAYVSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20699 (Experiment 1)	20699	44.356	483.241333	3+	3+	1446.7020642825303	0	0.07264627022258073	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 21.201702136401888)	Phosphorylation of Y (2: 85.85197524988102)		0	Y2-{Y2 Y9}	1	100.0	Confident
609	P23528, Q9Y281	YALYDATYETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30903 (Experiment 1)	30903	56.773	669.317139	2+	2+	1336.6186978905205	0	0.7673317951257677								100.0	Confident
610	P05556	DNTNEIYSGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11521 (Experiment 1)	11521	31.346	610.745239	2+	2+	1219.4758123154602	0	0.09230602124473411	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73333333333333	Confident
611	P23526	VAVVAGYGDVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24571 (Experiment 1)	24571	49.41	567.811462	2+	2+	1133.6080736371703	0	0.2619084884743114								100.0	Confident
612	P0DMV8, P17066, P48741	FEELCSDLFR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43699 (Experiment 1)	43699	73.59	658.302979	2+	2+	1314.59143759686	0	-0.024707835382121575								94.08602150537635	Confident
613	P30101	LAPEYEAAATR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18240 (Experiment 1)	18240	41.321	636.287659	2+	2+	1270.5594823697706	0	1.0079544054384917	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
614	P10809	LVQDVANNTNEEAGDGTTTATVLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29796 (Experiment 1)	29796	55.491	854.087708	3+	3+	2559.241252374861	0	0.016479456570874938								100.0	Confident
615	Q9UHF7	AGDDTPVGYSVPIKPLDSSR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34151 (Experiment 1)	34151	60.535	718.674927	3+	3+	2153.0041790799505	0	-0.5693254079245357	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.86914378029078)	Y9	1		0	100.0	Confident
616	O75083	VFASLPQVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33724 (Experiment 1)	33724	60.027	573.820007	2+	2+	1144.6240580544802	1	-1.7022154021908795								92.65091863517061	Confident
617	P46778	VYNVTQHAVGIVVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28062 (Experiment 1)	28062	53.473	547.642029	3+	3+	1639.9045899920304	0	-0.2023173177072454								100.0	Confident
618	Q16881	LYAGSTVK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11780 (Experiment 1)	11780	31.753	459.720184	2+	2+	917.4259490190802	0	-0.14568936634150084	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 72.05169628432957)	Y2	1		0	90.5149051490515	Doubtful
619	P25685, Q9UDY4	VSLEEIYSGCTK	Phosphorylation of Y(7)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32736 (Experiment 1)	32736	58.897	733.31781	2+	2+	1464.6207622969903	0	0.20780175032495757	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
620	P36578	LAPGGHVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6563 (Experiment 1)	6563	21.199	432.246277	2+	2+	862.4773342511401	0	0.7713377603003717								99.45799457994579	Confident
621	P54819	AMVASGSELGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16582 (Experiment 1)	16582	39.06	525.270203	2+	2+	1048.5222954078802	0	3.386514715197093								99.73890339425587	Confident
622	P49368	IVLLDSSLEYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42058 (Experiment 1)	42058	70.799	640.360474	2+	2+	1278.7071189721005	0	-0.5652326657742578								97.58713136729223	Confident
623	P63244	DGQAMLWDLNEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44065 (Experiment 1)	44065	74.265	738.842834	2+	2+	1475.6714788227102	0	-0.2461661858417401								100.0	Confident
624	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33057 (Experiment 1)	33057	59.261	616.269287	2+	2+	1230.5209716027305	0	2.4741385417336814	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.714203795409155)	Phosphorylation of Y (8: 0.17452006980802792)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
625	P60174	SNVSDAVAQSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16036 (Experiment 1)	16036	38.39	617.805969	2+	2+	1233.5949427541705	0	1.976605241321525								100.0	Confident
626	P30050	EILGTAQSVGCNVDGR		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27685 (Experiment 1)	27685	53.036	838.404114	2+	2+	1674.7995328701402	0	-3.493412784292836								100.0	Confident
627	P20042	TGFQAVTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17679 (Experiment 1)	17679	40.53	454.746277	2+	2+	907.4763311916302	0	1.83605440705152								99.20634920634922	Confident
628	Q07666	KDDEENYLDLFSHK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36706 (Experiment 1)	36706	63.575	611.596252	3+	3+	1831.7665745835404	0	0.19185646861248135	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
629	P07814	LNQWCNVVR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29141 (Experiment 1)	29141	54.738	594.800537	2+	2+	1187.5869613531102	0	-0.3701127891033568								98.70801033591732	Confident
630	Q9Y512	ETSYGLSFFKPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40639 (Experiment 1)	40639	68.661	504.569214	3+	3+	1510.6857455120503	0	0.04431999605042912	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.38219895287958)	Y4	1		0	92.14285714285715	Doubtful
631	Q9NR30	GRAPQVLVLAPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27332 (Experiment 1)	27332	52.612	459.949219	3+	3+	1376.8252174725203	0	0.44217005444538043								100.0	Confident
632	P30085	KNPDSQYGELIEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19428 (Experiment 1)	19428	42.822	534.247131	3+	3+	1599.7181678391403	0	0.8708589203724956	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Confident
633	P50990	QYGNEVFLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30211 (Experiment 1)	30211	55.977	584.803833	2+	2+	1167.5924235730304	0	0.5895085780430368								99.72972972972973	Confident
634	P33991	THIDVIHYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18813 (Experiment 1)	18813	42.065	617.293579	2+	2+	1232.5703218369902	0	1.8493903759863644	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 98.87096774193549)	Y8	1		0	99.45799457994579	Confident
635	Q96GX9	HGDEIYIAPSGVQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25410 (Experiment 1)	25410	50.386	531.915222	3+	3+	1592.7235875727504	0	0.15605673116782945	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
636	P39023	TVFAEHISDECK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20383 (Experiment 1)	20383	43.99	479.222656	3+	3+	1434.6449297217002	0	0.8408609686625544								100.0	Confident
637	Q14152	IGLINDMVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38739 (Experiment 1)	38739	66.041	515.789795	2+	2+	1029.56410065021	0	0.9077506233391437								99.46091644204851	Confident
638	P78371	GATQQILDEAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28802 (Experiment 1)	28802	54.351	665.833984	2+	2+	1329.6524576302902	0	0.7189755982783299								100.0	Confident
639	P11387	AEEVATFFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37740 (Experiment 1)	37740	64.821	556.785461	2+	2+	1111.5549754351505	0	1.2514990667212553								92.69521410579345	Confident
640	P09234	TTAAFQQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9136 (Experiment 1)	9136	26.913	476.248199	2+	2+	950.4821448480602	0	-0.31473251805758								98.91598915989161	Confident
641	P16989, P67809, Q9Y2T7	NGYGFINR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26048 (Experiment 1)	26048	51.128	510.718658	2+	2+	1019.4225949741403	0	0.16456444343928064	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
642	P00387	GPSGLLVYQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30234 (Experiment 1)	30234	56.002	559.814453	2+	2+	1117.6131590176103	0	1.0664694636529306								100.0	Confident
643	P04406	GALQNIIPASTGAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34717 (Experiment 1)	34717	61.19	706.398376	2+	2+	1410.7830778770206	0	-0.6220357576840251								100.0	Confident
644	P61081	LVICPDEGFYK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38492 (Experiment 1)	38492	65.745	670.831543	2+	2+	1339.6482241969902	0	0.23021387410264094								92.63157894736842	Confident
645	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28906 (Experiment 1)	28906	54.469	569.277039	2+	2+	1136.5389910178403	0	0.46905877924255224								100.0	Confident
646	P06276, P68104, Q05639, Q5VTE0	QLIVGVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21365 (Experiment 1)	21365	45.247	435.773834	2+	2+	869.5334521449302	0	-0.38675844825685407								94.3089430894309	Confident
647	Q02543	KSSGEIVYCGQVFEK	Phosphorylation of Y(8)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29207 (Experiment 1)	29207	54.813	604.276733	3+	3+	1809.8008519172806	0	4.146948491414185	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
648	P07195	LKDDEVAQLKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11779 (Experiment 1)	11779	31.751	429.582062	3+	3+	1285.7241660185705	0	0.1478809588731684								97.76119402985076	Confident
649	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21284 (Experiment 1)	21284	45.13	636.766296	2+	2+	1271.5183458337801	0	-0.2408790574244032	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
650	Q9NY33	GDYAPILQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27972 (Experiment 1)	27972	53.368	542.757263	2+	2+	1083.5001765885002	0	-0.1874890490482008	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
651	O43175	ILQDGGLQVVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29691 (Experiment 1)	29691	55.37	649.869812	2+	2+	1297.7241660185705	0	0.6963305718455468								100.0	Confident
652	P07900, P08238, Q58FF7, Q58FF8	IRYESLTDPSKLDSGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23563 (Experiment 1)	23563	48.145	630.305969	3+	3+	1887.8979231062604	0	-0.9759836153176242	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
653	P62191, P62195, Q8NB90	GVLLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31820 (Experiment 1)	31820	57.852	619.813171	2+	2+	1237.6107896666401	0	0.8062111199264108	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.73474801061008	Confident
654	P29401	DAIAQAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16412 (Experiment 1)	16412	38.855	422.237854	2+	2+	842.4610154806603	0	0.16529278175652093								97.8319783197832	Confident
655	Q06830	KQGGLGPMNIPLVSDPKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33283 (Experiment 1)	33283	59.519	477.518219	4+	4+	1906.0458515754503	0	-1.0897178094209852								100.0	Doubtful
656	P31943, P55795	HTGPNSPDTANDGFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15943 (Experiment 1)	15943	38.269	562.261841	3+	3+	1683.76011058631	0	2.1241709845098202								100.0	Confident
657	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23445 (Experiment 1)	23445	47.992	420.570007	3+	3+	1257.68296991293	1	1.4807977528704612								100.0	Confident
658	Q02790	GEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(12, 7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41575 (Experiment 1)	41575	70.026	734.006165	3+	3+	2197.9850374660305	1	3.7588686605357484	Phosphorylation of Y (7: Very Confident, 12: Very Confident)		Phosphorylation of Y (7: 99.82547993019197, 12: 99.82547993019197)	Y7, Y12	2		0	100.0	Confident
659	Q9Y2W1	SGKWEGLVYAPPGK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32659 (Experiment 1)	32659	58.81	523.588501	3+	3+	1567.7435947413403	0	0.05020369207374911	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
660	P00519	GQGESDPLDHEPAVSPLLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38129 (Experiment 1)	38129	65.294	705.353271	3+	3+	2113.0439965688	0	-2.8415794833574743								96.73202614379085	Confident
661	Q6GTX8	AVSPQSTKPMAESITYAAVAR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34337 (Experiment 1)	34337	60.754	753.369324	3+	3+	2257.0813838548306	0	2.1055431031959886	Phosphorylation of Y (16: Very Confident)	Phosphorylation of Y (16: 100.0)	Phosphorylation of Y (16: 96.50959860383944)	Y16	1		0	99.25925925925925	Confident
662	O75688	NVIEAVYSR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26525 (Experiment 1)	26525	51.679	565.766052	2+	2+	1129.5168892818003	0	0.5848574336722285	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.93053311793214)	Y7	1		0	99.72972972972973	Confident
663	P46779	TVGVEPAADGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11311 (Experiment 1)	11311	31.032	522.272705	2+	2+	1042.5294889633003	0	1.3097610254976724								100.0	Confident
664	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29707 (Experiment 1)	29707	55.387	528.262451	2+	2+	1054.5100129962104	0	0.3180902521043452	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
665	P62424	QTATQLLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18493 (Experiment 1)	18493	41.658	451.768707	2+	2+	901.5232813840503	0	-0.4651910060870291								99.73890339425587	Confident
666	Q16836	DTPGFIVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29640 (Experiment 1)	29640	55.313	509.768646	2+	2+	1017.5243440132103	0	-1.5741889192098537								99.7289972899729	Confident
667	P62269	VLNTNIDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17761 (Experiment 1)	17761	40.631	501.2724	2+	2+	1000.53015766964	0	0.08916982474497913								100.0	Confident
668	P09874	VVDRDSEEAEIIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20279 (Experiment 1)	20279	43.874	510.929626	3+	3+	1529.7685500116904	0	-0.9795286730449637								100.0	Confident
669	ALDOA_RABIT, P04075	AAQEEYVKR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6419 (Experiment 1)	6419	20.913	391.847656	3+	3+	1172.5227029382304	0	-1.3307353514717322	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
670	P12956	TFNTSTGGLLLPSDTKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32967 (Experiment 1)	32967	59.158	603.323181	3+	3+	1806.94757700282	0	0.07546908999933137								99.24812030075188	Confident
671	P26038	ALTSELANAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22507 (Experiment 1)	22507	46.862	523.286255	2+	2+	1044.5563724174801	0	1.5141342619996345								92.5257731958763	Confident
672	Q92608, Q9H7D0	SVVYYQVK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24536 (Experiment 1)	24536	49.37	533.254578	2+	2+	1064.4943629320703	0	0.2251592106181488	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (4: 3.1413612565445024)		0	Y4-{Y4 Y5}	1	99.7289972899729	Confident
673	Q16531	TVPLYESPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21794 (Experiment 1)	21794	45.949	571.267822	2+	2+	1140.52164030907	0	-0.48072235912868205	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	99.73118279569893	Confident
674	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33269 (Experiment 1)	33269	59.504	932.895203	2+	2+	1863.7750310922602	0	0.4405502757594968	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 2.6178010471204187)		0	Y6-{Y6 Y11}	1	100.0	Confident
675	P01911, P01912, Q5Y7A7, Q9GIY3	HNYGVVESFTVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29361 (Experiment 1)	29361	54.991	512.591431	3+	3+	1534.7528403779004	0	-0.24501530950090422								100.0	Confident
676	O43175, Q13363	TLGILGLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42559 (Experiment 1)	42559	71.618	450.287567	2+	2+	898.5600012459399	0	0.6438339097078826								99.45799457994579	Confident
677	Q9Y5Z4	VYYTAGYNSPVK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27612 (Experiment 1)	27612	52.953	721.323181	2+	2+	1440.6326473100305	0	-0.5810454936983314	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 1.0471204188481675)		0	Y2-{Y2 Y3 Y7}	1	100.0	Confident
678	P18669, Q8N0Y7	SYDVPPPPMEPDHPFYSNISK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38459 (Experiment 1)	38459	65.704	833.032471	3+	3+	2496.0708787407802	0	1.8826267502140783	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 10.854536476826103)	Phosphorylation of Y (16: 99.35379644588045)		0	Y16-{Y2 Y16}	1	98.49624060150376	Confident
679	Q9UBT2	ELAEAVAGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16896 (Experiment 1)	16896	39.451	486.759094	2+	2+	971.5036085686302	0	0.027218542980355576								99.72972972972973	Confident
680	P68104, Q5VTE0	YYVTIIDAPGHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31355 (Experiment 1)	31355	57.301	702.867798	2+	2+	1403.71974934447	0	0.9203175192289378								100.0	Confident
681	P00519	GAVSTLLQAPELPTKTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37055 (Experiment 1)	37055	63.993	594.675415	3+	3+	1781.0046979561203	0	-0.1582692588349767								98.56115107913669	Confident
682	P40429, Q6NVV1	YQAVTATLEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23943 (Experiment 1)	23943	48.644	626.826172	2+	2+	1251.6346823078306	0	2.4797674324719545								99.7340425531915	Confident
683	P36873, P62136, P62140	AHQVVEDGYEFFAK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35921 (Experiment 1)	35921	62.609	573.91748	3+	3+	1718.7341522564507	0	-2.0570028068096673	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
684	P61160	GYAFNHSADFETVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28633 (Experiment 1)	28633	54.151	538.583313	3+	3+	1612.7270195528806	0	0.6746386878273144								100.0	Confident
685	Q9UN86	NSSYVHGGVDASGKPQEAVYGQNDIHHK	Phosphorylation of Y(20)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15172 (Experiment 1)	15172	37.127	769.350891	4+	4+	3073.36794013083	0	2.1180243642530243	Phosphorylation of Y (20: Doubtfull)	Phosphorylation of Y (20: 17.899796346635615)	Phosphorylation of Y (20: 0.17452006980802792)		0	Y20-{Y4 Y20}	1	100.0	Doubtful
686	Q07666	SGSMDPSGAHPSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11129 (Experiment 1)	11129	30.753	462.213501	3+	3+	1383.6201119561902	0	-1.037294908819243								99.24812030075188	Confident
687	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34476 (Experiment 1)	34476	60.915	631.298889	4+	2+	1259.5798834611805	1	-0.010488794444036727	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	99.73684210526315	Confident
688	P13639	SDPVVSYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16721 (Experiment 1)	16721	39.232	501.718445	2+	2+	1001.4219262678002	0	0.40939170968993543	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.16055846422339)	Y7	1		0	96.24664879356568	Confident
689	Q9UKY7	KTPQGPPEIYSDTQFPSLQSTAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37385 (Experiment 1)	37385	64.388	867.415039	3+	3+	2599.2207137786104	0	0.9890780397047476	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.83844911147011)	Y10	1		0	100.0	Confident
690	P62269	VITIMQNPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26246 (Experiment 1)	26246	51.358	536.803711	2+	2+	1070.59064975122	1	-1.0586585273387108								99.7289972899729	Confident
691	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32798 (Experiment 1)	32798	58.97	932.895691	2+	2+	1863.7750310922602	0	0.9636532067614993	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 1.3961605584642234)		0	Y6-{Y6 Y11}	1	100.0	Confident
692	P36578	SNYNLPMHK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16536 (Experiment 1)	16536	39.0	592.251831	2+	2+	1182.4892946349703	0	-0.15666356402466936	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
693	P08238, Q58FF8	SIYYITGESK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32154 (Experiment 1)	32154	58.232	620.778564	2+	2+	1239.5424353233002	0	0.11255470099276457	Phosphorylation of Y (4: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (4: 0.17452006980802792)		0	Y4-{Y3 Y4}	1	100.0	Confident
694	P08621	EFEVYGPIKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29412 (Experiment 1)	29412	55.049	659.31781	2+	2+	1316.6166033230702	0	3.3851341100944197	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
695	O60506	VTEGLTDVILYHQPDDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38955 (Experiment 1)	38955	66.301	648.331848	3+	3+	1941.9683720170503	0	2.7468428940582292								99.28057553956835	Confident
696	P60842, Q14240	VLITTDLLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42472 (Experiment 1)	42472	71.448	557.844971	2+	2+	1113.67575927417	0	-0.3318194934789946								100.0	Confident
697	P22626	LTDCVVMRDPASK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20414 (Experiment 1)	20414	44.024	497.915405	3+	3+	1490.7221344965803	0	1.5070206394708545								100.0	Confident
698	P22234	NFEWVAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36178 (Experiment 1)	36178	62.953	525.753967	2+	2+	1049.4930438849303	0	0.3206647736282533								99.72826086956522	Confident
699	Q00839	YNILGTNTIMDK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41438 (Experiment 1)	41438	69.809	731.834961	2+	2+	1461.6574821588804	0	-1.443692612705868	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 96.76898222940227)	Y1	1		0	98.91891891891892	Confident
700	Q00839	SSGPTSLFAVTVAPPGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43834 (Experiment 1)	43834	73.845	857.96106	2+	2+	1713.9049839148504	0	1.5054036450673636								100.0	Confident
701	P60842	GFKDQIYDIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45548 (Experiment 1)	45548	77.771	527.916748	3+	3+	1580.7276103240304	0	0.5078300351199079	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
702	Q8TDN6	KKQDLYMWLSNSPHGPSAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30401 (Experiment 1)	30401	56.193	567.522156	4+	4+	2266.0605888406	0	-0.471658829452165	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Doubtful
703	O15067	GHLLYVALSPGQHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29883 (Experiment 1)	29883	55.593	543.610779	3+	3+	1626.8031753061302	1	2.4404188316894984	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.25479930191972)	Y5	1		0	100.0	Confident
704	P25685, Q9UDY4	VSLEEIYSGCTK	Phosphorylation of Y(7)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32775 (Experiment 1)	32775	58.944	489.213959	3+	3+	1464.6207622969903	0	-0.48696966850352114	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	99.37888198757764	Confident
705	P54578	AQLFALTGVQPAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41434 (Experiment 1)	41434	69.804	686.391113	2+	2+	1370.76703389006	0	0.46560670831158996								100.0	Confident
706	P07437, P68371, Q13885, Q9BVA1	EVDEQMLNVQNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25910 (Experiment 1)	25910	50.967	723.848267	2+	2+	1445.6820435064103	0	-0.04313060808423401								100.0	Confident
707	P22090, P62701, Q8TD47	LTGVFAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26886 (Experiment 1)	26886	52.094	430.752991	2+	2+	859.4915873329501	0	-0.18370916535445098								92.83819628647215	Confident
708	P84090	MYEEHLKR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8087 (Experiment 1)	8087	24.62	395.842407	3+	3+	1184.5049446991102	0	0.3763287392394609	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.42931937172776)	Y2	1		0	97.76119402985076	Confident
709	P35579	NKHEAMITDLEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20412 (Experiment 1)	20412	44.022	529.259521	3+	3+	1584.7566054290003	0	0.08072320475379977								100.0	Confident
710	P25685	DYYQTLGLAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37387 (Experiment 1)	37387	64.391	640.292603	2+	2+	1278.5645677502102	0	4.752003267343455	Phosphorylation of Y (3: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (3: 2.9700447894165167)		0	Y3-{Y2 Y3}	1	99.45652173913044	Confident
711	P62805	KTVTAMDVVYALK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45581 (Experiment 1)	45581	77.839	506.926086	3+	3+	1517.7564679241605	0	-0.025858204624387683	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 95.15347334410339)	Y10	1		0	97.74436090225565	Confident
712	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44491 (Experiment 1)	44491	75.388	625.278442	2+	2+	1248.5427696764702	0	-0.35073169888056444	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.60743134087238)	Y4	1		0	99.7289972899729	Confident
713	P49588	TITVALADGGRPDNTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23460 (Experiment 1)	23460	48.01	571.968323	3+	3+	1712.8805600721603	0	1.5033066098836139								99.42196531791907	Confident
714	Q14807	STQQDIYAGSVQPILR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37269 (Experiment 1)	37269	64.246	619.304016	3+	3+	1854.8876927757303	0	1.35949776007529	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 95.31502423263328)	Y7	1		0	98.52941176470588	Confident
715	Q15154	TEYMAFPKPFESSSSIGAEKPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37762 (Experiment 1)	37762	64.846	847.0578	3+	3+	2538.1501916906404	0	0.5426271468542857	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.86914378029078)	Y3	1		0	100.0	Confident
716	P49327	GYAVLGGER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21417 (Experiment 1)	21417	45.319	501.22644	2+	2+	1000.43791068511	0	0.4153626045011465	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.19224555735056)	Y2	1		0	99.73544973544973	Confident
717	P46776	TGAAPIIDVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34733 (Experiment 1)	34733	61.21	556.32782	2+	2+	1110.6397081186203	0	1.239331752686293								100.0	Confident
718	P12268	NLIDAGVDALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42768 (Experiment 1)	42768	72.034	578.820984	2+	2+	1155.6247863304702	0	2.270772784222229								100.0	Confident
719	Q96GX9	HGDEIYIAPSGVQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25192 (Experiment 1)	25192	50.132	531.915466	3+	3+	1592.7235875727504	0	0.6147765196831554	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
720	Q8N163	FAEFQYLQPGPPR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42937 (Experiment 1)	42937	72.333	815.378174	2+	2+	1628.73884371407	0	1.8098090807225362	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 84.46771378708551)	Y6	1		0	93.08510638297872	Confident
721	P31146	KLQATVQELQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16793 (Experiment 1)	16793	39.32	643.378662	2+	2+	1284.7401504358804	0	2.036620102102712								100.0	Confident
722	P55884	GTYLATFHQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21761 (Experiment 1)	21761	45.898	637.291748	2+	2+	1272.5652364565503	0	2.9081034050123025	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.38219895287958)	Y3	1		0	99.48849104859335	Confident
723	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38164 (Experiment 1)	38164	65.335	635.655518	3+	3+	1903.9444793758603	0	0.12859362148766218	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	100.0	Confident
724	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17108 (Experiment 1)	17108	39.739	514.763306	2+	2+	1027.5120650773501	0	-0.005838580856008839								100.0	Confident
725	P38606	TVISQSLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18458 (Experiment 1)	18458	41.613	481.779694	2+	2+	961.5444107514502	0	0.44036218010515193								97.5609756097561	Confident
726	Q14839, Q8TDI0	HLCEPGADGAETFADGVPR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29744 (Experiment 1)	29744	55.433	666.97052	3+	3+	1997.8901387796902	0	-0.20399704375775726								100.0	Confident
727	P07900, Q58FG0	HIYYITGETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19924 (Experiment 1)	19924	43.457	612.816467	2+	2+	1223.6186383208703	0	-0.2098951760896224								98.92761394101876	Confident
728	P52272	GGNRFEPYANPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17620 (Experiment 1)	17620	40.447	484.240051	3+	3+	1449.7000765290502	0	-1.206651788689601								100.0	Confident
729	P14625	DISTNYYASQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20530 (Experiment 1)	20530	44.164	685.285645	2+	2+	1368.5598762925904	0	-2.290445631774947	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (6: 0.0)		0	Y6-{Y6 Y7}	1	100.0	Confident
730	P55084	DQLLLGPTYATPK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39585 (Experiment 1)	39585	67.16	748.872559	2+	2+	1495.7323613513004	0	-1.1993247372667266	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.86914378029078)	Y9	1		0	99.72972972972973	Confident
731	P12004	DLSHIGDAVVISCAK		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36193 (Experiment 1)	36193	62.971	528.93988	3+	3+	1583.7977419649903	0	0.04325291598807747								100.0	Confident
732	P20339, P51148, P61020	LVLLGESAVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35897 (Experiment 1)	35897	62.581	543.332458	2+	2+	1084.6492101731603	0	1.0609475116570872								99.72972972972973	Confident
733	Q13242	DAEDAIYGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19068 (Experiment 1)	19068	42.374	545.216431	2+	2+	1088.4175691633502	0	0.6785411127745912	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
734	Q9Y230	AVLIAGQPGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19893 (Experiment 1)	19893	43.413	556.32782	2+	2+	1110.63970811862	0	1.2393317528906458								99.73333333333333	Confident
735	Q13838	HFILDECDK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24530 (Experiment 1)	24530	49.363	588.772339	2+	2+	1175.5281090643102	0	1.712041636081027								96.50537634408603	Confident
736	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28511 (Experiment 1)	28511	54.008	609.260315	2+	2+	1216.5053215385904	0	0.6200373102765451	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 15.41625462903884)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
737	P54578	SSSSGHYVSWVK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23567 (Experiment 1)	23567	48.15	468.537415	3+	3+	1402.5918451272105	0	-1.0170131896220431	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
738	Q9Y2Z0	LFQQIYSDGSDEVKR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29742 (Experiment 1)	29742	55.43	622.286743	3+	3+	1863.8404082301404	0	-1.0759393680839922	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
739	P62258	YLAEFATGNDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29414 (Experiment 1)	29414	55.051	628.798218	2+	2+	1255.58331544131	0	-1.1389769100531506								98.91891891891892	Confident
740	P37802, Q9UI15	GASQAGMTGYGMPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23733 (Experiment 1)	23733	48.362	692.311707	2+	2+	1382.60710474434	0	1.2684490568798246								100.0	Confident
741	P10809	TVIIEQSWGSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33389 (Experiment 1)	33389	59.642	672.863708	2+	2+	1343.7085159544301	0	3.230316880318144								100.0	Confident
742	Q9UKV3	SHCFVTYSTVEEAVATR	Phosphorylation of Y(7)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38166 (Experiment 1)	38166	65.338	679.631531	3+	3+	2035.8710567354206	0	0.8371524345638044	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Confident
743	Q96AP0	GLLLRPRPAKELPLPRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11602 (Experiment 1)	11602	31.457	489.569397	3+	4+	1953.2363696568002	1	4.474425294412242								88.23529411764706	Doubtful
744	P25705	TGAIVDVPVGEELLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45688 (Experiment 1)	45688	78.08	812.948486	2+	2+	1623.8831858411102	0	-0.47160083688899496								100.0	Confident
745	P61978	HESGASIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4038 (Experiment 1)	4038	16.601	414.713837	2+	2+	827.4137309350701	0	-0.7352880362158348								98.75621890547264	Confident
746	P49411	GITINAAHVEYSTAAR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27110 (Experiment 1)	27110	52.353	585.280701	3+	3+	1752.8196132159105	0	0.37610665605957466	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
747	O00507, Q93008	EIYTNLGPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25989 (Experiment 1)	25989	51.058	571.766357	2+	2+	1141.5168892818	0	1.1121553188153186	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	99.45652173913044	Confident
748	O15371	IFHTVTTTDDPVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26629 (Experiment 1)	26629	51.795	538.953796	3+	3+	1613.8413210291303	0	-1.0900301400989787								92.14285714285715	Doubtful
749	P78527	QGNLSSQVPLKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16791 (Experiment 1)	16791	39.318	442.921173	3+	3+	1325.7415474182103	0	0.10700276382912233								100.0	Confident
750	P61970	LSSLPFQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30350 (Experiment 1)	30350	56.133	460.265778	2+	2+	918.5174677276202	0	-0.5047746669099966								99.45799457994579	Confident
751	P08238, Q58FF8	SIYYITGESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28325 (Experiment 1)	28325	53.789	580.795288	2+	2+	1159.5761048025502	0	-0.07036572970662176								100.0	Confident
752	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21326 (Experiment 1)	21326	45.184	422.552094	3+	3+	1264.6339540318404	0	0.39329897765242516								100.0	Confident
753	P07195	GLTSVINQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22235 (Experiment 1)	22235	46.528	480.279999	2+	2+	958.5447451046202	0	0.7287022854590921								99.75247524752476	Confident
754	P40227, Q92526	TEVNSGFFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33390 (Experiment 1)	33390	59.643	596.289368	2+	2+	1190.5607890915803	0	2.8459206524497693								100.0	Confident
755	O43707	LSGSNPYTTVTPQIINSK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33709 (Experiment 1)	33709	60.011	1000.489685	2+	2+	1998.9663370192504	0	-0.7596038933662909	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
756	P22087	VSISEGDDKIEYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22646 (Experiment 1)	22646	47.027	504.251495	3+	3+	1509.7311018738103	0	1.0270849399527446								99.24812030075188	Confident
757	P08238, Q58FF7	IDIIPNPQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32920 (Experiment 1)	32920	59.104	597.826782	2+	2+	1193.6404363946103	0	-1.1920898982061912								100.0	Confident
758	Q16881	KVVYENAYGQFIGPHR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26127 (Experiment 1)	26127	51.22	653.649963	3+	3+	1956.9247469907903	1	-0.021546008942800742	Phosphorylation of Y (8: Random)	Phosphorylation of Y (4: 0.0, 8: 0.0)	Phosphorylation of Y (8: 0.17452006980802792)		0	Y8-{Y4 Y8}	1	100.0	Confident
759	P14625	FAFQAEVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30559 (Experiment 1)	30559	56.375	541.272949	2+	2+	1080.5352430500805	0	-3.600743096512179								100.0	Confident
760	P23396	GLCAIAQAESLR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35349 (Experiment 1)	35349	61.926	644.837646	2+	2+	1287.6605202161902	0	0.16969404937991173								100.0	Confident
761	P06493	SPEVLLGSAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26596 (Experiment 1)	26596	51.759	514.790344	2+	2+	1027.5662088251902	0	-0.07163965864883592								99.73190348525469	Confident
762	P13639	GHVFEESQVAGTPMFVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38376 (Experiment 1)	38376	65.603	654.66626	3+	3+	1960.9716835756806	0	2.681792912577746								100.0	Confident
763	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33448 (Experiment 1)	33448	59.71	652.024597	3+	3+	1953.0571274518006	0	-2.640922146173135								100.0	Confident
764	P33991	VNVTGIYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23941 (Experiment 1)	23941	48.642	461.261536	2+	2+	920.5079656730802	0	0.5998696884573392								96.75675675675676	Confident
765	P24752	NEQDAYAINSYTR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25962 (Experiment 1)	25962	51.028	812.834839	2+	2+	1623.6566302117403	0	-0.9258608875491785	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 5.977382875605816)		0	Y6-{Y6 Y11}	1	100.0	Confident
766	Q13283, Q9UN86	VMEKPSPLLVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24425 (Experiment 1)	24425	49.24	442.592682	3+	3+	1324.75369232504	0	1.901130486927595								100.0	Confident
767	Q15691	LTVEDLEKER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29025 (Experiment 1)	29025	54.605	411.222321	3+	3+	1230.6455813447003	0	-0.36293828659549343								99.28057553956835	Confident
768	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31884 (Experiment 1)	31884	57.926	565.800293	2+	2+	1129.58800689893	0	-1.7442807432123055								100.0	Confident
769	P30740	EATTNAPFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15522 (Experiment 1)	15522	37.645	503.752136	2+	2+	1005.4879585044903	0	1.7474516101244593								99.74424552429667	Confident
770	P13804	TIYAGNALCTVK	Phosphorylation of Y(3)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30497 (Experiment 1)	30497	56.303	695.825684	2+	2+	1389.6363527914805	0	0.332177339535664	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
771	P62841	EAPPMEKPEVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16062 (Experiment 1)	16062	38.424	451.907928	3+	3+	1352.7009880458406	0	0.7129434653013211								100.0	Confident
772	ALDOA_RABIT, P04075	ALSDHHIYLEGTLLKPNMVTPGHACTQK	Phosphorylation of Y(8)	Carbamidomethylation of C(25)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34634 (Experiment 1)	34634	61.097	803.641052	4+	4+	3210.5355401332404	0	-0.13625499472514274	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Doubtful
773	Q9P258	AVQDLCGWR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30347 (Experiment 1)	30347	56.13	552.767456	2+	2+	1103.51821308695	0	1.9411269316141697								99.1891891891892	Confident
774	P62805	VFLENVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39916 (Experiment 1)	39916	67.626	495.292419	2+	2+	988.5705659296402	0	-0.28353269073341003								99.1891891891892	Confident
775	P48643	VAIEHLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13269 (Experiment 1)	13269	34.108	462.76059	2+	2+	923.5076313199102	0	-1.0850669505344066								99.45799457994579	Confident
776	Q99436	DGIVLGADTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26497 (Experiment 1)	26497	51.646	508.772491	2+	2+	1015.5298233164701	0	0.5953056398290011								97.8319783197832	Confident
777	Q8WWM7	ISLAPTDVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24494 (Experiment 1)	24494	49.323	472.276123	2+	2+	942.5385970950204	0	-0.9570966379945898								99.46091644204851	Confident
778	P62318	VAQLEQVYIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32402 (Experiment 1)	32402	58.515	609.846985	2+	2+	1217.6768219033302	0	2.127721077041008								100.0	Confident
779	P07900	YYTSASGDEMVSLKDYCTR		Carbamidomethylation of C(17)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32552 (Experiment 1)	32552	58.69	749.330505	3+	3+	2244.96673441788	0	1.3128099186846096								100.0	Confident
780	P35232	VLPSITTEILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43383 (Experiment 1)	43383	73.102	607.375427	2+	2+	1212.7329397971203	0	2.767051815794577								99.73045822102425	Confident
781	P22626	NYYEQWGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28167 (Experiment 1)	28167	53.603	584.23053	2+	2+	1166.4433899883702	0	2.667685238159893	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 3.664921465968586)		0	Y2-{Y2 Y3}	1	100.0	Confident
782	P60842	GVAINMVTEEDKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23588 (Experiment 1)	23588	48.174	487.91684	3+	3+	1460.7293280520003	0	-0.4354923533708005								99.24812030075188	Confident
783	P07900, P08238	SLTNDWEDHLAVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35399 (Experiment 1)	35399	61.983	509.9198	3+	3+	1526.7365216074204	0	0.6857240837348273								100.0	Confident
784	O94788, P00352, P05091, P30837, P30838, P43353, P47895, P48448, P49189, P51648	VTLELGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24795 (Experiment 1)	24795	49.669	408.744812	2+	2+	815.4752685624701	0	-0.24158844399939042								100.0	Confident
785	P13639	IMGPNYTPGKKEDLYLKPIQR	Phosphorylation of Y(15)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28991 (Experiment 1)	28991	54.566	636.078552	4+	4+	2540.2862316709807	0	-0.4439458476369734	Phosphorylation of Y (15: Doubtfull)	Phosphorylation of Y (15: 4.289952059198672)	Phosphorylation of Y (15: 3.664921465968586)		0	Y15-{Y6 Y15}	1	100.0	Doubtful
786	B2RXH8, B7ZW38, O60812, P07910	SDVEAIFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33770 (Experiment 1)	33770	60.079	498.256104	2+	2+	994.4971262058602	0	0.5307118089023717								100.0	Confident
787	O00231	TYHALSNLPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18865 (Experiment 1)	18865	42.126	612.295105	2+	2+	1222.5747385110903	0	0.7500925346946685	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
788	Q14019	EVVQNFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17525 (Experiment 1)	17525	40.324	467.754242	2+	2+	933.4919812557703	0	2.08422980974138								99.72826086956522	Confident
789	P62899	EYTINIHKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13575 (Experiment 1)	13575	34.602	391.883911	3+	3+	1172.6302060640803	0	-0.2572738422590702								100.0	Confident
790	Q9UBQ0	VVTVGQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23036 (Experiment 1)	23036	47.49	439.260529	2+	2+	876.5069030439204	0	-0.45300833752574104								99.72972972972973	Confident
791	Q01469	FEETTADGRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6898 (Experiment 1)	6898	22.025	385.187836	3+	3+	1152.5411162761602	0	0.486622910382852								99.28057553956835	Confident
792	GSTP1_HUMAN, P09211	FQDGDLTLYQSNTILR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44354 (Experiment 1)	44354	75.028	655.311768	3+	3+	1962.9088221431302	0	2.3665414801485856	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
793	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33950 (Experiment 1)	33950	60.291	932.895447	2+	2+	1863.7750310922602	0	0.7021017411995658	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 70.58040127411856)		0	Y6-{Y6 Y11}	1	92.63959390862944	Doubtful
794	P00558, P07205	LGDVYVNDAFGTAHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33060 (Experiment 1)	33060	59.264	817.904907	2+	2+	1633.7848687821704	0	6.353030859069778								99.73190348525469	Doubtful
795	P68363, Q71U36, Q9BQE3	EIIDLVLDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46424 (Experiment 1)	46424	79.452	543.309998	2+	2+	1084.61282466444	0	-6.793127263737364								99.72972972972973	Doubtful
796	P11142	MKEIAEAYLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26028 (Experiment 1)	26028	51.105	418.225861	3+	3+	1251.6533095774303	0	1.9479322239251131								98.49624060150376	Confident
797	P31146	KGTVVAEKDRPHEGTRPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5520 (Experiment 1)	5520	19.138	427.23938	5+	5+	2131.1610324400604	0	-0.2409768482679639								100.0	Doubtful
798	P15311, P26038, P35241	APDFVFYAPR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44653 (Experiment 1)	44653	75.791	631.782776	2+	2+	1261.5532747905202	0	-1.801030458635621	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
799	O75083	IAVVGEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14632 (Experiment 1)	14632	36.241	400.734528	2+	2+	799.45520182423	0	-0.8718455684234289								99.73262032085562	Confident
800	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21931 (Experiment 1)	21931	46.141	673.305054	2+	2+	1344.6002845525904	0	-3.5121298851344958	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.33452891645359)	Phosphorylation of Y (9: 37.95148962324529)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
801	P22626	GFGFVTFDDHDPVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42253 (Experiment 1)	42253	71.119	565.926636	3+	3+	1694.75765097482	0	0.25187296051294766								100.0	Confident
802	Q9NYK5	DAHALIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18300 (Experiment 1)	18300	41.404	505.741058	2+	2+	1009.4633971569604	0	4.118635918235883	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.33507853403141)	Y7	1		0	99.49874686716792	Confident
803	A3KMH1	EVEYIALSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31101 (Experiment 1)	31101	57.005	580.271973	2+	2+	1158.5322049927702	0	-2.4229324455135135	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.38219895287958)	Y4	1		0	99.19786096256684	Confident
804	P52272	DKFNECGHVLYADIK	Phosphorylation of Y(11)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29188 (Experiment 1)	29188	54.792	630.281921	3+	3+	1887.8226499910204	0	0.6788546374496953	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
805	P00519	AGENRSDQVTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4564 (Experiment 1)	4564	17.259	411.53772	3+	3+	1231.59052608007	0	0.6516373258935197								100.0	Confident
806	Q96M27	QMIYSAAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16057 (Experiment 1)	16057	38.417	510.223083	2+	2+	1018.4307171296903	0	0.8779860243848991	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 84.29319371727748)	Y4	1		0	92.74611398963731	Confident
807	P37837	LVPVLSAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26711 (Experiment 1)	26711	51.89	413.773071	2+	2+	825.5323895157703	0	-0.9672555756609114								99.7289972899729	Confident
808	Q63HK5	EKAVTDEKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34005 (Experiment 1)	34005	60.361	572.814209	2+	2+	1143.6135529404303	0	0.27244962303512454								99.1869918699187	Confident
809	Q13162	DYGVYLEDSGHTLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32678 (Experiment 1)	32678	58.832	852.866943	2+	2+	1703.7192304683003	0	0.060148937951888276	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 16.666495241286455)	Phosphorylation of Y (2: 24.88207912892212)		0	Y2-{Y2 Y5}	1	100.0	Confident
810	P31153	TAAYGHFGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11481 (Experiment 1)	11481	31.294	530.223938	2+	2+	1058.4334940110102	0	-0.1612003859235563	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
811	P07900, Q58FG0	HIYYITGETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19792 (Experiment 1)	19792	43.28	408.879303	3+	3+	1223.6186383208703	0	-2.08595865999466								100.0	Confident
812	P04406	VGVNGFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20130 (Experiment 1)	20130	43.705	403.219666	2+	2+	804.42423604912	0	0.6733521049360991								99.73190348525469	Confident
813	Q9NSI2	QARSRESNKPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26216 (Experiment 1)	26216	51.322	664.856323	2+	2+	1327.7068932449902	0	-6.618061729887234								96.24664879356568	Doubtful
814	P15259, P18669, Q8N0Y7	HYGGLTGLNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16894 (Experiment 1)	16894	39.448	570.266052	2+	2+	1138.5172236349702	0	0.2870866137368269	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
815	P18621	QWGWTQGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31298 (Experiment 1)	31298	57.235	509.746429	2+	2+	1017.4780625271301	0	0.23790191540558284								99.7289972899729	Confident
816	Q15365	QGANINEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16538 (Experiment 1)	16538	39.003	507.769684	2+	2+	1013.5254066423702	0	-0.5825236009115128								99.7289972899729	Confident
817	P31949	DGYNYTLSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20739 (Experiment 1)	20739	44.404	570.734253	2+	2+	1139.4536203189004	0	0.2915083251006231	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 11.207454373355382)	Phosphorylation of Y (5: 87.68580895544247)		0	Y5-{Y3 Y5}	1	99.45945945945947	Confident
818	Q9UQ80	LVKPGNQNTQVTEAWNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20559 (Experiment 1)	20559	44.197	643.004822	3+	3+	1925.9959241775707	0	-1.7042756608312097								100.0	Confident
819	Q9Y277	GYGFGMVK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32528 (Experiment 1)	32528	58.664	469.696411	2+	2+	937.3768906516802	0	1.4673485747361112	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	99.72826086956522	Confident
820	P42167	RVEHNQSYSQAGITETEWTSGSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22091 (Experiment 1)	22091	46.344	671.315552	4+	4+	2681.2317503203208	0	0.5034194081831908								100.0	Doubtful
821	P05388, Q8NHW5	CFIVGADNVGSK		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28616 (Experiment 1)	28616	54.131	633.810547	2+	2+	1265.60742201417	0	-0.6949609674182584								99.45799457994579	Confident
822	Q00059	SAYNVYVAER	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24844 (Experiment 1)	24844	49.725	626.27478	2+	2+	1250.5332676219305	0	1.3887249786189775	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 10.504952121481434)	Phosphorylation of Y (3: 96.68411867364746)		0	Y3-{Y3 Y6}	1	99.46524064171123	Confident
823	P62861	FVNVVPTFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40174 (Experiment 1)	40174	67.975	554.313416	2+	2+	1106.61243074162	0	-0.13681359603379703								100.0	Confident
824	P07900, Q58FG0	HIYYITGETK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21939 (Experiment 1)	21939	46.149	435.53537	3+	3+	1303.5849688416204	0	-0.5267399934995521	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 2.197994287921463)		0	Y3-{Y3 Y4}	1	100.0	Confident
825	P68104, Q05639, Q5VTE0	THINIVVIGHVDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26551 (Experiment 1)	26551	51.707	397.975372	4+	4+	1587.8732898637504	0	-0.5702177476082708								100.0	Doubtful
826	Q15651	LSAKPAPPKPEPKPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6977 (Experiment 1)	6977	22.199	403.993988	4+	4+	1611.9460608811903	0	0.4859304634104072								100.0	Doubtful
827	P30153	VLELDNVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26828 (Experiment 1)	26828	52.027	465.268829	2+	2+	928.5229470308802	0	0.16983248479624394								98.91598915989161	Confident
828	P26641	ALIAAQYSGAQVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26544 (Experiment 1)	26544	51.699	714.355469	2+	2+	1426.6969789020902	0	-0.4156442369181032	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
829	Q14152	EDAPIGPHLQSMPSEQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30810 (Experiment 1)	30810	56.663	668.997498	3+	3+	2003.9734744808302	0	-1.4000437673652009								100.0	Confident
830	Q00610	LASTLVHLGEYQAAVDGAR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37967 (Experiment 1)	37967	65.095	684.33728	3+	3+	2049.9884694461603	0	0.7506798208896978	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
831	P18124	TTHFVEGGDAGNREDQINR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13740 (Experiment 1)	13740	34.85	529.75061	4+	4+	2114.97295688686	0	0.17802997853184085								100.0	Doubtful
832	Q06830	ADEGISFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23781 (Experiment 1)	23781	48.426	447.719757	2+	2+	893.4242956187702	0	0.7431524854957233								99.72826086956522	Confident
833	Q92598	FICEQDHQNFLR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26713 (Experiment 1)	26713	51.892	536.253174	3+	3+	1605.7358104147704	0	1.1699616815163647								99.37888198757764	Confident
834	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10246 (Experiment 1)	10246	29.097	607.758423	2+	2+	1213.5016331404804	0	0.5429182293041148	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
835	P25787	HIGLVYSGMGPDYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32251 (Experiment 1)	32251	58.343	522.257324	3+	3+	1563.75039784975	0	-0.16291467359547632								100.0	Confident
836	P16403	KPAAATVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4139 (Experiment 1)	4139	16.712	443.771332	2+	2+	885.5283667644901	0	-0.2880966186527557								100.0	Confident
837	Q13263	LIYFQLHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39048 (Experiment 1)	39048	66.418	390.534058	3+	3+	1168.5794299687102	0	0.7806673529912854	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.65095986038395)	Y3	1		0	99.37888198757764	Confident
838	Q13151	AVPKEDIYSGGGGGGSR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12685 (Experiment 1)	12685	33.239	843.877686	2+	2+	1685.7410285420399	0	-0.12411492887355514	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
839	Q02790	MEKGEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35221 (Experiment 1)	35221	61.778	836.408386	3+	3+	2506.1967479602404	0	2.622585127704876	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 5.144382828771395)	Phosphorylation of Y (10: 56.980802792321114)		0	Y10-{Y10 Y15}	1	92.14285714285715	Doubtful
840	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26863 (Experiment 1)	26863	52.068	565.215698	2+	2+	1128.4165065341901	0	0.29770252934730684	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 38.749371984659035)	Phosphorylation of Y (6: 90.04350797544515)		0	Y6-{Y2 Y6}	1	100.0	Confident
841	P14868	GEEILSGAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18347 (Experiment 1)	18347	41.468	530.275208	3+	2+	1058.5356369729002	0	0.21318507870256								99.45652173913044	Confident
842	P10809	VGGTSDVEVNEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12041 (Experiment 1)	12041	32.176	617.301147	2+	2+	1232.5884603914003	0	-0.5826366991302554								100.0	Confident
843	P62805	TVTAMDVVYALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46360 (Experiment 1)	46360	79.357	655.85498	2+	2+	1309.6951743894106	0	0.17738449319278496								100.0	Confident
844	P25205	SKDIFDQLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32253 (Experiment 1)	32253	58.345	582.817078	2+	2+	1163.6186383208703	0	0.8276578882933471								96.19565217391303	Confident
845	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38943 (Experiment 1)	38943	66.284	621.325012	3+	3+	1860.9498991094704	0	1.7744314696262862	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	100.0	Confident
846	O95758, P26599, Q9UKA9	VTNILMLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39168 (Experiment 1)	39168	66.57	466.28598	2+	2+	930.5572243646202	0	0.19591173604311704								100.0	Confident
847	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44567 (Experiment 1)	44567	75.594	918.969299	2+	2+	1835.9222873793005	0	0.956337038747137	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
848	P13010	ANPQVGVAFPHIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30632 (Experiment 1)	30632	56.458	459.925568	3+	3+	1376.7564692063604	0	-1.1556978378016312								100.0	Confident
849	Q9UKK9	TTYMDPTGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14598 (Experiment 1)	14598	36.188	547.216248	2+	2+	1092.41987766247	0	-1.7676674273321882	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.30191972076788)	Y3	1		0	99.45652173913044	Confident
850	P33991	AGIICQLNAR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28404 (Experiment 1)	28404	53.883	558.303162	2+	2+	1114.5917123803802	0	0.052557465961887116								100.0	Confident
851	O00487	HYYSITINYR	Phosphorylation of Y(2, 3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32882 (Experiment 1)	32882	59.062	745.299561	2+	2+	1488.5839964729803	0	0.3841365576757548	Phosphorylation of Y (2: Confident, 3: Doubtfull)		Phosphorylation of Y (2: 100.0, 3: 75.39267015706807)	Y2	1	Y3-{Y3}	1	100.0	Confident
852	Q8WXX5	VYSVLSDR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24682 (Experiment 1)	24682	49.539	509.732941	2+	2+	1017.4532263960803	0	-1.861098254085212	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.50959860383944)	Y2	1		0	99.45652173913044	Confident
853	P27348	YDDMATCMK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19511 (Experiment 1)	19511	42.924	567.718262	2+	2+	1133.41915286229	0	2.4820507541605425								100.0	Confident
854	P18124	AGNFYVPAEPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28197 (Experiment 1)	28197	53.643	596.80249	2+	2+	1191.5924235730304	0	-1.6726667100197934								99.72826086956522	Confident
855	Q9UKY7	KTPQGPPEIYSDTQFPSLQSTAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37158 (Experiment 1)	37158	64.115	867.414856	3+	3+	2599.2207137786104	0	0.7781061603089627	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
856	O14745	LVEPGSPAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12790 (Experiment 1)	12790	33.422	513.777283	2+	2+	1025.5393253710104	0	0.6692548001943704								99.73118279569893	Confident
857	P06576	IMDPNIVGSEHYDVAR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30756 (Experiment 1)	30756	56.6	632.616943	3+	3+	1894.8284636474505	0	0.28239957354533973	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 100.0)	Y12	1		0	100.0	Confident
858	Q8WUM4	HYQFASGAFLHIK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35189 (Experiment 1)	35189	61.739	533.589172	3+	3+	1597.7442634476804	0	0.8890442457348536	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
859	P40937	VTEETVYTCTGHPLK	Phosphorylation of Y(7)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19768 (Experiment 1)	19768	43.249	907.907227	2+	2+	1813.7957665368406	0	2.276961140167526	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 95.28795811518324)	Y7	1		0	94.90616621983914	Doubtful
860	P26038	KTANDMIHAENMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14472 (Experiment 1)	14472	36.012	510.910065	3+	3+	1529.7078814147703	0	0.31589704964483345								100.0	Confident
861	P48047	SFLSQGQVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32554 (Experiment 1)	32554	58.692	553.813538	2+	2+	1105.6131590176103	0	-0.5741561244899367								91.08108108108108	Confident
862	Q9UKY7	KTPQGPPEIYSDTQFPSLQSTAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36935 (Experiment 1)	36935	63.851	867.414978	3+	3+	2599.2207137786104	0	0.9187540799498407	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
863	P54577	NSVEVALNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18227 (Experiment 1)	18227	41.304	487.269287	2+	2+	972.5240096600401	0	0.01170434551779049								99.7289972899729	Confident
864	O95758	SQPVYIQYSNHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20613 (Experiment 1)	20613	44.26	524.572021	3+	3+	1570.6929561508102	0	0.8117409618025303	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 17.571249873983163)	Phosphorylation of Y (5: 0.34904013961605584)		0	Y5-{Y5 Y8}	1	100.0	Confident
865	P45880	WCEYGLTFTEK	Phosphorylation of Y(4)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42743 (Experiment 1)	42743	71.979	757.307678	2+	2+	1512.5996329295901	0	0.7725642587088363	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 90.40139616055846)	Y4	1		0	91.30434782608697	Doubtful
866	O43665	AKEIYMTFLSSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39720 (Experiment 1)	39720	67.355	499.906616	3+	3+	1496.6986186948702	0	-0.40013811045446357	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.38219895287958)	Y5	1		0	92.14285714285715	Doubtful
867	P00338	DYNVTANSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11758 (Experiment 1)	11758	31.721	506.241089	2+	2+	1010.4668887067403	0	0.7272821065967794								100.0	Confident
868	Q15366	IITLAGPTNAIFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44569 (Experiment 1)	44569	75.597	679.906189	2+	2+	1357.7969370360104	0	0.6530540241122424								99.73045822102425	Confident
869	P26599	HQNVQLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11632 (Experiment 1)	11632	31.516	496.274872	2+	2+	990.5359117564201	0	-0.7260991451975798								100.0	Confident
870	Q8NBX0	SAIYGFGDQSNLR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35187 (Experiment 1)	35187	61.737	754.333557	2+	2+	1506.65042263249	0	1.4174345666590238	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
871	P55084	AALTGLLHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27272 (Experiment 1)	27272	52.543	476.29126	2+	2+	950.5661492555403	0	1.9083011357275672								100.0	Confident
872	P26641	KLDPGSEETQTLVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20460 (Experiment 1)	20460	44.084	524.947021	3+	3+	1571.8155002041105	0	2.3706546594543347								100.0	Confident
873	O43684	LYDVPANSMR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25315 (Experiment 1)	25315	50.274	623.270569	2+	2+	1244.5260740665103	0	0.40993438522121023	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
874	Q92905	GYKPPDEGPSEYQTIPLNK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27879 (Experiment 1)	27879	53.262	738.344543	3+	3+	2212.0089301072203	0	1.2954638807175587	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 23.641702321696215)	Phosphorylation of Y (12: 0.6980802792321117)		0	Y12-{Y2 Y12}	1	100.0	Confident
875	P10768	SGYHQSASEHGLVVIAPDTSPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23524 (Experiment 1)	23524	48.092	578.038757	4+	4+	2307.124372147821	1	-0.7809316370671323								100.0	Doubtful
876	P29692	IASLEVENQSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28873 (Experiment 1)	28873	54.433	679.868164	2+	2+	1357.7201432672905	0	1.2000863770527983								100.0	Confident
877	P00558, P07205	VSHVSTGGGASLELLEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31664 (Experiment 1)	31664	57.668	580.975891	3+	3+	1739.9053778376701	0	0.26722968806276587								100.0	Confident
878	P13639	GPLMMYISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38615 (Experiment 1)	38615	65.888	520.270142	2+	2+	1038.5242099841803	0	1.4618217501382385								100.0	Confident
879	P61204, P84077	QDLPNAMNAAEITDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33529 (Experiment 1)	33529	59.806	815.88916	2+	2+	1629.7668357595305	0	-1.8805785971312328								99.45799457994579	Confident
880	P78371	TVYGGGCSEMLMAHAVTQLANR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43588 (Experiment 1)	43588	73.405	789.373169	3+	3+	2365.0977061011204	0	-0.012035522815245161								94.77611940298507	Confident
881	P14625	SGTSEFLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19329 (Experiment 1)	19329	42.7	491.746307	2+	2+	981.4767251144501	0	1.358376994067537								99.72972972972973	Confident
882	Q7KZ85	VSDGIYQHVDVR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20462 (Experiment 1)	20462	44.087	489.893494	3+	3+	1466.6555080129303	0	2.1396442290342237	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
883	P00519, P42684	YSLTVAVK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26546 (Experiment 1)	26546	51.702	480.743286	2+	2+	959.4728992115004	0	-0.915399490958009	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 99.82547993019197)	Y1	1		0	100.0	Confident
884	Q8NC51	RFEKPLEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9035 (Experiment 1)	9035	26.692	392.55188	3+	3+	1174.6346227381803	0	-0.6896226950509515								99.28057553956835	Confident
885	P19623	ESYYQLMK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34279 (Experiment 1)	34279	60.686	571.236023	2+	2+	1140.4562631711904	0	1.0765221905461897	Phosphorylation of Y (4: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (4: 1.2216404886561953)		0	Y4-{Y3 Y4}	1	99.72972972972973	Confident
886	P08238, Q58FF8	SIYYITGESK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30763 (Experiment 1)	30763	56.607	620.77887	2+	2+	1239.5424353233002	0	0.6054841483197677	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.16155088852988692)		0	Y3-{Y3 Y4}	1	100.0	Confident
887	P62263	IEDVTPIPSDSTRR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20941 (Experiment 1)	20941	44.641	529.277222	3+	3+	1584.81074917684	0	-0.5747314221613763								100.0	Confident
888	Q9UI08	INIYHNTASNTFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23154 (Experiment 1)	23154	47.629	544.250488	3+	3+	1629.7300699355208	0	-0.26662713238037566	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
889	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44160 (Experiment 1)	44160	74.493	624.290527	3+	3+	1869.85097291384	0	-0.6521074332894065	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
890	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21589 (Experiment 1)	21589	45.626	673.307434	2+	2+	1344.6002845525904	0	0.022659623565177228	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.33452891645359)	Phosphorylation of Y (9: 18.093699515347332)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
891	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27417 (Experiment 1)	27417	52.715	609.257202	2+	2+	1216.5053215385904	0	-4.4894402866041405	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.714203795409155)	Phosphorylation of Y (6: 0.1745200698080279)		0	Y8-{Y3 Y6 Y8}	1	99.45652173913044	Doubtful
892	O15144	DNTINLIHTFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38085 (Experiment 1)	38085	65.241	672.356689	2+	2+	1342.6993482530604	0	-0.38906914264058706								100.0	Confident
893	P14866	NDQDTWDYTNPNLSGQGDPGSNPNKR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27657 (Experiment 1)	27657	53.003	990.750061	3+	3+	2969.22133546679	0	2.361224295665406	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
894	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15866 (Experiment 1)	15866	38.156	514.763	2+	2+	1027.5120650773501	0	-0.6002865427760832								100.0	Confident
895	O75874	HAYGDQYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7467 (Experiment 1)	7467	23.419	545.211121	2+	2+	1088.4076731859902	0	0.014563519834008897	Phosphorylation of Y (7: Random)	Phosphorylation of Y (3: 0.0, 7: 0.0)	Phosphorylation of Y (7: 28.272251308900525)		0	Y7-{Y3 Y7}	1	99.72826086956522	Confident
896	P07900	NPDDITNEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35266 (Experiment 1)	35266	61.83	957.372314	2+	2+	1912.7404194053506	0	-5.4024348411589	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 14: 0.0)	Phosphorylation of Y (10: 51.976392724998696)		0	Y10-{Y10 Y14}	1	99.45652173913044	Doubtful
897	P06576	VVDLLAPYAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40999 (Experiment 1)	40999	69.174	544.820862	2+	2+	1087.6277464525904	0	-0.5280505490419202								100.0	Confident
898	P23528	MLPDKDCR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8190 (Experiment 1)	8190	24.843	517.73999	2+	2+	1033.46848601321	0	-2.954125484399953								95.13513513513514	Confident
899	P46782	QAVDVSPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22690 (Experiment 1)	22690	47.079	492.777771	2+	2+	983.53999407735	0	1.009572761896888								100.0	Confident
900	Q14566	VFEMSQDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18940 (Experiment 1)	18940	42.221	492.228271	2+	2+	982.4429824580202	0	-1.009075159048069								96.4769647696477	Confident
901	Q14240	GFKDQIYEIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46283 (Experiment 1)	46283	79.242	532.588623	3+	3+	1594.7432603881705	0	0.4876883331963756	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
902	P83881, Q969Q0	HFELGGDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14345 (Experiment 1)	14345	35.808	451.721771	2+	2+	901.42938099921	0	-0.4338208706070914								100.0	Confident
903	Q86UX7	TGSGGPGNHPHGPDASAEGLNPYGLVAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31539 (Experiment 1)	31539	57.518	696.337158	4+	4+	2781.3219027374003	0	-0.8532514002793928								100.0	Doubtful
904	P63220	TYAICGAIR	Phosphorylation of Y(2)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27278 (Experiment 1)	27278	52.549	552.749451	2+	2+	1103.48348097854	0	0.7852459337492462	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
905	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45228 (Experiment 1)	45228	77.057	936.431946	2+	2+	1869.85097291384	1	-2.665087419617665	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 95.15347334410339)	Y2	1		0	94.03794037940379	Confident
906	P38159, Q96E39	YDDYSSSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8003 (Experiment 1)	8003	24.458	536.68396	2+	2+	1071.3546345536201	0	-1.1808492913271886	Phosphorylation of Y (4: Random)	Phosphorylation of Y (1: 0.0, 4: 0.0)	Phosphorylation of Y (4: 97.38219895287958)		0	Y4-{Y1 Y4}	1	99.47506561679789	Confident
907	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGRPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29545 (Experiment 1)	29545	55.201	599.856689	2+	2+	1197.69822605425	0	0.499296278488474								100.0	Confident
908	P61978	RPAEDMEEEQAFKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15813 (Experiment 1)	15813	38.073	579.272034	3+	3+	1734.7995328701406	0	-3.0269340053195717								100.0	Confident
909	O60488	IGYSSPLTLSDQSSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33115 (Experiment 1)	33115	59.328	831.889465	2+	2+	1661.7549472706803	0	5.667729631020478	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 85.16579406631763)	Y3	1		0	97.56756756756756	Doubtful
910	P00519, P42684, P53671, Q06418	VADFGLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27539 (Experiment 1)	27539	52.859	432.732361	2+	2+	863.4501164437902	0	0.06080269686589673								99.73190348525469	Confident
911	P63010, Q10567	RNVEGQDMLYQSLK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31486 (Experiment 1)	31486	57.455	587.606995	3+	3+	1759.7964352431802	0	1.543185952968179	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 91.7975567190227)	Y10	1		0	92.56756756756756	Doubtful
912	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28689 (Experiment 1)	28689	54.215	899.928406	2+	2+	1797.84107693648	0	0.6567915093885646	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
913	P61158	DYEEIGPSICR	Phosphorylation of Y(2)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31022 (Experiment 1)	31022	56.912	709.786377	2+	2+	1417.5584963936	0	-0.2080394695671783	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
914	P42765	ETPALTINR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22482 (Experiment 1)	22482	46.833	507.782471	2+	2+	1013.5505587610503	0	-0.16709383995887553								99.19354838709677	Confident
915	Q9Y230	GTSYQSPHGIPIDLLDR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43128 (Experiment 1)	43128	72.656	650.310669	3+	3+	1947.9091564963	0	0.5233928166121435	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	100.0	Confident
916	P12004	MPSGEFAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18221 (Experiment 1)	18221	41.295	447.711884	2+	2+	893.4065373796502	0	2.990421774545893								95.39295392953929	Confident
917	P04406	VVDLMAHMASKE			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29027 (Experiment 1)	29027	54.607	665.828369	2+	2+	1329.6420932707306	0	0.0689334187137909								99.45799457994579	Confident
918	P05141	AAYFGIYDTAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39437 (Experiment 1)	39437	66.951	650.285889	2+	2+	1298.5584197406101	0	-0.9185753197898886	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 18.111436865187635)	Phosphorylation of Y (7: 98.60383944153578)		0	Y7-{Y3 Y7}	1	98.91304347826086	Confident
919	Q13733	QKRNMEELKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29859 (Experiment 1)	29859	55.564	435.241364	3+	3+	1302.7078047617804	0	-4.244494473729416								92.14285714285715	Doubtful
920	Q9Y2S6	GPLATGGIKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9964 (Experiment 1)	9964	28.494	471.293396	2+	2+	940.5705659296402	0	1.775051082729957								99.45652173913044	Confident
921	Q9H0A0	AGPNASIISLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31225 (Experiment 1)	31225	57.149	535.813538	2+	2+	1069.61315901761	0	-0.5934441850950779								99.45945945945947	Confident
922	Q7L1Q6	FLDASGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15471 (Experiment 1)	15471	37.574	404.713898	2+	2+	807.4126683059103	0	0.710082945869172								99.45799457994579	Confident
923	P05388, Q8NHW5	IIQLLDDYPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41925 (Experiment 1)	41925	70.561	609.344055	2+	2+	1216.6703395405602	0	2.6401622236729327								100.0	Confident
924	P40939	VIGMHYFSPVDK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36599 (Experiment 1)	36599	63.446	736.839172	2+	2+	1471.6570882360604	0	4.548387936706055	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.46236559139786	Confident
925	P53611	HADYIASYGSK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17650 (Experiment 1)	17650	40.495	646.271179	2+	2+	1290.5281822414904	0	-0.29180862216124315	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 9.112014798223164)	Phosphorylation of Y (4: 9.07504363001745)		0	Y8-{Y4 Y8}	1	100.0	Confident
926	Q8NC51	SEEAHAEDSVMDHHFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17560 (Experiment 1)	17560	40.368	474.953522	4+	4+	1895.7856737111506	0	-0.364024117512513								100.0	Doubtful
927	P62424	TNYNDRYDEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17442 (Experiment 1)	17442	40.211	486.891663	3+	3+	1457.6535202594503	0	-0.24691310515783824								100.0	Confident
928	Q9NWQ8	AEFAEYASVDR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27792 (Experiment 1)	27792	53.165	669.27478	2+	2+	1336.5336615447502	0	1.0052096824207428	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
929	P62917	AVVGVVAGGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16853 (Experiment 1)	16853	39.397	471.280243	2+	2+	940.5454138109601	0	0.5508990772709221								100.0	Confident
930	Q9H910	GSGIFDESTPVQTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31144 (Experiment 1)	31144	57.055	747.368958	2+	2+	1492.7157861628402	0	5.069077235860755								99.73614775725594	Doubtful
931	O43684	LYDVPANSMR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25089 (Experiment 1)	25089	50.011	623.270386	2+	2+	1244.5260740665103	0	0.1163218129088005	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
932	Q15181	AAPFSLEYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35788 (Experiment 1)	35788	62.451	527.272705	2+	2+	1052.5290950404801	0	1.6708894876677653								99.73045822102425	Confident
933	P30049	IEANEALVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19366 (Experiment 1)	19366	42.744	493.780212	2+	2+	985.5444107514504	0	1.4787116307778048								93.78378378378378	Confident
934	P07737	SSFYVNGLTLGGQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43385 (Experiment 1)	43385	73.104	775.86499	2+	2+	1549.7177739163203	0	-1.5124064271781366	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
935	P19338	ALELTGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31931 (Experiment 1)	31931	57.979	422.760773	2+	2+	843.5065686907501	0	0.5019101416536907								99.45799457994579	Confident
936	P68363, Q71U36, Q9BQE3	EIIDLVLDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46287 (Experiment 1)	46287	79.252	543.313477	2+	2+	1084.61282466444	0	-0.38982826390156067								100.0	Confident
937	P13639	NMSVIAHVDHGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13654 (Experiment 1)	13654	34.728	436.556793	3+	3+	1306.6452045052204	0	2.554156329149634								100.0	Confident
938	P11586	IFHELTQTDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17401 (Experiment 1)	17401	40.155	411.216309	3+	3+	1230.6244519773002	0	2.1445549699231075								96.71052631578947	Confident
939	P30041	VVFVFGPDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32000 (Experiment 1)	32000	58.058	568.328918	2+	2+	1134.6437308699003	0	-0.39396495037013957								100.0	Confident
940	P17987	GANDFMCDEMER		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32991 (Experiment 1)	32991	59.187	737.774231	2+	2+	1473.53228512157	0	1.1005715059884682								100.0	Confident
941	GSTP1_HUMAN, P09211	FQDGDLTLYQSNTILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43605 (Experiment 1)	43605	73.432	942.478027	2+	2+	1882.9424916223802	0	-0.5255058767595501								99.47916666666666	Confident
942	O15173	EKYDYVGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11527 (Experiment 1)	11527	31.354	555.237	2+	2+	1108.45904005251	0	0.3665227775498875	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0)	Phosphorylation of Y (3: 44.54167124324193)		0	Y3-{Y3 Y5}	1	99.73890339425587	Confident
943	Q04837	SGDSEVYQLGDVSQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29818 (Experiment 1)	29818	55.517	846.360413	2+	2+	1690.7087253542504	0	-1.4487234304806322	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
944	P62888	KSEIEYYAMLAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40131 (Experiment 1)	40131	67.902	509.238159	3+	3+	1524.6935333144304	0	-0.5797643252243202	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (7: 0.0)		0	Y6-{Y6 Y7}	1	100.0	Confident
945	P07741	IDYIAGLDSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36379 (Experiment 1)	36379	63.194	561.792358	2+	2+	1121.57168812845	0	-1.357316437597264								100.0	Confident
946	Q9Y5P4	QVDTLQKYFDACADAVSK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15817 (Experiment 1)	15817	38.079	687.328491	2+	3+	2057.9728057744906	1	-6.073287389089642								97.76119402985076	Doubtful
947	P61244	ATEYIQYMR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30553 (Experiment 1)	30553	56.367	627.764709	2+	2+	1253.5151750296402	0	-0.24687847477287492	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 7: 0.0)	Phosphorylation of Y (4: 80.69951108910817)		0	Y4-{Y4 Y7}	1	100.0	Confident
948	Q16629	AFSYYGPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36004 (Experiment 1)	36004	62.717	537.274414	2+	2+	1072.53418042092	0	0.08807925870321101								100.0	Confident
949	Q8N5Y8	DLIYAFHGSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36049 (Experiment 1)	36049	62.778	629.784485	2+	2+	1257.5543374196802	0	0.06323329853346783	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 78.88307155322862)	Y4	1		0	93.6842105263158	Confident
950	P35579, P35580	LDPHLVLDQLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41990 (Experiment 1)	41990	70.689	440.254639	3+	3+	1317.74048478905	0	1.2135495514727004								100.0	Confident
951	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43776 (Experiment 1)	43776	73.728	895.948669	2+	2+	1789.88464239309	0	-1.036512946130199								100.0	Confident
952	Q08211	ISAVSVAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17923 (Experiment 1)	17923	40.843	466.263885	2+	2+	930.5134449763402	0	-0.24440013020611198								97.8319783197832	Confident
953	P62851	LITPAVVSER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28471 (Experiment 1)	28471	53.96	542.821777	2+	2+	1083.6288090817504	0	0.17683949640737454								100.0	Confident
954	Q14444	LNQDQLDAVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20476 (Experiment 1)	20476	44.103	615.820007	2+	2+	1229.6251802532904	0	0.22799937184835323								100.0	Confident
955	P55263	IVIFTQGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30512 (Experiment 1)	30512	56.32	467.279327	2+	2+	932.5443511818	0	-0.26762938409600345								96.4769647696477	Confident
956	P11142	GTLDPVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15336 (Experiment 1)	15336	37.39	429.73233	2+	2+	857.4494477374503	0	0.7671396652104953								93.6	Confident
957	P22314	YDGQVAVFGSDLQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37408 (Experiment 1)	37408	64.416	828.397644	2+	2+	1654.7838657226605	0	-1.8895818883930597								99.72826086956522	Confident
958	Q13151	EDIYSGGGGGGSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9539 (Experiment 1)	9539	27.752	646.251404	2+	2+	1290.48777398149	0	0.37221200758174194	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 73.82875605815832)	Y4	1		0	92.8388746803069	Confident
959	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32332 (Experiment 1)	32332	58.434	932.897278	2+	2+	1863.7750310922602	0	2.6648096646595225	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 23.821989528795815)		0	Y6-{Y6 Y11}	1	99.46666666666667	Confident
960	HBB_HUMAN, P02042, P68871	LHVDPENFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23607 (Experiment 1)	23607	48.2	563.784973	2+	2+	1125.5567067706502	0	-1.1650742806244956								95.26315789473684	Confident
961	P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3	DVNAAIATIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30510 (Experiment 1)	30510	56.317	508.292389	2+	2+	1014.5709598524604	0	-0.7227981070618928								100.0	Confident
962	Q9H324	YDICIYKNK	Phosphorylation of Y(1)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19847 (Experiment 1)	19847	43.348	648.794189	2+	2+	1295.5621252220606	0	9.016688194370598	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 6: 0.0)	Phosphorylation of Y (1: 76.06786756001415)		0	Y1-{Y1 Y6}	1	91.44385026737967	Doubtful
963	P60900	LYQVEYAFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37323 (Experiment 1)	37323	64.31	580.802429	2+	2+	1159.5913609438705	0	-0.9089808188384838								99.45799457994579	Confident
964	O60506	DYAFIHFDER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41464 (Experiment 1)	41464	69.846	464.858612	3+	3+	1391.5547313425004	0	-0.5196867327534157	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	100.0	Confident
965	P07320	RGDYADHQQWMGLSDSVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32595 (Experiment 1)	32595	58.739	734.314148	3+	3+	2199.91571551206	0	2.2238885142581246	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
966	P09651, Q32P51	IEVIEIMTDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43778 (Experiment 1)	43778	73.731	609.823914	2+	2+	1217.6325741328503	0	0.5747019034172164								100.0	Confident
967	P07203	FLVGPDGVPLRR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32216 (Experiment 1)	32216	58.302	442.59433	3+	3+	1324.7615545868	0	-0.2967255357768806								96.99248120300751	Confident
968	P23396	AELNEFLTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37239 (Experiment 1)	37239	64.211	546.787842	2+	2+	1091.5611234447504	0	0.006969454025691694								100.0	Confident
969	Q9NXR7	ELVQQYHQFQCSR	Phosphorylation of Y(6)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20598 (Experiment 1)	20598	44.242	601.594421	3+	3+	1801.7607184408002	0	0.3962575794881585	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
970	P63173	KIEEIKDFLLTAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39910 (Experiment 1)	39910	67.612	525.974243	3+	3+	1574.9031930097003	0	-1.4534341642461586								100.0	Confident
971	P52597	GLPFGCTK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26671 (Experiment 1)	26671	51.844	440.22345	2+	2+	878.4320238515002	0	0.3671033365001981								97.8891820580475	Confident
972	P62241	LLACIASR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23864 (Experiment 1)	23864	48.543	452.257233	2+	2+	902.5007721176601	0	-0.9497365718611639								96.19565217391303	Confident
973	Q16531	TVPLYESPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21978 (Experiment 1)	21978	46.2	571.268433	2+	2+	1140.52164030907	0	0.5888280035625685	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
974	P11142, P54652	FEELNADLFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43862 (Experiment 1)	43862	73.894	627.311035	2+	2+	1252.60880191316	0	-1.0240896435873494								100.0	Confident
975	Q9Y285	VNLQMVYDSPLCR	Phosphorylation of Y(7)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43517 (Experiment 1)	43517	73.288	837.875916	2+	2+	1673.73066418248	0	3.9474281819046624	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.72972972972973	Confident
976	Q07020	APGTPHSHTKPYVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5346 (Experiment 1)	5346	18.847	516.607422	3+	3+	1546.8004592766601	0	-0.014632062199596696								94.8905109489051	Confident
977	P33991	VNVTGIYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23917 (Experiment 1)	23917	48.612	501.24469	2+	2+	1000.4742961938302	0	0.529554564407947	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
978	P55084	DQLLLGPTYATPK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39767 (Experiment 1)	39767	67.419	748.873291	2+	2+	1495.7323613513004	0	-0.2218565241936938	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.83844911147011)	Y9	1		0	100.0	Confident
979	P37802	NFSDNQLQEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18296 (Experiment 1)	18296	41.4	640.298645	2+	2+	1278.5840437173003	0	-1.0203438672969383								100.0	Confident
980	P09651	SSGPYGGGGQYFAKPR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20337 (Experiment 1)	20337	43.939	854.878723	2+	2+	1707.7406346192204	0	1.3209184402517706	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 6.326938772424313)	Phosphorylation of Y (5: 2.6178010471204187)		0	Y11-{Y5 Y11}	1	100.0	Confident
981	P15880	GTGIVSAPVPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21110 (Experiment 1)	21110	44.867	513.303467	2+	2+	1024.5916952970401	0	0.6679964561040496								98.71794871794873	Confident
982	P26640	DPGVITYDLPTPPGEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41252 (Experiment 1)	41252	69.531	889.915161	2+	2+	1777.8175475272403	0	-0.9992295700155215	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.12277867528272)	Y7	1		0	96.7479674796748	Confident
983	P35659	EPFTIAQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24502 (Experiment 1)	24502	49.331	495.766571	2+	2+	989.5181960036102	0	0.3964193479975704								100.0	Confident
984	P52272	MGANSLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12879 (Experiment 1)	12879	33.566	439.213745	2+	2+	876.41235103608	0	0.6671360968276497								97.9002624671916	Confident
985	P61978	DLAGSIIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34365 (Experiment 1)	34365	60.785	437.25589	2+	2+	872.4967322830403	0	0.5657826768127519								93.51351351351352	Confident
986	P18669, Q8N0Y7	SYDVPPPPMEPDHPFYSNISK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38860 (Experiment 1)	38860	66.189	833.366882	3+	3+	2496.0708787407802	1	1.8338739370665214	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 13.07044506515171)	Phosphorylation of Y (2: 99.67689822294022)		0	Y2-{Y2 Y16}	1	99.28571428571429	Confident
987	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	LAVNMVPFPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42304 (Experiment 1)	42304	71.204	572.320313	2+	2+	1142.6270352599402	0	-0.840606853810192								100.0	Confident
988	P22061	VQLVVGDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22170 (Experiment 1)	22170	46.446	471.77243	2+	2+	941.5294293936499	0	0.9301874025569756								98.93048128342245	Confident
989	Q9NWT1	GEQYVVIIQNK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30673 (Experiment 1)	30673	56.505	685.840271	2+	2+	1369.66428179148	0	1.244660814606273	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
990	P13639	ETVSEESNVLCLSK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32850 (Experiment 1)	32850	59.027	797.885498	2+	2+	1593.7556023694901	0	0.5268283047499381								100.0	Confident
991	P15144	SEYMEGNVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15609 (Experiment 1)	15609	37.767	582.72345	2+	2+	1163.4318393285	0	0.43565957140681494	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
992	P62805, Q99525	DNIQGITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14706 (Experiment 1)	14706	36.352	444.742981	2+	2+	887.4712458111901	0	0.18353883354104572								96.52406417112299	Confident
993	Q8WXI9	TTSSAIYMNLASHIQPGTVNR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38534 (Experiment 1)	38534	65.792	781.037231	3+	3+	2340.0933455208606	0	-1.4860222552774192	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
994	Q13126	TTMRPQSFYDGSHSCAR	Phosphorylation of Y(9)	Carbamidomethylation of C(15)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21581 (Experiment 1)	21581	45.612	694.28418	3+	3+	2079.8292090067803	0	0.7209314328814431	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 97.38219895287958)	Y9	1		0	92.14285714285715	Doubtful
995	P00338	TLHPDLGTDKDKEQWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17440 (Experiment 1)	17440	40.209	478.49585	4+	4+	1909.9533906592505	0	0.47203853907034415								100.0	Doubtful
996	P61604	GGIMLPEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24973 (Experiment 1)	24973	49.877	422.733276	2+	2+	843.4524249429103	0	-0.5037175257778923								92.9539295392954	Confident
997	Q9NQ79	SSPYYALR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36520 (Experiment 1)	36520	63.355	518.727844	2+	2+	1035.4426617123802	0	-1.4715267123985332	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (4: 94.02261712439419)		0	Y4-{Y4 Y5}	1	95.09043927648578	Confident
998	Q92769	YYAVNFPMR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41130 (Experiment 1)	41130	69.368	620.765381	2+	2+	1239.51478110682	0	1.1501617535631974	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.17452006980802792)		0	Y2-{Y1 Y2}	1	100.0	Confident
999	P63104	KGIVDQSQQAYQEAFEISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38862 (Experiment 1)	38862	66.191	723.699707	3+	3+	2168.0749623439106	0	1.072847448320851								100.0	Confident
1000	P55209, Q99733	FYEEVHDLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25085 (Experiment 1)	25085	50.007	668.81134	2+	2+	1335.6095301891503	0	-1.0489664414647453								100.0	Confident
1001	Q16181	DVTNNVHYENYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18290 (Experiment 1)	18290	41.391	535.222534	3+	3+	1602.6463998812103	0	-0.3906670349137978	Phosphorylation of Y (8: Random)	Phosphorylation of Y (8: 0.0, 11: 0.0)	Phosphorylation of Y (8: 0.3490401396160559)		0	Y8-{Y8 Y11}	1	99.28057553956835	Confident
1002	P10599, THIO_HUMAN	CMPTFQFFK		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46556 (Experiment 1)	46556	79.662	603.277771	2+	2+	1204.5409226774802	0	0.05502349209553988								91.30434782608697	Confident
1003	P62805	DNIQGITKPAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20853 (Experiment 1)	20853	44.536	663.381531	2+	2+	1324.74629844548	0	1.666178869740383								100.0	Confident
1004	Q14240	ETQALVLAPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27796 (Experiment 1)	27796	53.169	599.843201	2+	2+	1197.6717365228901	0	0.09381076267449003								100.0	Confident
1005	P23528	HELQANCYEEVKDR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14194 (Experiment 1)	14194	35.592	597.606445	3+	3+	1789.8053465265702	0	-4.373498523168916								100.0	Doubtful
1006	P10809	VGEVIVTKDDAMLLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35470 (Experiment 1)	35470	62.064	544.307983	3+	3+	1629.9011444043701	0	0.5972083249592082								100.0	Confident
1007	P35579	IAQLEEQLDNETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29580 (Experiment 1)	29580	55.243	765.88562	2+	2+	1529.7573166216505	0	-0.41099806512467546								100.0	Confident
1008	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21067 (Experiment 1)	21067	44.811	713.290955	2+	2+	1424.5666150733405	0	0.520119746517163	Phosphorylation of Y (4: Confident, 7: Doubtfull)		Phosphorylation of Y (4: 97.09208400646203, 7: 39.25686591276252)	Y4	1	Y9-{Y7}	1	99.45799457994579	Confident
1009	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21114 (Experiment 1)	21114	44.875	636.766785	2+	2+	1271.5183458337801	0	0.5270634126746891	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 93.21486268174475)	Y5	1		0	99.18478260869566	Confident
1010	P49327	YSGTLNLDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23389 (Experiment 1)	23389	47.925	519.764771	2+	2+	1037.5141732523302	0	0.7847922092563662								99.45652173913044	Confident
1011	P06733	YISPDQLADLYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42653 (Experiment 1)	42653	71.812	753.350403	2+	2+	1504.6850768057104	0	0.7806869015371493	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 53.46147739171065)	Phosphorylation of Y (11: 100.0)		0	Y11-{Y1 Y11}	1	100.0	Confident
1012	P49458	PQYQTWEEFSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39763 (Experiment 1)	39763	67.414	775.81958	2+	2+	1549.6238735314805	0	0.4727486009484723	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1013	P14324	VLTEDEMGHPEIGDAIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32210 (Experiment 1)	32210	58.294	651.650818	3+	3+	1951.9309409625102	0	-0.16182638836428673								99.25373134328358	Confident
1014	P57737	SLQSLLGPSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34677 (Experiment 1)	34677	61.145	558.817627	2+	2+	1115.61863832087	0	1.8456373002547133								97.289972899729	Confident
1015	P11021	ITPSYVAFTPEGER	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36371 (Experiment 1)	36371	63.183	823.880127	2+	2+	1645.7389032837207	0	4.125485296093778	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1016	Q07020	TNSTFNQVVLKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22651 (Experiment 1)	22651	47.033	469.596283	3+	3+	1405.7677621660503	0	-0.5270953807526495								100.0	Confident
1017	P61604	VLLPEYGGTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29547 (Experiment 1)	29547	55.204	538.803467	2+	2+	1075.59136094387	0	0.9466563727441888								99.21052631578947	Confident
1018	P53999	DDNMFQIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36214 (Experiment 1)	36214	62.996	534.246887	2+	2+	1066.4753452154603	0	3.627409975830023								99.45799457994579	Confident
1019	Q01130	VDNLTYRTSPDTLR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25713 (Experiment 1)	25713	50.743	577.608704	3+	3+	1729.8036287986001	0	0.3773034155669368	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 89.87783595113437)	Y6	1		0	94.81481481481482	Confident
1020	Q9BVV7	QGTVYAQVK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12396 (Experiment 1)	12396	32.785	537.254944	2+	2+	1072.4954255612304	0	-0.0842196501539495	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.30191972076788)	Y5	1		0	99.7340425531915	Confident
1021	Q9NTK5	LQELSAEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16814 (Experiment 1)	16814	39.349	537.773987	2+	2+	1073.5353026197304	0	-1.7493873898417656								99.45799457994579	Confident
1022	Q7Z388	NENIYQIYSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29068 (Experiment 1)	29068	54.655	676.302429	2+	2+	1350.5856971176104	0	3.4067336341409065	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 8: 0.0)	Phosphorylation of Y (5: 61.03076678992909)		0	Y5-{Y5 Y8}	1	96.7479674796748	Confident
1023	Q02790	LYANMFER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37924 (Experiment 1)	37924	65.04	562.236206	2+	2+	1122.4569318775302	0	0.8245552317083202	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1024	P43487	FLNAENAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14557 (Experiment 1)	14557	36.132	517.766541	2+	2+	1033.5192586327703	0	-0.7045316979152224								100.0	Confident
1025	P41252	FLIQNVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43186 (Experiment 1)	43186	72.77	501.807373	2+	2+	1001.60220041109	0	-2.0001108065527036								99.45945945945947	Confident
1026	P50990	HFSGLEEAVYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29198 (Experiment 1)	29198	54.803	694.305786	2+	2+	1386.5969305076505	0	0.06377502015062869	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
1027	P49207	AFLIEEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29609 (Experiment 1)	29609	55.276	489.269379	2+	2+	976.5229470308802	0	1.2856282931677416								99.45652173913044	Confident
1028	Q13867	AQHVFQHAVPQEGKPITNQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13651 (Experiment 1)	13651	34.725	565.05127	4+	4+	2256.17634815103	0	-0.16547976983361706								100.0	Doubtful
1029	P05204	LSAKPAPPKPEPKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6463 (Experiment 1)	6463	20.998	528.987122	3+	3+	1583.9399128715904	0	-0.23710214084295794								100.0	Confident
1030	P19338	NSTWSGESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9573 (Experiment 1)	9573	27.823	498.224213	2+	2+	994.4355885784603	0	-1.7216236043255755								98.9247311827957	Confident
1031	Q9GZR7	VQHVIHYQVPR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15478 (Experiment 1)	15478	37.584	485.912811	3+	3+	1454.7183830530103	0	-1.220693118823786	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	99.24812030075188	Confident
1032	P14866	ASLNGADIYSGCCTLK	Phosphorylation of Y(9)	Carbamidomethylation of C(12, 13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29764 (Experiment 1)	29764	55.456	905.383362	2+	2+	1808.74743644543	0	2.614711913426997	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.83844911147011)	Y9	1		0	100.0	Confident
1033	P52565	AEEYEFLTPVEEAPK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42665 (Experiment 1)	42665	71.831	916.406128	2+	2+	1830.7964777294908	0	0.6685560401479995	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1034	Q99961, Q99962	TIEYLQPNPASR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26649 (Experiment 1)	26649	51.818	734.845276	2+	2+	1467.6759091043402	0	0.06121155302333763	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
1035	Q96JM2	CPLCLYHTK	Phosphorylation of Y(6)	Carbamidomethylation of C(1, 4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26042 (Experiment 1)	26042	51.122	636.773438	2+	2+	1270.5239658915302	1	3.9309906707352176	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 90.92495636998254)	Y6	1		0	92.43243243243244	Confident
1036	P21796	LTFDSSFSPNTGKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28320 (Experiment 1)	28320	53.784	510.259949	3+	3+	1527.7569226988303	0	0.7152573370177838								100.0	Confident
1037	O75608	ALIDQEVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20616 (Experiment 1)	20616	44.263	458.260193	2+	2+	914.5072969667403	0	-1.5972345497140765								98.92761394101876	Confident
1038	P11908, P60891	MVLVGDVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28007 (Experiment 1)	28007	53.409	430.748718	2+	2+	859.4837250711903	0	-0.977372602725422								98.66666666666667	Confident
1039	Q06830	ATAVMPDGQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24799 (Experiment 1)	24799	49.673	582.787781	2+	2+	1163.5644945730303	0	-2.990364885074396								100.0	Confident
1040	P30101	EATNPPVIQEEKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14410 (Experiment 1)	14410	35.918	527.282288	3+	3+	1578.8253366118206	0	-0.19092379030058954								100.0	Confident
1041	P12004	SEGFDTYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18843 (Experiment 1)	18843	42.1	527.698181	2+	2+	1053.3804553786404	0	1.2826360981280076	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
1042	P23526	YPQLLPGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41123 (Experiment 1)	41123	69.358	528.813477	2+	2+	1055.61276509479	0	-0.3441934675513256								96.49595687331536	Confident
1043	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28081 (Experiment 1)	28081	53.493	609.260315	2+	2+	1216.5053215385904	0	0.6200373102765451	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 43.16022828057617)	Phosphorylation of Y (3: 64.97821550177572)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
1044	P22314	NIILGGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27743 (Experiment 1)	27743	53.107	407.263428	2+	2+	812.5119884243602	0	0.38628822986263195								92.45283018867924	Confident
1045	P18124	EVPAVPETLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27338 (Experiment 1)	27338	52.62	541.808716	2+	2+	1081.6019256275704	0	0.8798673925184933								100.0	Confident
1046	Q01469	TTQFSCTLGEKFEETTADGR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35377 (Experiment 1)	35377	61.958	760.014465	3+	3+	2277.0219407948807	0	-0.16455619046016545								99.25373134328358	Confident
1047	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27089 (Experiment 1)	27089	52.328	565.21521	2+	2+	1128.4165065341901	0	-0.565684929677775	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 49.39867221793312)	Phosphorylation of Y (6: 99.82547993019197)		0	Y6-{Y2 Y6}	1	100.0	Confident
1048	P62328	NPLPSKETIEQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17254 (Experiment 1)	17254	39.946	504.935333	3+	3+	1511.7831374466707	0	0.6813767553429919								100.0	Confident
1049	Q9H6Z4	DTGQLYAALHHR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26211 (Experiment 1)	26211	51.317	487.892181	3+	3+	1460.6561767192704	0	-0.9996185639072703	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 90.40139616055846)	Y6	1		0	96.26865671641791	Confident
1050	P46776	NQSFCPTVNLDK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29528 (Experiment 1)	29528	55.183	711.837524	2+	2+	1421.6609141390102	0	-0.2943596654933257								100.0	Confident
1051	P26599	GQPIYIQFSNHK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32125 (Experiment 1)	32125	58.199	504.573303	3+	3+	1510.6969789020904	0	0.7271479138720388	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1052	P78527	INQVFHGSCITEGNELTK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27824 (Experiment 1)	27824	53.201	683.004089	3+	3+	2045.9840391645305	0	3.122702151144207								92.14285714285715	Doubtful
1053	P55060	HKDAAIYLVTSLASK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43773 (Experiment 1)	43773	73.724	566.294312	3+	3+	1695.8596871227403	0	0.8355360922850832	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1054	P51991	IFVGGIKEDTEEYNLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34411 (Experiment 1)	34411	60.839	628.323608	3+	3+	1881.9472426496504	0	0.9294316493285143								100.0	Confident
1055	P36578	SNYNLPMHK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16315 (Experiment 1)	16315	38.738	592.252625	2+	2+	1182.4892946349703	0	1.1839821444005851	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1056	Q08945	IPYTTVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30369 (Experiment 1)	30369	56.156	481.787292	2+	2+	961.5596668927701	0	0.37794037909854616								99.1869918699187	Confident
1057	P19338	KVVVSPTKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4201 (Experiment 1)	4201	16.782	493.322662	2+	2+	984.6331661862002	0	-2.427532925669681								99.73333333333333	Confident
1058	P61978	GGDLMAYDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24090 (Experiment 1)	24090	48.826	499.224335	2+	2+	996.43348040348	0	0.6376525115536369								100.0	Confident
1059	Q15819	YPEAPPSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18762 (Experiment 1)	18762	42.002	508.264496	2+	2+	1014.5134449763402	0	0.9779268627309363								99.7340425531915	Confident
1060	P62750	KLYDIDVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22992 (Experiment 1)	22992	47.438	532.802856	2+	2+	1063.5913609438703	0	-0.1894485492150067								99.73118279569893	Confident
1061	P60842	GFKDQIYDIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45436 (Experiment 1)	45436	77.52	527.916809	3+	3+	1580.7276103240304	0	0.6233786157785173	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1062	P38159, Q96E39	LFIGGLNTETNEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36308 (Experiment 1)	36308	63.107	718.375793	2+	2+	1434.7354589782606	0	1.0955894221858613								100.0	Confident
1063	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19363 (Experiment 1)	19363	42.74	636.766785	2+	2+	1271.5183458337801	0	0.5270634126746891	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1064	Q00839	NFILDQTNVSAAAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36552 (Experiment 1)	36552	63.392	824.427002	2+	2+	1646.8376326310206	0	1.1028492251820472								100.0	Confident
1065	P18124	KTTHFVEGGDAGNREDQINR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10928 (Experiment 1)	10928	30.374	561.774414	4+	4+	2243.06791990086	0	0.28046492179213556								100.0	Doubtful
1066	P13639	YEWDVAEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33050 (Experiment 1)	33050	59.253	569.762207	2+	2+	1137.5090878718904	0	0.6785243041311632								100.0	Confident
1067	P13010	KKDQVTAQEIFQDNHEDGPTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20286 (Experiment 1)	20286	43.881	625.559204	4+	4+	2498.2037446673307	0	1.5847707459414153								100.0	Doubtful
1068	O00629	IEQLQNHENEDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18776 (Experiment 1)	18776	42.019	618.274963	3+	3+	1851.8040227214206	0	-0.5192519047990041	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 98.60383944153578)	Y13	1		0	96.71052631578947	Confident
1069	P00338	FIIPNVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40514 (Experiment 1)	40514	68.501	465.294647	2+	2+	928.5745886809204	0	0.16375159436199274								99.73045822102425	Confident
1070	P41252	SDTPLIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25204 (Experiment 1)	25204	50.146	508.739136	2+	2+	1015.4627284506203	0	0.9735998767660702	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	99.73890339425587	Confident
1071	Q70E73, Q7Z5R6	ASGIYYVPK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28926 (Experiment 1)	28926	54.491	539.255188	2+	2+	1076.4943629320703	0	1.353845373004798	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (5: 5.410122164048866)		0	Y5-{Y5 Y6}	1	99.45652173913044	Confident
1072	P14927	WYYNAAGFNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38660 (Experiment 1)	38660	65.94	657.271851	2+	2+	1312.5277883186702	0	1.0351493922054977	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 1.5706806282722512)		0	Y2-{Y2 Y3}	1	100.0	Confident
1073	P17987	SSLGPVGLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25441 (Experiment 1)	25441	50.425	486.771667	2+	2+	971.5287606873101	0	0.020932880630368113								99.45799457994579	Confident
1074	P60709, P63261	GYSFTTTAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22904 (Experiment 1)	22904	47.328	566.766907	2+	2+	1131.5196525555903	0	-0.34537044635423314								100.0	Confident
1075	P23526	VPAINVNDSVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24353 (Experiment 1)	24353	49.157	628.846802	2+	2+	1255.6772158261504	0	1.4592130370350473								100.0	Confident
1076	P20700	LYKEELEQTYHAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17255 (Experiment 1)	17255	39.948	577.938843	3+	3+	1730.7916671325704	0	1.7490156811036128	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 10.49857933847463)	Phosphorylation of Y (10: 81.04824930741161)		0	Y10-{Y2 Y10}	1	100.0	Confident
1077	P57735, P62491, Q15907	AITSAYYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19863 (Experiment 1)	19863	43.368	472.744995	2+	2+	943.4763311916302	0	-0.945673056237385								99.45652173913044	Confident
1078	P55884	GTYLATFHQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21817 (Experiment 1)	21817	45.983	425.195801	3+	3+	1272.5652364565503	0	0.2643041958411624	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.30191972076788)	Y3	1		0	100.0	Confident
1079	P61353	YSVDIPLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34789 (Experiment 1)	34789	61.275	525.279541	2+	2+	1048.5440763982801	0	0.43088323018400504								100.0	Confident
1080	P10412, P16402, P16403, P22492, Q02539	ALAAAGYDVEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19944 (Experiment 1)	19944	43.479	594.270508	2+	2+	1186.5271196123304	0	-0.5523962430293344	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.50959860383944)	Y7	1		0	99.7289972899729	Confident
1081	Q9NTK5	FDFLCQYHKPASK	Phosphorylation of Y(7)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29002 (Experiment 1)	29002	54.579	574.257629	3+	3+	1719.7480284987805	0	1.7582736134768655	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	99.37888198757764	Confident
1082	P12956	IMATPEQVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17699 (Experiment 1)	17699	40.556	537.287292	2+	2+	1072.5586809166002	0	1.2564520807502793								100.0	Confident
1083	P39656	TADDPSLSLIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33506 (Experiment 1)	33506	59.78	580.314575	2+	2+	1158.6132185872602	0	1.1877013021969465								99.1891891891892	Confident
1084	P48444	ENVNLAQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25885 (Experiment 1)	25885	50.939	528.793823	2+	2+	1055.57235683479	0	0.6961428691423248								99.45945945945947	Confident
1085	P17980	VDILDPALLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45958 (Experiment 1)	45958	78.678	562.838684	2+	2+	1123.6601092100302	0	2.403764103898018								99.72972972972973	Confident
1086	P09651, Q32P51	DYFEQYGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29500 (Experiment 1)	29500	55.15	525.232361	2+	2+	1048.4501760134401	0	-0.006613324683544875								99.73684210526315	Confident
1087	P14866	AITHLNNNFMFGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33507 (Experiment 1)	33507	59.781	545.608948	3+	3+	1633.8034960517703	0	0.9277396740557601								100.0	Confident
1088	P00519	GAVSTLLQAPELPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41704 (Experiment 1)	41704	70.225	762.92981	2+	2+	1523.8559084641104	0	-7.105057741687514								99.73262032085562	Doubtful
1089	Q07955	EAGDVCYADVYR	Phosphorylation of Y(7)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26722 (Experiment 1)	26722	51.902	749.289734	2+	2+	1496.5643100500301	0	0.4037267310790863	Phosphorylation of Y (11: Random)	Phosphorylation of Y (7: 0.0, 11: 0.0)	Phosphorylation of Y (11: 25.181614466621504)		0	Y11-{Y7 Y11}	1	100.0	Confident
1090	Q96KP4	TGQEIPVNVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21648 (Experiment 1)	21648	45.727	556.806824	2+	2+	1111.5985715826303	0	0.47007684633517816								99.21259842519686	Confident
1091	Q06830	DISLSDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27155 (Experiment 1)	27155	52.406	510.718048	2+	2+	1019.4212575614604	0	0.27951332114050303	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	100.0	Confident
1092	P13639	SDPVVSYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17269 (Experiment 1)	17269	39.972	461.735535	2+	2+	921.4555957470502	0	0.9976709341843961								99.19354838709677	Confident
1093	P61978	ENTQTTIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6489 (Experiment 1)	6489	21.049	467.745941	2+	2+	933.4767251144503	0	0.6455986709234778								94.08602150537635	Confident
1094	P62424	AGVNTVTTLVENKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25021 (Experiment 1)	25021	49.933	491.947418	3+	3+	1472.8198573085606	0	0.38438472677306906								100.0	Confident
1095	Q16881	KVVYENAYGQFIGPHR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28732 (Experiment 1)	28732	54.266	653.650269	3+	3+	1956.9247469907903	1	0.4468341046417104	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 9.440360040453784)	Phosphorylation of Y (4: 2.094240837696335)		0	Y4-{Y4 Y8}	1	100.0	Confident
1096	P62826	NLQYYDISAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30094 (Experiment 1)	30094	55.839	607.806946	2+	2+	1213.5979028762904	0	1.1814539071871302								100.0	Confident
1097	Q96AE4	IAQITGPPDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18761 (Experiment 1)	18761	42.001	534.297424	2+	2+	1066.57710786206	0	2.982621362928432								100.0	Confident
1098	P62241	IIDVVYNASNNELVR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41468 (Experiment 1)	41468	69.853	899.940796	2+	2+	1797.8662290551604	0	0.4500360376870072	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1099	Q9NWQ8	AEFAEYASVDR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27575 (Experiment 1)	27575	52.902	669.274963	2+	2+	1336.5336615447502	0	1.2786402514705562	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 94.02261712439419)	Y6	1		0	98.95287958115183	Confident
1100	Q9BYD2	LLPQGLAVYASPENK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40172 (Experiment 1)	40172	67.972	840.423096	2+	2+	1678.8331380217307	0	-0.8917853550826702	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	99.72826086956522	Doubtful
1101	P29401	VLDPFTIKPLDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42063 (Experiment 1)	42063	70.804	471.941376	3+	3+	1412.8027506924402	0	-0.31931418810200896								100.0	Confident
1102	P55786	SPVYLTVLK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41648 (Experiment 1)	41648	70.144	550.293152	2+	2+	1098.5726132527702	0	-0.7833876506394485	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.47643979057592)	Y4	1		0	99.7289972899729	Confident
1103	P84098	LLADQAEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14171 (Experiment 1)	14171	35.559	493.766663	2+	2+	985.5192586327703	0	-0.4916959688173615								100.0	Confident
1104	P08238	YHTSQSGDEMTSLSEYVSR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32281 (Experiment 1)	32281	58.375	752.97522	3+	3+	2255.9042073385003	0	-0.16677789807965598	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 46.102562025336766)	Phosphorylation of Y (16: 100.0)		0	Y16-{Y1 Y16}	1	100.0	Confident
1105	P16401	ALAAGGYDVEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17927 (Experiment 1)	17927	40.849	587.263123	2+	2+	1172.5114695481905	0	0.19030500901254424	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 95.15347334410339)	Y7	1		0	95.2127659574468	Confident
1106	P49411	ELAMPGEDLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31181 (Experiment 1)	31181	57.099	551.775574	2+	2+	1101.5376111188502	0	-0.9207108711911606								99.73614775725594	Confident
1107	O15145	LIGNMALLPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46203 (Experiment 1)	46203	79.113	605.871216	2+	2+	1209.72674930121	0	0.9323484837553658								99.7289972899729	Confident
1108	P49321	ATLVESSTSGFTPGGGGSSVSMIASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39369 (Experiment 1)	39369	66.857	815.064087	3+	3+	2442.1696676577303	0	0.3124261777407682								99.24812030075188	Confident
1109	O95758	SQPVYIQYSNHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20615 (Experiment 1)	20615	44.262	786.357178	2+	2+	1570.6929561508102	0	4.353584837628715	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 8: 0.0)	Phosphorylation of Y (5: 3.664921465968586)		0	Y5-{Y5 Y8}	1	100.0	Confident
1110	O00571	SDYDGIGSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15047 (Experiment 1)	15047	36.916	525.2005	2+	2+	1048.3862690350702	0	0.16948892460765444	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	99.7340425531915	Confident
1111	Q00325	IQTQPGYANTLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20878 (Experiment 1)	20878	44.565	681.36322	2+	2+	1360.7099129367602	0	1.4486638091274089								99.45799457994579	Confident
1112	P17844	TTYLVLDEADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36121 (Experiment 1)	36121	62.871	648.328491	2+	2+	1294.6404959642603	0	1.4908376111404944								100.0	Confident
1113	P49458	LYLADPMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34012 (Experiment 1)	34012	60.369	475.753998	2+	2+	949.4942897548901	0	-0.889837777660625								99.1869918699187	Confident
1114	Q9UKM9	SNIDALLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34763 (Experiment 1)	34763	61.243	494.775482	2+	2+	987.5349086969102	0	1.5182358479073117								100.0	Confident
1115	Q07020	APGTPHSHTKPYVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5367 (Experiment 1)	5367	18.878	387.707428	4+	4+	1546.8004592766601	0	0.09469518447470443								100.0	Doubtful
1116	Q9Y490	ILADATAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10914 (Experiment 1)	10914	30.356	401.73999	2+	2+	801.4596184983302	0	7.229315206839984								99.45799457994579	Doubtful
1117	P23526	KLDEAVAEAHLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18356 (Experiment 1)	18356	41.478	460.921265	3+	3+	1379.7408787118704	0	0.7860261830576205								100.0	Confident
1118	P62826	LVLVGDGGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23766 (Experiment 1)	23766	48.404	508.292908	2+	2+	1014.57095985246	0	0.2982670049168065								99.73118279569893	Confident
1119	O75264	EGESNLGLDLEEKEPGDHER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26212 (Experiment 1)	26212	51.318	564.012024	4+	4+	2252.01929794259	0	-0.13643760387070775								100.0	Doubtful
1120	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32110 (Experiment 1)	32110	58.181	630.798157	2+	2+	1259.5798834611805	0	1.4882795461353349	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1121	P42704	IIETPGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22407 (Experiment 1)	22407	46.738	449.771423	2+	2+	897.5283667644901	0	-0.08192840202669331								91.30434782608697	Confident
1122	P78527	LAAVVSACK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14830 (Experiment 1)	14830	36.534	459.757324	2+	2+	917.5004377644902	0	-0.37269442876123676								99.45945945945947	Confident
1123	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3, 8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27257 (Experiment 1)	27257	52.526	649.242981	2+	2+	1296.4716520593404	0	-0.18713557650769896	Phosphorylation of Y (3: Confident, 8: Doubtfull)		Phosphorylation of Y (3: 96.50959860383944, 8: 67.4266832643796)	Y3	1	Y8-{Y8}	1	98.6737400530504	Confident
1124	P40925	VIVVGNPANTNCLTASK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29447 (Experiment 1)	29447	55.088	879.46637	2+	2+	1756.9141686995602	0	2.284553527524625								99.73333333333333	Confident
1125	P13639	KEDLYLKPIQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23164 (Experiment 1)	23164	47.641	741.889343	2+	2+	1481.7643301859202	0	-0.13284967627224972	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
1126	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38593 (Experiment 1)	38593	65.859	912.996216	2+	2+	1823.9781488551102	0	-0.14774907595269826								98.92183288409704	Confident
1127	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16907 (Experiment 1)	16907	39.465	514.763367	2+	2+	1027.5120650773501	0	0.11266248362586792								99.73118279569893	Confident
1128	GSTP1_HUMAN, P09211	ASCLYGQLPK	Phosphorylation of Y(5)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27144 (Experiment 1)	27144	52.393	608.774963	2+	2+	1215.5359104742201	0	-0.44138445224876627	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1129	P27348	KQTIDNSQGAYQEAFDISKK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23163 (Experiment 1)	23163	47.639	784.369446	3+	3+	2350.0842203058005	0	0.9724567082607419	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
1130	Q15631	KVEEVVYDLSIR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39526 (Experiment 1)	39526	67.076	765.384583	2+	2+	1528.75382507187	0	0.5147705669397703	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73890339425587	Confident
1131	Q07020	GCGTVLLSGPR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25294 (Experiment 1)	25294	50.249	558.795044	2+	2+	1115.57572796307	0	-0.17260054736803057								100.0	Confident
1132	P17844	LLQLVEDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32611 (Experiment 1)	32611	58.756	493.286987	2+	2+	984.5603951687601	0	-0.987357712553163								99.73474801061008	Confident
1133	P62857	TGSQGQCTQVR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5668 (Experiment 1)	5668	19.375	611.285828	2+	2+	1220.5567834236401	0	0.2614511941330349								100.0	Confident
1134	P40926	TIIPLISQCTPK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40448 (Experiment 1)	40448	68.401	685.889282	2+	2+	1369.7639226555702	0	0.0644497687837967								100.0	Confident
1135	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32718 (Experiment 1)	32718	58.878	576.284912	2+	2+	1150.5546410819804	0	0.5465913878461197								100.0	Confident
1136	P00519	LGGGQYGEVYEGVWKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33849 (Experiment 1)	33849	60.172	617.289917	3+	3+	1848.8447653345906	0	1.704369516774589	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 5.4262273427701455)	Phosphorylation of Y (6: 9.424083769633508)		0	Y6-{Y6 Y10}	1	100.0	Confident
1137	P29401	MPSLPSYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29448 (Experiment 1)	29448	55.091	461.738708	2+	2+	921.4629896266101	0	-0.13704744107015057								98.93899204244032	Confident
1138	P26599	DYGNSPLHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13077 (Experiment 1)	13077	33.841	569.737244	2+	2+	1137.4604370348402	0	-0.44052609201314447	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1139	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28571 (Experiment 1)	28571	54.077	528.262024	2+	2+	1054.5100129962104	0	-0.4902203425158555	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
1140	P43246	DIYQDLNR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24709 (Experiment 1)	24709	49.57	558.738159	2+	2+	1115.4648537089402	0	-2.7639368975820866	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 94.4153577661431)	Y3	1		0	96.4769647696477	Confident
1141	P49327	GNAGQSNYGFANSAMER	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26988 (Experiment 1)	26988	52.213	927.36615	2+	2+	1852.7199758276302	0	-1.20166051790122	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
1142	P14317	SAVGHEYVAEVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18539 (Experiment 1)	18539	41.716	473.238098	3+	3+	1416.6885087858407	0	2.786352692392924								100.0	Confident
1143	P14866	FSTPEQAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13078 (Experiment 1)	13078	33.844	489.747803	2+	2+	977.4818104948904	0	-0.7732836411057993								100.0	Confident
1144	P38159	ALEAVFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30921 (Experiment 1)	30921	56.792	417.73999	2+	2+	833.4647038787703	0	0.8655961232897674								98.91598915989161	Confident
1145	Q12931	AQLLQPTLEINPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39358 (Experiment 1)	39358	66.845	746.929443	2+	2+	1491.8409271063103	0	2.279979630560858								99.45799457994579	Confident
1146	Q9Y2X3	YGLIYHASLVGQTSPK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34278 (Experiment 1)	34278	60.684	907.447327	2+	2+	1812.8811508433105	0	-0.5784227338759925	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.0)		0	Y1-{Y1 Y5}	1	100.0	Confident
1147	P36871	IALYETPTGWK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40003 (Experiment 1)	40003	67.741	679.820679	2+	2+	1357.6319190340405	0	-3.7612480670473922	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
1148	P10809	GYISPYFINTSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40004 (Experiment 1)	40004	67.742	695.355591	2+	2+	1388.6976169175603	0	-0.7103203709625455								100.0	Confident
1149	P25398	DVIEEYFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43005 (Experiment 1)	43005	72.448	521.75885	2+	2+	1041.5018772331302	0	1.2168790150356477								100.0	Confident
1150	Q9NTK5	IGIVGLPNVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39681 (Experiment 1)	39681	67.293	533.834412	2+	2+	1065.6546299067702	0	-0.3360969858670769								100.0	Confident
1151	P35579, P35580	AGVLAHLEEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25953 (Experiment 1)	25953	51.016	408.55069	3+	3+	1222.6305999869003	0	-0.2932212491775925								100.0	Confident
1152	Q14566	ESEDFIVEQYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34608 (Experiment 1)	34608	61.067	693.823547	2+	2+	1385.6350762306504	0	-1.8269484034895518								96.19565217391303	Confident
1153	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13408 (Experiment 1)	13408	34.336	400.860107	3+	3+	1199.5587540937802	0	-0.21827578105573345	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	99.25373134328358	Confident
1154	Q00325	IQTQPGYANTLR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20116 (Experiment 1)	20116	43.689	721.849976	2+	2+	1440.6762434575103	1	4.020799938513704	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 94.58987783595113)	Y7	1		0	97.5609756097561	Confident
1155	P05141	AAYFGIYDTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37654 (Experiment 1)	37654	64.719	610.302979	2+	2+	1218.59208921986	0	-0.5605028356532256								99.73821989528795	Confident
1156	P37837	MESALDQLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28585 (Experiment 1)	28585	54.093	517.763184	2+	2+	1033.5113963710103	0	0.40433111879581773								100.0	Confident
1157	P62917	GVAMNPVEHPFGGGNHQHIGKPSTIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19959 (Experiment 1)	19959	43.497	685.097168	4+	4+	2736.3666851851904	0	-2.597819067543182								100.0	Doubtful
1158	P17844, Q92841	GDGPICLVLAPTR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43251 (Experiment 1)	43251	72.884	684.868591	2+	2+	1367.72312047275	0	-0.3587594789920713								99.7340425531915	Confident
1159	P39019	VLQALEGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34750 (Experiment 1)	34750	61.228	485.799469	2+	2+	969.5858816406103	0	-1.5403186134783262								99.73333333333333	Confident
1160	P26038	TANDMIHAENMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18357 (Experiment 1)	18357	41.479	468.212036	3+	3+	1401.6129184007705	0	0.9683647622319022								97.74436090225565	Confident
1161	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29018 (Experiment 1)	29018	54.596	528.26239	2+	2+	1054.5100129962104	0	0.20261730989276847	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1162	P48444	NYCNIQVTK	Phosphorylation of Y(2)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17917 (Experiment 1)	17917	40.835	610.262451	2+	2+	1218.5104240023702	0	-0.06139652661825248	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1163	P10412, P16402, P16403, P22492, Q02539	ALAAAGYDVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21148 (Experiment 1)	21148	44.918	554.289246	2+	2+	1106.5607890915803	0	2.841462078597769								100.0	Confident
1164	O95433	LNWTGTSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20863 (Experiment 1)	20863	44.547	453.737488	2+	2+	905.46068112749	0	-0.2843726245035878								99.45945945945947	Confident
1165	P25705	VLSIGDGIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31013 (Experiment 1)	31013	56.901	500.793121	2+	2+	999.5712942056302	0	0.39423554849740816								99.73045822102425	Confident
1166	P00338	DQLIYNLLKEEQTPQNK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46717 (Experiment 1)	46717	79.903	718.688293	3+	3+	2153.0405645886703	0	1.1525691003223695	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1167	Q06323	VDVFREDLCTK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28349 (Experiment 1)	28349	53.817	461.230591	3+	3+	1380.67075054672	0	-0.5831838427241272								100.0	Confident
1168	Q02790	ALELDSNNEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16981 (Experiment 1)	16981	39.568	566.773865	2+	2+	1131.5407819229904	0	-6.7088534460441975								100.0	Doubtful
1169	P10412, P16402, P16403	KASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23251 (Experiment 1)	23251	47.744	442.926941	3+	3+	1325.7554661468505	0	2.6546605855447387								100.0	Confident
1170	P09651, Q32P51	SSGPYGGGGQYFAK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23929 (Experiment 1)	23929	48.626	728.301025	2+	2+	1454.5867597467704	0	0.5061917759918209	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 8.445702272403691)	Phosphorylation of Y (5: 0.5235602094240843)		0	Y11-{Y5 Y11}	1	96.19565217391303	Confident
1171	P08238	YHTSQSGDEMTSLSEYVSR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39011 (Experiment 1)	39011	66.372	752.974304	3+	3+	2255.9042073385003	0	-1.38328519204637	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 2.162047371369046)	Phosphorylation of Y (1: 99.65095986038395)		0	Y16-{Y1 Y16}	1	99.37888198757764	Confident
1172	P49327	GNAGQSNYGFANSAMER	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27212 (Experiment 1)	27212	52.471	927.367676	2+	2+	1852.7199758276302	0	0.443857993075941	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
1173	O95573	IGYSSPQTLADQSSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22496 (Experiment 1)	22496	46.85	831.373474	2+	2+	1660.7345461792704	0	-1.2937086513702043	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
1174	Q8TEM1	AVDPTSGQLYGLAR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34426 (Experiment 1)	34426	60.857	764.363464	2+	2+	1526.71302288905	0	-0.4237659373896826	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 96.16055846422339)	Y10	1		0	99.72972972972973	Confident
1175	Q5T0F9	AEEVYAQLQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20436 (Experiment 1)	20436	44.057	629.790161	2+	2+	1257.5642333970404	0	1.2191927588166012	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.73333333333333	Confident
1176	Q14697	LSFQHDPETSVLVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39251 (Experiment 1)	39251	66.692	580.981079	3+	3+	1739.9206339789903	0	0.44385892818396405								100.0	Confident
1177	TRYP_PIG	VATVSLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22812 (Experiment 1)	22812	47.222	421.758331	2+	2+	841.5021520166501	0	-0.05091810726730755								100.0	Confident
1178	P39019	DVNQQEFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21388 (Experiment 1)	21388	45.276	567.780579	2+	2+	1133.5465360097703	0	0.060812761372204094								100.0	Confident
1179	P68104, Q5VTE0	YYVTIIDAPGHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31299 (Experiment 1)	31299	57.236	468.913971	3+	3+	1403.71974934447	0	0.23760945084280002								100.0	Confident
1180	P10412, P16402, P16403	SGVSLAALKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20105 (Experiment 1)	20105	43.677	487.305725	2+	2+	972.5967806774802	0	0.11942083154184095								100.0	Confident
1181	Q02790	VGEVCHITCKPEYAYGSAGSPPK	Phosphorylation of Y(13)	Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20930 (Experiment 1)	20930	44.626	863.050476	3+	3+	2586.1284107002402	0	0.45879891596952793	Phosphorylation of Y (13: Doubtfull)	Phosphorylation of Y (13: 9.890060795627313)	Phosphorylation of Y (13: 0.0)		0	Y13-{Y13 Y15}	1	100.0	Confident
1182	P00491	FGDRFPAMSDAYDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32964 (Experiment 1)	32964	59.155	549.91156	3+	3+	1646.7147406170202	0	-1.1456480328506278								97.87234042553192	Confident
1183	P55263	AGHYAASIIIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26557 (Experiment 1)	26557	51.715	626.315857	2+	2+	1250.61727202941	0	-0.08858391739063537	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1184	Q08211	KVFDPVPVGVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27630 (Experiment 1)	27630	52.973	429.2547	2+	3+	1284.7441731871602	0	-1.4774326952682908								92.41379310344827	Doubtful
1185	Q15717	NVALLSQLYHSPAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38251 (Experiment 1)	38251	65.441	523.623352	3+	3+	1567.8470751159102	0	0.7330233925522963								100.0	Confident
1186	P15153	HHCPSTPIILVGTK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21125 (Experiment 1)	21125	44.889	520.617188	3+	3+	1558.8289825236204	0	0.48152866970992136								100.0	Confident
1187	P61158	YSYVCPDLVK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33224 (Experiment 1)	33224	59.453	622.306519	2+	2+	1242.5954603481403	0	2.430253817088969								100.0	Confident
1188	P05388, Q8NHW5	GNVGFVFTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34786 (Experiment 1)	34786	61.271	484.763336	2+	2+	967.5127167003502	0	-0.6164179109599268								100.0	Confident
1189	O95831	ISGLGLTPEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27060 (Experiment 1)	27060	52.296	571.82373	2+	2+	1141.6342883850104	0	-1.2078171067724675								100.0	Confident
1190	P42704	SGGLGGSHALLLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36725 (Experiment 1)	36725	63.598	450.93457	3+	3+	1349.7779329269301	0	2.9181500054749416								100.0	Confident
1191	P62424	TCTTVAFTQVNSEDKGALAK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26317 (Experiment 1)	26317	51.438	714.355225	3+	3+	2140.0470333439107	0	-1.4874670629537123								100.0	Confident
1192	P62805	DAVTYTEHAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10301 (Experiment 1)	10301	29.196	567.774597	2+	2+	1133.5353026197304	0	-0.5825841563364397								99.74358974358975	Confident
1193	P13796, P13797	MINLSVPDTIDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41455 (Experiment 1)	41455	69.833	751.880005	2+	2+	1501.7446437629703	0	0.5408468372331202								100.0	Confident
1194	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16054 (Experiment 1)	16054	38.413	514.76355	2+	2+	1027.5120650773501	0	0.4681656766297929								100.0	Confident
1195	Q92619	LYDPGQQYASHVR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18858 (Experiment 1)	18858	42.119	538.573792	3+	3+	1612.7035208345103	0	-2.459721849159061	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 13.82214083567011)	Phosphorylation of Y (8: 99.47643979057592)		0	Y8-{Y2 Y8}	1	100.0	Confident
1196	Q9Y2W1	SGKWEGLVYAPPGK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32898 (Experiment 1)	32898	59.081	523.588867	3+	3+	1567.7435947413403	0	0.7492259543553872	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
1197	P62158	VFDKDGNGYISAAELR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33223 (Experiment 1)	33223	59.451	612.612976	3+	3+	1833.8298435464403	1	-8.764880100704294	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Doubtful
1198	Q9NVP2, Q9Y294	NILASNPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15467 (Experiment 1)	15467	37.57	442.752136	2+	2+	883.4875645816701	0	2.433065560652491								97.289972899729	Confident
1199	Q06830	HGEVCPAGWKPGSDTIKPDVQK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20260 (Experiment 1)	20260	43.852	602.301941	4+	4+	2405.17977884896	0	-0.4651801738689951								100.0	Doubtful
1200	Q96AE4	QQAAYYAQTSPQGMPQHPPAPQGQ	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28173 (Experiment 1)	28173	53.611	887.722473	3+	3+	2660.1479002748606	0	-0.867641018506953	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (6: 0.0)		0	Y5-{Y5 Y6}	1	100.0	Confident
1201	P06733	IDKLMIEMDGTENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30937 (Experiment 1)	30937	56.811	546.269531	3+	3+	1635.7847943227905	0	1.2016529253497596								100.0	Confident
1202	P62805	KTVTAMDVVYALK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45683 (Experiment 1)	45683	78.074	759.885803	2+	2+	1517.7564679241605	0	0.3850199848418357	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
1203	P78527	APGLGAFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26974 (Experiment 1)	26974	52.196	394.724701	2+	2+	787.4340724568301	0	0.9837366498083218								94.10187667560321	Confident
1204	P15259, P18669	AMEAVAAQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10300 (Experiment 1)	10300	29.195	488.250641	2+	2+	974.4855159763404	0	1.2422836150093908								100.0	Confident
1205	Q15018	AIYQVYNALQEK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39942 (Experiment 1)	39942	67.662	760.364014	2+	2+	1518.7119602598905	0	0.9961071055397315	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 11.733172724467732)	Phosphorylation of Y (3: 84.27078180681356)		0	Y3-{Y3 Y6}	1	99.73333333333333	Confident
1206	P78371	LAVEAVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32703 (Experiment 1)	32703	58.86	435.774231	2+	2+	869.5334521449302	0	0.5242642324232014								99.73190348525469	Confident
1207	P33993	TQRPADVIFATVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35548 (Experiment 1)	35548	62.153	491.94342	3+	3+	1472.8099613312004	0	-1.0371992567409227								99.4186046511628	Confident
1208	P22626	NYYEQWGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27167 (Experiment 1)	27167	52.419	584.229614	2+	2+	1166.4433899883702	0	1.099806812370634	Phosphorylation of Y (3: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (3: 15.359275832291647)		0	Y3-{Y2 Y3}	1	99.7289972899729	Confident
1209	P17844	LIDFLECGK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42668 (Experiment 1)	42668	71.839	547.781067	2+	2+	1093.54778187973	0	-0.18329705929018889								99.73333333333333	Confident
1210	P28907	LGTQTVPCNK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11262 (Experiment 1)	11262	30.965	559.287109	2+	2+	1116.55974354576	0	-0.07016018915825718								93.76693766937669	Confident
1211	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21704 (Experiment 1)	21704	45.82	506.90802	3+	3+	1517.7014551458406	0	0.5099242783637523	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.83844911147011)	Y11	1		0	100.0	Confident
1212	Q6P1J9	TNYVVWGTGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33143 (Experiment 1)	33143	59.361	602.773621	2+	2+	1203.53253934594	0	0.12419293855499101	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1213	P07910	VPPPPPIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18939 (Experiment 1)	18939	42.219	472.289795	2+	2+	942.5650866263802	0	-0.05246778778259151								90.2439024390244	Doubtful
1214	P52272	FEPYANPTKR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15111 (Experiment 1)	15111	37.027	434.866669	3+	3+	1301.5805521675202	0	-1.8201468812714647	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.30191972076788)	Y4	1		0	98.7012987012987	Confident
1215	Q13347	LFDSTTLEHQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22495 (Experiment 1)	22495	46.848	440.226349	3+	3+	1317.6564803815704	0	0.5582116312174535								99.28057553956835	Confident
1216	P20701	TSLLASGAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20693 (Experiment 1)	20693	44.348	486.778046	2+	2+	971.53999407735	0	1.5869568180423717								99.20212765957447	Confident
1217	O75367	QTAAQLILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30253 (Experiment 1)	30253	56.024	493.305725	2+	2+	984.5967806774802	0	0.11796833456589706								99.74025974025975	Confident
1218	Q9ULZ3	VLTDEQYQAVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20341 (Experiment 1)	20341	43.943	701.324463	2+	2+	1400.6337099391903	0	0.47276797978653545	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1219	P62241	ISSLLEEQFQQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36883 (Experiment 1)	36883	63.789	502.932159	3+	3+	1505.7725727629704	0	1.3751619112036861								92.14285714285715	Doubtful
1220	O75367	SIAFPSIGSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36805 (Experiment 1)	36805	63.694	546.295593	2+	2+	1090.57710786206	0	-0.4345591323359849								99.73045822102425	Confident
1221	P07900	RAPFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40018 (Experiment 1)	40018	67.76	422.21933	3+	3+	1263.6360197205104	0	0.11122107972192434								100.0	Confident
1222	P61158	AEPEDHYFLLTEPPLNTPENR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44472 (Experiment 1)	44472	75.342	854.726807	3+	3+	2561.1475488383503	0	4.306564654856679	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1223	P50395	TYDATTHFETTCDDIK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24364 (Experiment 1)	24364	49.169	639.943604	3+	3+	1916.8098227703204	0	-0.43762730724607407								93.98496240601504	Confident
1224	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34400 (Experiment 1)	34400	60.827	954.459839	2+	2+	1906.8978635366104	0	3.8040141091587336	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 10.654616120755556)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y5}	1	100.0	Confident
1225	Q14671, Q8TB72	DQYANYVVQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21383 (Experiment 1)	21383	45.27	654.287292	2+	2+	1306.5594823697704	0	0.41930879766006934	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 23.915653034399412)	Phosphorylation of Y (3: 1.1308562197092082)		0	Y3-{Y3 Y6}	1	100.0	Confident
1226	P07900, P08238, Q14568	HNDDEQYAWESSAGGSFTVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35877 (Experiment 1)	35877	62.558	752.658875	3+	3+	2254.9515527359404	0	1.4361832822544531								100.0	Confident
1227	P35606	TYLPSQVSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21384 (Experiment 1)	21384	45.272	565.765564	2+	2+	1129.5168892818003	0	-0.277690404944314	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 97.09208400646203)	Y2	1		0	99.46666666666667	Confident
1228	P40926	EGVVECSFVK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27086 (Experiment 1)	27086	52.325	577.28186	2+	2+	1152.5485101557204	0	0.5689690555744901								100.0	Confident
1229	O00148	HFVLDECDK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20432 (Experiment 1)	20432	44.048	581.762451	2+	2+	1161.51245900017	0	-1.8133947665196903								100.0	Confident
1230	P16885	MYVDPSEINPSMPQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37970 (Experiment 1)	37970	65.099	922.392578	2+	2+	1842.7681718900103	0	1.3178659647816968	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.86914378029078)	Y2	1		0	99.45652173913044	Confident
1231	P63104	YLAEVAAGDDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14355 (Experiment 1)	14355	35.824	640.331177	2+	2+	1278.6455813447003	0	1.7332636631592373								96.19565217391303	Confident
1232	P36957	GLVVPVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36964 (Experiment 1)	36964	63.885	426.787598	2+	2+	851.5592729699501	0	1.6051293799852149								99.7289972899729	Confident
1233	Q12906	AYAALAALEK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36724 (Experiment 1)	36724	63.597	551.273865	2+	2+	1099.5314767167804	1	-1.5019691961006534	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1234	Q92841	QLAEDFLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36806 (Experiment 1)	36806	63.695	496.263794	2+	2+	990.5134449763402	0	-0.41299587010991917								98.91598915989161	Confident
1235	P07910	GFAFVQYVNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42749 (Experiment 1)	42749	71.991	665.333191	2+	2+	1328.6513354314802	0	0.37096832500430155								100.0	Confident
1236	P22626	IDTIEIITDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40341 (Experiment 1)	40341	68.251	594.827148	2+	2+	1187.6397676882702	0	-0.020696679722128564								100.0	Confident
1237	P52272	FEPYANPTKR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 15013 (Experiment 1)	15013	36.858	651.797852	2+	2+	1301.5805521675202	0	0.45942091482114633	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	99.45799457994579	Confident
1238	Q9Y277	YKVCNYGLTFTQK	Phosphorylation of Y(6)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31273 (Experiment 1)	31273	57.204	567.928772	3+	3+	1700.7633442097501	0	0.6705010887698464	Phosphorylation of Y (6: Random)	Phosphorylation of Y (1: 0.0, 6: 0.0)	Phosphorylation of Y (6: 0.17452006980802792)		0	Y6-{Y1 Y6}	1	100.0	Confident
1239	Q9Y265	LDPSIFESLQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44392 (Experiment 1)	44392	75.126	638.843384	2+	2+	1275.6710678165505	0	0.8979124494915537								100.0	Confident
1240	P07900, P08238, Q58FF6, Q58FF7	EDQTEYLEER	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20363 (Experiment 1)	20363	43.967	696.27301	2+	2+	1390.5289700871303	0	1.793106789287419	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.77835951134381)	Y6	1		0	99.45652173913044	Confident
1241	P50395	TDDYLDQPCYETINR	Phosphorylation of Y(10)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34421 (Experiment 1)	34421	60.851	991.891235	2+	2+	1981.7764876442402	0	-4.320302738009747	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 13.327477663949075)	Phosphorylation of Y (10: 76.10068631180204)		0	Y10-{Y4 Y10}	1	99.7289972899729	Doubtful
1242	Q13162	QITLNDLPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38904 (Experiment 1)	38904	66.239	613.348816	2+	2+	1224.68263555976	0	0.3615453105509488								100.0	Confident
1243	P11142, P54652	STAGDTHLGGEDFDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18853 (Experiment 1)	18853	42.113	846.368347	2+	2+	1690.7183053439803	0	2.2659939379814262								99.2248062015504	Confident
1244	TRYP_PIG	VATVSLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22169 (Experiment 1)	22169	46.445	421.758545	2+	2+	841.5021520166501	0	0.4564814469377312								99.73753280839895	Confident
1245	Q96IX5	AGPESDAQYQFTGIK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34183 (Experiment 1)	34183	60.57	846.370789	2+	2+	1690.7239814955703	0	1.7980159035188317	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
1246	Q99873	TGFSTSPESPYTHWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29433 (Experiment 1)	29433	55.073	575.602417	3+	3+	1723.7842000758303	0	0.7073890828980351								92.99363057324841	Doubtful
1247	P24752	EAYMGNVLQGGEGQAPTR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32861 (Experiment 1)	32861	59.04	653.287537	3+	3+	1956.8400909603101	0	0.3523917919634398	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.76898222940227)	Y3	1		0	99.25925925925925	Confident
1248	P29401	SVPTSTVFYPSDGVATEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34922 (Experiment 1)	34922	61.431	943.467041	2+	2+	1883.9152738150308	1	0.4774374593358696								91.08108108108108	Doubtful
1249	Q16630	GDYGPPGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10329 (Experiment 1)	10329	29.245	449.676483	2+	2+	897.3381966438401	0	0.24064254668612978	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
1250	Q14739	FADGEVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17741 (Experiment 1)	17741	40.607	446.73056	2+	2+	891.4450310633501	0	1.7191634109720255								93.6	Confident
1251	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17914 (Experiment 1)	17914	40.828	514.76416	2+	2+	1027.5120650773501	0	1.653176319902592								96.2059620596206	Confident
1252	P26583	SEHPGLSIGDTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17075 (Experiment 1)	17075	39.697	437.889709	3+	3+	1310.6466439738604	0	0.4975575777167677								100.0	Confident
1253	P13804	VLVAQHDVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14852 (Experiment 1)	14852	36.569	626.310974	2+	2+	1250.6060386393704	0	1.0828713934619494	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 94.24083769633508)	Y9	1		0	93.65079365079364	Confident
1254	P27797	AKIDDPTDSKPEDWDKPEHIPDPDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24840 (Experiment 1)	24840	49.72	740.604919	4+	4+	2958.3883105313703	0	0.7627559063428265								100.0	Doubtful
1255	CYC_HUMAN, P99999	ADLIAYLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42213 (Experiment 1)	42213	71.057	453.768097	2+	2+	905.5222187548902	0	-0.6365455727356257								92.62086513994912	Confident
1256	P13639, Q15029	GGGQIIPTAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19445 (Experiment 1)	19445	42.843	485.276855	2+	2+	968.54032843052	0	-1.2069015018464724								99.72826086956522	Confident
1257	P15170	LESGSICK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 9990 (Experiment 1)	9990	28.554	447.224701	2+	2+	892.4324177743201	0	2.718207043613237								97.8891820580475	Confident
1258	P13693, Q56UQ5	VKPFMTGAAEQIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24276 (Experiment 1)	24276	49.065	710.387268	2+	2+	1418.7591716283005	0	0.5711240722295887								91.32791327913279	Confident
1259	P11940, Q13310	SLGYAYVNFQQPADAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39617 (Experiment 1)	39617	67.211	965.463013	2+	2+	1927.9064404668304	1	0.8693421913011666								92.63157894736842	Doubtful
1260	P33992	AIACLLFGGSR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43855 (Experiment 1)	43855	73.884	582.813538	2+	2+	1163.61211347179	0	0.35139431654642533								100.0	Confident
1261	Q92598	FVVQNVSAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19940 (Experiment 1)	19940	43.475	560.311646	2+	2+	1118.6084079903403	0	0.29543927536804654								100.0	Confident
1262	O43175	GGIVDEGALLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36051 (Experiment 1)	36051	62.78	550.308716	2+	2+	1098.6033226099	0	-0.40299502127500103								99.50248756218906	Confident
1263	Q15365	IANPVEGSSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14187 (Experiment 1)	14187	35.583	543.779175	2+	2+	1085.54653600977	0	-2.518427168874901								92.63157894736842	Confident
1264	O00232	AIYDTPCIQAESEK	Phosphorylation of Y(3)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28776 (Experiment 1)	28776	54.32	852.864624	2+	2+	1703.7113682065406	0	1.950407034427465	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1265	P38646	VQQTVQDLFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37312 (Experiment 1)	37312	64.298	645.848694	2+	2+	1289.6727991520502	0	7.769615696493112								100.0	Doubtful
1266	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19977 (Experiment 1)	19977	43.518	636.766785	2+	2+	1271.5183458337801	0	0.5270634126746891	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1267	P49368	KGESQTDIEITREEDFTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24772 (Experiment 1)	24772	49.643	539.263367	4+	4+	2153.0236550470404	0	0.32780176924527793								100.0	Doubtful
1268	Q13162	DYGVYLEDSGHTLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32637 (Experiment 1)	32637	58.785	568.91333	3+	3+	1703.7192304683003	0	-0.6268488885423751	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 20.693682721948154)	Phosphorylation of Y (2: 3.926701570680628)		0	Y2-{Y2 Y5}	1	99.3975903614458	Confident
1269	P00558, P07205	LGDVYVNDAFGTAHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32963 (Experiment 1)	32963	59.154	545.6026	3+	3+	1633.7848687821704	0	0.6731505894883062								100.0	Confident
1270	P25786	NVSIGIVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26646 (Experiment 1)	26646	51.814	443.771179	2+	2+	885.5283667644903	0	-0.6328686779476467								98.93048128342245	Confident
1271	P37802	GPAYGLSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13814 (Experiment 1)	13814	34.959	450.702362	2+	2+	899.3902322167003	0	-0.06783891677438303	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 85.51483420593368)	Y4	1		0	95.23809523809523	Confident
1272	P27824	GTLSGWILSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43082 (Experiment 1)	43082	72.566	531.302612	2+	2+	1060.5916952970401	0	-0.9638854148240176								96.7479674796748	Confident
1273	Q9NQ29, Q9Y383	ADYEIASK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11910 (Experiment 1)	11910	31.958	488.705048	2+	2+	975.3950428136204	0	0.5118148602090739	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 89.82229402261711)	Y3	1		0	97.58713136729223	Confident
1274	P07900	HLEINPDHSIIETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34524 (Experiment 1)	34524	60.971	596.318909	3+	3+	1785.93734667229	0	-1.3689930763936684								100.0	Confident
1275	P10809	IPAMTIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24512 (Experiment 1)	24512	49.342	422.751587	2+	2+	843.4888104516303	0	-0.22399113063010676								99.73474801061008	Confident
1276	P62249	ALVAYYQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23859 (Experiment 1)	23859	48.536	518.247437	2+	2+	1034.4837982483702	0	-3.3547395328196328	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (5: 15.270506108202442)		0	Y5-{Y5 Y6}	1	99.19354838709677	Confident
1277	P26599	GQPIYIQFSNHK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31872 (Experiment 1)	31872	57.911	504.573181	3+	3+	1510.6969789020904	0	0.4853592817353012	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1278	P62937, PPIA_HUMAN	EGMNIVEAMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41450 (Experiment 1)	41450	69.828	639.793884	2+	2+	1277.5744076337305	0	-0.931992531442264								99.7289972899729	Confident
1279	P60842, Q14240	GYDVIAQAQSGTGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24019 (Experiment 1)	24019	48.737	737.832825	2+	2+	1473.6500882793205	0	0.6836153873475997	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1280	P57721, Q15365, Q15366	INISEGNCPER		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16980 (Experiment 1)	16980	39.567	644.80127	2+	2+	1287.58774919875	0	0.18445037315965754								100.0	Confident
1281	P06733	SGKYDLDFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23583 (Experiment 1)	23583	48.168	536.768799	2+	2+	1071.5236753068702	0	-0.5870685159807745								100.0	Confident
1282	P62753	LNISFPATGCQK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35292 (Experiment 1)	35292	61.859	668.339722	2+	2+	1334.6652712434604	0	-0.28441895927791866								100.0	Confident
1283	P27348	YLAEVACGDDR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21121 (Experiment 1)	21121	44.883	634.780762	2+	2+	1267.55030106087	0	-2.622941619464739								100.0	Confident
1284	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31873 (Experiment 1)	31873	57.914	630.79718	2+	2+	1259.5798834611805	0	-0.060554170526668956	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1285	P12956	SDSFENPVLQQHFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33768 (Experiment 1)	33768	60.077	568.609314	3+	3+	1702.8063325027404	0	-0.1289128536084125								100.0	Confident
1286	P43243	DSFDDRGPSLNPVLDYDHGSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36050 (Experiment 1)	36050	62.779	591.272888	4+	4+	2361.06216581408	0	0.11852340543516413								100.0	Doubtful
1287	Q99543	NQDHYAVLGLGHVR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26748 (Experiment 1)	26748	51.933	553.598999	3+	3+	1657.7726034538402	0	1.5439272153039167	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1288	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28775 (Experiment 1)	28775	54.317	609.260498	2+	2+	1216.5053215385904	0	0.9204017176637955	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.714203795409155)	Phosphorylation of Y (6: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
1289	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16702 (Experiment 1)	16702	39.209	514.764465	2+	2+	1027.5120650773501	0	2.245681641649418								100.0	Confident
1290	P50995	SETDLLDIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38337 (Experiment 1)	38337	65.555	531.276978	2+	2+	1060.5400536470001	0	-0.6122797080684704								100.0	Confident
1291	P18669, Q8N0Y7	SYDVPPPPMEPDHPFYSNISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37742 (Experiment 1)	37742	64.824	806.374268	3+	3+	2416.10454822003	0	-1.477235955674185								94.77611940298507	Doubtful
1292	P34932	VLATAFDTTLGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38515 (Experiment 1)	38515	65.771	661.35907	2+	2+	1320.7037649271601	0	-0.13446610811371631								100.0	Confident
1293	Q15814	LYGNPNTLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19292 (Experiment 1)	19292	42.657	564.266174	2+	2+	1126.5172236349702	0	0.5063494156964685	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
1294	P06733	LMIEMDGTENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31034 (Experiment 1)	31034	56.926	640.795532	2+	2+	1279.5788243078302	0	-1.804973008997426								98.6522911051213	Confident
1295	P06733	SGKYDLDFKSPDDPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23904 (Experiment 1)	23904	48.594	457.469391	4+	4+	1825.8482568843701	0	0.10997916352008937								100.0	Doubtful
1296	B0I1T2	VGELVGVLAAHCQGEGR		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32714 (Experiment 1)	32714	58.872	584.63446	3+	3+	1750.8784518971802	0	1.7667494650851008								100.0	Confident
1297	Q15459	ASKPLPPAPAPDEYLVSPITGEK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38598 (Experiment 1)	38598	65.867	819.749084	3+	3+	2456.2240082539	0	0.5751135742478403	Phosphorylation of Y (14: Very Confident)	Phosphorylation of Y (14: 100.0)	Phosphorylation of Y (14: 99.82547993019197)	Y14	1		0	100.0	Confident
1298	P49354	NYQVWHHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10980 (Experiment 1)	10980	30.456	610.261414	2+	2+	1218.5083902867702	0	-0.09440248143732202	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
1299	P61604	GGEIQPVSVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17776 (Experiment 1)	17776	40.652	507.285156	2+	2+	1012.5553097883203	0	0.4428261396611478								99.73045822102425	Confident
1300	P22314	AENYDIPSADR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19105 (Experiment 1)	19105	42.426	665.76947	2+	2+	1329.5238251370401	0	0.4220151254159228	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1301	P23193, Q15560	NCTYTQVQTR	Phosphorylation of Y(4)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10485 (Experiment 1)	10485	29.568	675.779114	2+	2+	1349.5435150358003	0	0.11840451362291328	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.72826086956522	Confident
1302	P33991	YQQLFEDIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38406 (Experiment 1)	38406	65.639	606.305115	2+	2+	1210.5982372294602	0	-2.111278311693876								98.91598915989161	Confident
1303	P62995	GYDDRDYYSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15541 (Experiment 1)	15541	37.669	437.186005	3+	3+	1308.5370935248802	0	-0.6922489720656212								100.0	Confident
1304	P09651	NQGGYGGSSSSSSYGSGR	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9111 (Experiment 1)	9111	26.875	887.837402	2+	2+	1773.6591493928802	0	0.6204256413917388	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 44.290626167326955)	Phosphorylation of Y (14: 0.9693053311793215)		0	Y14-{Y5 Y14}	1	100.0	Confident
1305	Q99832	TFSYAGFEMQPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39934 (Experiment 1)	39934	67.65	703.328125	2+	2+	1404.6383877892804	0	2.352589611597751								100.0	Confident
1306	P50990	HFSGLEEAVYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28740 (Experiment 1)	28740	54.277	694.304626	2+	2+	1386.5969305076505	0	-1.6069586787417534	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 96.33507853403141)	Y10	1		0	99.01477832512316	Confident
1307	P07900, Q58FG0	EGLELPEDEEEKKKQEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15785 (Experiment 1)	15785	38.033	547.520752	4+	4+	2186.0590374962508	0	-2.3448204651283495								100.0	Doubtful
1308	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45150 (Experiment 1)	45150	76.908	625.279358	2+	2+	1248.5427696764702	0	1.1142151426592288	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	99.73753280839895	Confident
1309	P28907	YTEIHPEMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16480 (Experiment 1)	16480	38.935	392.52182	3+	3+	1174.5440934816202	0	-0.3930837732213748								99.37888198757764	Confident
1310	P68104, Q05639, Q5VTE0	THINIVVIGHVDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26451 (Experiment 1)	26451	51.594	530.299072	3+	3+	1587.8732898637504	0	1.3179598002888122								100.0	Confident
1311	P08621	EFEVYGPIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38244 (Experiment 1)	38244	65.433	581.262451	2+	2+	1160.5154922994702	0	-4.42417218836495	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.72826086956522	Doubtful
1312	P00441, SODC_HUMAN	GDGPVQGIINFEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41208 (Experiment 1)	41208	69.477	751.385803	2+	2+	1500.757257052	0	-0.13573958659832613								100.0	Confident
1313	P54577	LASAAYPDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17157 (Experiment 1)	17157	39.802	560.286926	2+	2+	1118.56078909158	0	-1.3296965838594184								98.95287958115183	Confident
1314	Q86UX7	AGDALWLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36953 (Experiment 1)	36953	63.873	451.248047	2+	2+	900.48175092524	0	-0.23253154951547766								92.40837696335078	Confident
1315	P06733	YISPDQLADLYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44021 (Experiment 1)	44021	74.179	713.367126	2+	2+	1424.7187462849604	0	0.6678062507948368								100.0	Confident
1316	Q13200	FGGSGSQVDSAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11283 (Experiment 1)	11283	30.994	584.274292	2+	2+	1166.5316142216202	0	2.0682492685998004								100.0	Confident
1317	P11142, P54652	STAGDTHLGGEDFDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19010 (Experiment 1)	19010	42.304	564.579468	3+	3+	1690.7183053439803	0	-1.0218476734609847								100.0	Confident
1318	P50395	TDDYLDQPCYETINR	Phosphorylation of Y(10)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34253 (Experiment 1)	34253	60.656	661.600037	3+	3+	1981.7764876442402	0	0.9038476648437785	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 9.625675058248767)	Phosphorylation of Y (10: 99.82547993019197)		0	Y10-{Y4 Y10}	1	100.0	Confident
1319	P34897	AMADALLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32499 (Experiment 1)	32499	58.628	495.257599	2+	2+	988.5011660404803	0	-0.5259624800901388								99.46091644204851	Confident
1320	Q9Y2X3	YGLIYHASLVGQTSPK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34172 (Experiment 1)	34172	60.558	605.301941	3+	3+	1812.8811508433105	0	1.5654780483942712	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 4.524769842115505)	Phosphorylation of Y (5: 0.0)		0	Y5-{Y1 Y5}	1	100.0	Confident
1321	P35579	KVIQYLAYVASSHK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33584 (Experiment 1)	33584	59.867	562.959412	3+	3+	1685.8542078194807	0	1.3019191669173429	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 12.279802919763496)	Phosphorylation of Y (5: 19.87075928917609)		0	Y5-{Y5 Y8}	1	100.0	Confident
1322	P37235, P84074	IYANFFPYGDASK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45690 (Experiment 1)	45690	78.082	786.843567	2+	2+	1571.6697610947404	0	1.7919551020362248	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 15.4045583914898)	Phosphorylation of Y (2: 87.33631115830069)		0	Y2-{Y2 Y8}	1	100.0	Confident
1323	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33135 (Experiment 1)	33135	59.351	622.26532	3+	3+	1863.7750310922602	0	-0.4823731575672334	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 13.489623952122926)	Phosphorylation of Y (6: 82.27263574122212)		0	Y6-{Y6 Y11}	1	100.0	Confident
1324	P63010, Q10567	YNDPIYVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24439 (Experiment 1)	24439	49.256	506.2612	2+	2+	1010.5072969667403	0	0.5432965577412189								99.19354838709677	Confident
1325	P37802	IQASTMAFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23855 (Experiment 1)	23855	48.531	498.763275	2+	2+	995.5110024481903	0	0.9970854184616174								100.0	Confident
1326	P61204, P84077, P84085	DAVLLVFANK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45345 (Experiment 1)	45345	77.309	545.318298	2+	2+	1088.6229954253204	0	-0.8732130540460171								99.1891891891892	Confident
1327	O43809	YIQQTKPLTLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20793 (Experiment 1)	20793	44.465	497.283539	3+	3+	1488.8300280694402	0	-0.831496686415371								92.14285714285715	Doubtful
1328	P45880	YQLDPTASISAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29768 (Experiment 1)	29768	55.46	647.338928	2+	2+	1292.6612314088402	0	1.6001361582059765								100.0	Confident
1329	P17844	NFYQEHPDLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21659 (Experiment 1)	21659	45.74	463.889313	3+	3+	1388.6473126802002	0	-0.8644875421452931								96.71052631578947	Confident
1330	P11142	LSKEDIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10643 (Experiment 1)	10643	29.849	495.265808	2+	2+	988.5189242796002	0	-1.8790008283319828								99.46091644204851	Confident
1331	Q02878	YYPTEDVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22664 (Experiment 1)	22664	47.048	570.777649	2+	2+	1138.5294889633	1	6.927628382097525								100.0	Doubtful
1332	Q07666	KDDEENYLDLFSHK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36489 (Experiment 1)	36489	63.321	611.595947	3+	3+	1831.7665745835404	0	-0.3068386387309492	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1333	P62805	DNIQGITKPAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21052 (Experiment 1)	21052	44.792	663.381348	2+	2+	1324.74629844548	0	1.3903190570205592								100.0	Confident
1334	P08238, Q58FF7	IDIIPNPQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33372 (Experiment 1)	33372	59.622	597.829102	2+	2+	1193.6404363946103	0	2.6886282366426335								99.45799457994579	Confident
1335	P38919	EQIYDVYR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29969 (Experiment 1)	29969	55.693	583.249023	2+	2+	1164.4852548003503	0	-1.5102736946974018	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 12.680432057035638)	Phosphorylation of Y (4: 82.72251308900525)		0	Y7-{Y4 Y7}	1	100.0	Confident
1336	Q5EBM0	AVLDLVDQCPK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35555 (Experiment 1)	35555	62.162	629.329895	2+	2+	1256.6434731697202	0	1.4014105650570519								100.0	Confident
1337	P61978	NLPLPPPPPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30830 (Experiment 1)	30830	56.686	597.853271	2+	2+	1193.6920780446499	0	-0.07441480359954439								97.8319783197832	Confident
1338	Q9NTK5	LKPEYDIMCK	Phosphorylation of Y(5)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24619 (Experiment 1)	24619	49.465	688.803101	2+	2+	1375.5917110981802	0	-0.045028689283752116	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.72826086956522	Confident
1339	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19772 (Experiment 1)	19772	43.254	636.765869	2+	2+	1271.5183458337801	0	-0.9114545886447922	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1340	Q9BZW8	NHSPSFNSTIYEVIGK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43026 (Experiment 1)	43026	72.485	624.9552	3+	3+	1871.8454936105804	0	-0.9190042384284923	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.30191972076788)	Y11	1		0	99.27536231884058	Confident
1341	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	LAVNMVPFPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42485 (Experiment 1)	42485	71.463	572.320923	2+	2+	1142.6270352599402	0	0.22522896105043858								100.0	Confident
1342	Q8NBJ5	SLYHSVEWRPAEEPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26613 (Experiment 1)	26613	51.778	645.963501	3+	3+	1934.8676260374905	0	0.5405685398246814	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1343	Q9Y277	VCNYGLTFTQK	Phosphorylation of Y(4)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32054 (Experiment 1)	32054	58.118	705.810364	2+	2+	1409.6050526632	0	0.7951173046130933	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1344	P23528	AVLFCLSEDKK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31528 (Experiment 1)	31528	57.504	437.235413	3+	3+	1308.6747732980004	0	7.3464408947329805								100.0	Doubtful
1345	Q86XP3	KSEYTQPTPIQCQGVPVALSGR	Phosphorylation of Y(4)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33216 (Experiment 1)	33216	59.442	832.738159	3+	3+	2495.1879741816906	0	1.8707067223003355	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1346	Q15717	FGGPVHHQAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5356 (Experiment 1)	5356	18.863	411.879578	3+	3+	1232.6162873354403	0	0.4995508921160568								100.0	Confident
1347	P13010	TWTVVDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26328 (Experiment 1)	26328	51.452	460.24826	2+	2+	918.4810822189004	0	0.9612728642486813								99.45799457994579	Confident
1348	P11310	NTYYASIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20922 (Experiment 1)	20922	44.616	515.764893	2+	2+	1029.5131106231704	0	2.0575727442824396								95.13513513513514	Confident
1349	P63244	YTVQDESHSEWVSCVR		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28411 (Experiment 1)	28411	53.891	661.295471	3+	3+	1980.8635896786805	0	0.500997121190031								100.0	Confident
1350	P07900	NPDDITNEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35422 (Experiment 1)	35422	62.011	957.382263	2+	2+	1912.7404194053506	0	4.989495347018389	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 14: 0.0)	Phosphorylation of Y (10: 12.416287163502725)		0	Y10-{Y10 Y14}	1	100.0	Doubtful
1351	P52272	GCAVVEFK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22890 (Experiment 1)	22890	47.312	455.227325	2+	2+	908.4425885352002	0	-2.7365031374381705								100.0	Confident
1352	P55263	AGHYAASIIIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26329 (Experiment 1)	26329	51.453	626.317688	2+	2+	1250.61727202941	0	2.8348608864784928	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.70759289176091)	Y4	1		0	99.72826086956522	Confident
1353	P07737	DSPSVWAAVPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35648 (Experiment 1)	35648	62.272	607.313782	2+	2+	1212.6138872936003	0	-0.7213952806970688								97.289972899729	Confident
1354	Q15046	RGDIIGVQGNPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14933 (Experiment 1)	14933	36.715	437.577301	3+	3+	1309.71024728993	0	-0.13231212153085925								99.24812030075188	Confident
1355	P08238	HLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30415 (Experiment 1)	30415	56.208	594.988525	3+	3+	1781.94243205273	0	0.7358953130764845								100.0	Confident
1356	Q13242	GSPHYFSPFRPY	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40024 (Experiment 1)	40024	67.768	767.830627	2+	2+	1533.6442150532403	0	1.6188577746041202	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 18.007917952031534)	Phosphorylation of Y (5: 96.68411867364746)		0	Y12-{Y5 Y12}	1	99.23076923076923	Confident
1357	P62854, Q5JNZ5	LHYCVSCAIHSK	Phosphorylation of Y(3)	Carbamidomethylation of C(4, 7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15103 (Experiment 1)	15103	37.01	518.891357	3+	3+	1553.6520199389604	0	0.1423937350375415	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1358	P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0	FDSDVGEYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22121 (Experiment 1)	22121	46.381	544.238159	2+	2+	1086.4618033263002	0	-0.03514998205964023								100.0	Confident
1359	Q9BUR5	VDELSLYSVPEGQSK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36587 (Experiment 1)	36587	63.432	865.897217	2+	2+	1729.7811620185205	0	-0.7396670020982415	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1360	P26640	DPGVITYDLPTPPGEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41475 (Experiment 1)	41475	69.864	889.921082	2+	2+	1777.8175475272403	0	5.654207007974865	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.86914378029078)	Y7	1		0	98.91598915989161	Doubtful
1361	O00148, Q13838	ELAFQISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32865 (Experiment 1)	32865	59.044	468.263153	2+	2+	934.5123823471802	0	-0.6719302781362197								99.73753280839895	Confident
1362	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20264 (Experiment 1)	20264	43.858	713.291809	2+	2+	1424.5666150733405	0	1.717387759080821	Phosphorylation of Y (4: Doubtfull, 9: Doubtfull)		Phosphorylation of Y (4: 64.45862165757454, 9: 67.34064364954418)		0	Y4-{Y4}, Y9-{Y9}	2	98.6449864498645	Confident
1363	P62269	KADIDLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11508 (Experiment 1)	11508	31.329	452.261017	2+	2+	902.5072969667401	0	0.20353254700354476								99.73118279569893	Confident
1364	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27159 (Experiment 1)	27159	52.411	528.261597	2+	2+	1054.5100129962104	0	-1.298530936920847	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.60383944153578)	Y7	1		0	98.91304347826086	Confident
1365	O43390, O60506	GFCFLEYEDHK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39018 (Experiment 1)	39018	66.38	482.212372	3+	3+	1443.6129013174304	0	1.6488489339501977								100.0	Confident
1366	Q16658	LSCFAQTVSPAEK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25298 (Experiment 1)	25298	50.254	719.354614	2+	2+	1436.6969652945604	0	-1.5918606027707864								99.72972972972973	Confident
1367	P09651	SSGPYGGGGQYFAKPR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20538 (Experiment 1)	20538	44.172	570.253723	3+	3+	1707.7406346192204	0	-0.7569839082731123	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 15.816076247225412)	Phosphorylation of Y (11: 0.0)		0	Y11-{Y5 Y11}	1	100.0	Confident
1368	P23588	GLNISAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24442 (Experiment 1)	24442	49.26	415.247833	2+	2+	828.48175092524	0	-0.7680453976099542								98.94736842105263	Confident
1369	P28066	GVNTFSPEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18934 (Experiment 1)	18934	42.214	532.262695	2+	2+	1062.50942222506	0	1.3290835611783793								99.72972972972973	Confident
1370	O15460	RLFCRYHHGNR	Phosphorylation of Y(6)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27151 (Experiment 1)	27151	52.402	798.870789	2+	2+	1594.7088980818103	1	9.251537425586527	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 91.44851657940663)	Y6	1		0	92.11956521739131	Doubtful
1371	P00338	RVHPVSTMIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10689 (Experiment 1)	10689	29.926	389.89386	3+	3+	1166.6593980173802	0	0.30143442120390224								99.37888198757764	Confident
1372	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14284 (Experiment 1)	14284	35.715	600.78595	2+	2+	1199.5587540937802	0	-1.1709875678683621	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	99.72826086956522	Confident
1373	P08238	NPDDITQEEYGEFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37657 (Experiment 1)	37657	64.723	924.403076	2+	2+	1846.7897389487405	0	1.0061192759315183								100.0	Confident
1374	P37837	LLGELLQDNAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38597 (Experiment 1)	38597	65.865	607.340027	2+	2+	1212.6714021697203	0	-4.858130877137739								100.0	Doubtful
1375	P16401	KATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24389 (Experiment 1)	24389	49.198	670.893127	2+	2+	1339.7711162109902	0	0.4358783964123977								100.0	Confident
1376	P26639	VNTPTTTVYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17156 (Experiment 1)	17156	39.801	576.306396	2+	2+	1150.5982372294602	0	0.001593696998501894								91.08108108108108	Confident
1377	P54819	NLETPLCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22347 (Experiment 1)	22347	46.666	487.752655	2+	2+	973.4902670036101	0	0.5023683696197705								92.40837696335078	Confident
1378	P62249	GGGHVAQIYAIR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22223 (Experiment 1)	22223	46.51	661.324158	2+	2+	1320.6339847227102	0	-0.1675852110747807	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
1379	Q13263	DHQYQFLEDAVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37337 (Experiment 1)	37337	64.327	534.23053	3+	3+	1599.6718863530605	0	-1.3263629072237368	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1380	P16070	YGFIEGHVVIPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36069 (Experiment 1)	36069	62.802	462.922302	3+	3+	1385.7455701694903	0	-0.3554014346631157								100.0	Confident
1381	P31939	HVSPAGAAVGIPLSEDEAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28233 (Experiment 1)	28233	53.685	616.654297	3+	3+	1846.9424916223804	0	-0.7730002141970149								100.0	Confident
1382	P49354	NYHAWQHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7922 (Experiment 1)	7922	24.279	596.247253	2+	2+	1190.4770901584902	0	2.4007781540547266	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1383	P22626	GGNFGFGDSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25639 (Experiment 1)	25639	50.659	507.225037	2+	2+	1012.4362572847999	0	-0.7257310225902115								100.0	Confident
1384	P07900	NPDDITNEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35852 (Experiment 1)	35852	62.527	957.377869	2+	2+	1912.7404194053506	0	0.399874154322035	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 5.979331440136033)	Phosphorylation of Y (10: 0.16155088852988692)		0	Y10-{Y10 Y14}	1	100.0	Confident
1385	B0I1T2	LLYNSTDPTLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29955 (Experiment 1)	29955	55.677	646.849609	2+	2+	1291.6772158261504	0	5.758126012203421								99.45799457994579	Doubtful
1386	P49327	FDASFFGVHPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39019 (Experiment 1)	39019	66.381	417.877014	3+	3+	1250.6084079903403	0	0.6418234018477539								96.99248120300751	Confident
1387	P11142	MVNHFIAEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32549 (Experiment 1)	32549	58.687	618.316589	2+	2+	1234.6168644990605	0	1.4236799183395221								96.24664879356568	Confident
1388	P40939	FGELVMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30877 (Experiment 1)	30877	56.74	462.746429	2+	2+	923.4786396907502	0	-0.36156330146040067								99.45652173913044	Confident
1389	P61247	LIPDSIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23326 (Experiment 1)	23326	47.844	421.752838	2+	2+	841.4909186266102	0	0.2423692231519605								99.21875	Confident
1390	A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65	EDAANNYAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8455 (Experiment 1)	8455	25.473	512.229736	2+	2+	1022.4417365880602	0	3.106504736680156								100.0	Confident
1391	P31153	FVIGGPQGDAGLTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34616 (Experiment 1)	34616	61.076	722.880798	2+	2+	1443.7470267214699	0	0.011305395214362248								100.0	Confident
1392	Q9Y277	SCSGVEFSTSGHAYTDTGK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20437 (Experiment 1)	20437	44.059	664.291077	3+	3+	1989.8374345004906	0	7.008572720699928								100.0	Doubtful
1393	Q07020	TNSTFNQVVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28856 (Experiment 1)	28856	54.412	625.840637	2+	2+	1249.6666511424503	0	0.05586400544002634								99.45652173913044	Confident
1394	P20700	IESLSSQLSNLQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36471 (Experiment 1)	36471	63.298	723.892395	2+	2+	1445.7725727629702	0	-1.6132873078813668								97.86096256684492	Confident
1395	P18754	VPELFANR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32114 (Experiment 1)	32114	58.187	473.262207	2+	2+	944.5079656730802	0	2.002480932671219								99.72826086956522	Confident
1396	P08238, Q58FF7	RAPFDLFENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39185 (Experiment 1)	39185	66.597	412.884064	3+	3+	1235.6298717109105	0	0.3963088680593794								100.0	Confident
1397	O75964	TPALVNAAVTYSKPR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28754 (Experiment 1)	28754	54.294	834.430115	2+	2+	1666.8443714117707	0	0.7823636774377868	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
1398	Q02790	LYANMFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35366 (Experiment 1)	35366	61.946	522.253784	2+	2+	1042.4906013567802	0	2.3108642267039308								99.73890339425587	Confident
1399	P33991	THIDVIHYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17938 (Experiment 1)	17938	40.863	385.208832	3+	3+	1152.6039913162401	0	0.5843442675289472								100.0	Confident
1400	P54819	AVLLGPPGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25459 (Experiment 1)	25459	50.447	490.301239	2+	2+	978.5862159937801	0	1.742883189715914								99.45652173913044	Confident
1401	P78527	LYSLALHPNAFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35193 (Experiment 1)	35193	61.743	458.591675	3+	3+	1372.7503211967605	0	2.0893014895009387								99.37888198757764	Confident
1402	P04080	SQVVAGTNYFIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34340 (Experiment 1)	34340	60.757	663.85614	2+	2+	1325.6979512707303	0	-0.16886513742331105								100.0	Confident
1403	P40939	DATLTALDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26995 (Experiment 1)	26995	52.22	488.258942	2+	2+	974.5032742154601	0	0.05821800110428726								91.37466307277629	Confident
1404	P10809	VTDALNATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13394 (Experiment 1)	13394	34.312	480.759308	2+	2+	959.5036085686302	0	0.4726876350972865								100.0	Confident
1405	P11940, Q13310	SLGYAYVNFQQPADAER	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40760 (Experiment 1)	40760	68.835	670.298706	3+	3+	2007.8727709875805	0	0.7546949418760559	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 6: 0.0)	Phosphorylation of Y (4: 0.0)		0	Y4-{Y4 Y6}	1	99.43502824858757	Confident
1406	Q9UKK9	TTYMDPTGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14767 (Experiment 1)	14767	36.442	547.217163	2+	2+	1092.41987766247	0	-0.09557090972006006	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1407	P31146	HVFGQPAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7887 (Experiment 1)	7887	24.211	442.242554	2+	2+	882.4711862415402	0	-0.7136069426276906								96.48648648648648	Confident
1408	Q9BQ04, Q9BWF3	NYGFVHIEDK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28250 (Experiment 1)	28250	53.705	651.279846	2+	2+	1300.5489176860704	0	-2.9009102279371857	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1409	P22314	DNPGVVTCLDEAR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30313 (Experiment 1)	30313	56.092	723.337158	2+	2+	1444.6616424150002	0	-1.2990803541839593								100.0	Confident
1410	P55060	LLQAFLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40281 (Experiment 1)	40281	68.147	495.294128	2+	2+	988.5705659296402	0	3.166953224028635								97.289972899729	Confident
1411	Q8TEQ6	DGHYAVAAK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6601 (Experiment 1)	6601	21.285	506.217896	3+	2+	1010.4222606209705	0	-1.0090057777118406	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.38449111470113)	Y4	1		0	98.91304347826086	Confident
1412	P46777	DIICQIAYAR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39842 (Experiment 1)	39842	67.512	611.81604	2+	2+	1221.6175927750503	0	-0.053699696094360934								100.0	Confident
1413	Q15397	EAVVYLAHTHDGAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18011 (Experiment 1)	18011	40.986	540.250854	3+	3+	1617.7300699355203	0	0.40886211153068275	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1414	P61353	VYNYNHLMPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25897 (Experiment 1)	25897	50.953	469.899475	3+	3+	1406.6765046335	0	0.06452874482610198								100.0	Confident
1415	Q96L92	NSTTDQVYQAIAAK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31207 (Experiment 1)	31207	57.13	795.364075	2+	2+	1588.7134168118705	0	0.11331573260497184	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
1416	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23368 (Experiment 1)	23368	47.898	420.23468	3+	3+	1257.68296991293	0	-0.6022927543636957								92.3076923076923	Doubtful
1417	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33300 (Experiment 1)	33300	59.539	616.269226	2+	2+	1230.5209716027305	0	2.375155593582758	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 22.587430602603124)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
1418	P26640	LHEEGIIYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20623 (Experiment 1)	20623	44.27	605.285156	2+	2+	1208.55908844695	0	-2.750250344365587	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 96.50959860383944)	Y8	1		0	99.48849104859335	Confident
1419	Q12931	NIYYLCAPNR	Phosphorylation of Y(3)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35125 (Experiment 1)	35125	61.665	682.296997	2+	2+	1362.5791722685303	0	0.19698012721888802	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.9693053311793215)		0	Y3-{Y3 Y4}	1	100.0	Confident
1420	P49327	VVEVLAGHGHLYSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20831 (Experiment 1)	20831	44.511	512.947083	3+	3+	1535.8208603680703	0	-0.9362675703584109								100.0	Confident
1421	P47756	SGSGTMNLGGSLTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26709 (Experiment 1)	26709	51.887	669.327209	2+	2+	1336.6405130476	0	-0.48405391395176955								100.0	Confident
1422	P09651, P22626, P51991, Q32P51	LTDCVVMR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21647 (Experiment 1)	21647	45.725	497.246796	2+	2+	992.4783224209202	0	0.7206139668321604								100.0	Confident
1423	Q969H8	GAEIEYAMAYSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37259 (Experiment 1)	37259	64.234	706.793335	2+	2+	1411.5730838285804	0	-0.6839068052494266	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 5.038813678679345)	Phosphorylation of Y (6: 29.37503257074366)		0	Y6-{Y6 Y10}	1	96.2059620596206	Confident
1424	P17096	KQPPVSPGTALVGSQKEPSEVPTPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22858 (Experiment 1)	22858	47.275	640.350464	4+	4+	2557.375167096881	0	-0.9436090018026219								70.0	Doubtful
1425	P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3	DVNAAIATIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30746 (Experiment 1)	30746	56.588	508.29248	2+	2+	1014.5709598524604	0	-0.5437674227700746								100.0	Confident
1426	Q15029	IAVEPVNPSELPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34101 (Experiment 1)	34101	60.475	696.890564	2+	2+	1391.7660308305503	0	0.3904745351887932								96.19565217391303	Confident
1427	O14745	SVDPDSPAEASGLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21305 (Experiment 1)	21305	45.159	700.836731	2+	2+	1399.6579369335502	0	0.6935520477406762								99.7289972899729	Confident
1428	Q69YN4	SEYIEPAKR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10097 (Experiment 1)	10097	28.811	586.770386	2+	2+	1171.5274539655004	0	-1.0522836994531548	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	99.1869918699187	Confident
1429	A4D263	AYEDVPWDKMLPPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10913 (Experiment 1)	10913	30.354	590.602844	3+	3+	1767.79430998486	1	-6.1904919727934065	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.60383944153578)	Y2	1		0	96.71052631578947	Doubtful
1430	P22234	SWLPQNCTLVDMK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42880 (Experiment 1)	42880	72.221	796.383789	2+	2+	1590.7534346248603	0	-0.257136310959076								95.28795811518324	Confident
1431	P27797	HEQNIDCGGGYVK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12941 (Experiment 1)	12941	33.648	492.889801	3+	3+	1475.6463267040301	0	0.8432558235737236								100.0	Confident
1432	Q02790	GEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39184 (Experiment 1)	39184	66.595	707.014038	3+	3+	2118.0187069452804	0	0.7438114719652961	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 11.768653196251055)	Phosphorylation of Y (7: 89.87783595113437)		0	Y7-{Y7 Y12}	1	96.71052631578947	Confident
1433	P14324	LKEVLEYNAIGGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28666 (Experiment 1)	28666	54.188	505.260193	3+	3+	1512.7589104523101	0	-0.10611874251051674	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.28057553956835	Confident
1434	Q7KZ85	DHYQDPVPGITPSSSSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25941 (Experiment 1)	25941	51.002	641.614929	3+	3+	1921.82073541472	0	1.154476155271719	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.30191972076788)	Y3	1		0	98.7012987012987	Confident
1435	P51991	SSGSPYGGGYGSGGGSGGYGSR	Phosphorylation of Y(19)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20359 (Experiment 1)	20359	43.962	995.887085	2+	2+	1989.7490270264398	0	5.316916145347736	Phosphorylation of Y (19: Doubtfull)	Phosphorylation of Y (19: 9.135067184765218)	Phosphorylation of Y (6: 23.93014925737439)		0	Y19-{Y6 Y10 Y19}	1	100.0	Doubtful
1436	P52565	IDKTDYMVGSYGPR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26391 (Experiment 1)	26391	51.524	561.247803	3+	3+	1680.7218733205902	0	-0.1744452115538039	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 7.797340754347356)	Phosphorylation of Y (6: 100.0)		0	Y6-{Y6 Y11}	1	100.0	Confident
1437	P78527	ELLNPVVEFVSHPSTTCR		Carbamidomethylation of C(17)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45038 (Experiment 1)	45038	76.653	695.688049	3+	3+	2084.036074737391	0	2.991226146730922								99.37888198757764	Confident
1438	P08238	KHLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24787 (Experiment 1)	24787	49.661	478.516937	4+	4+	1910.0373950667304	0	0.6515270085429654								100.0	Doubtful
1439	Q8WX92	ELYSQLGEK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21566 (Experiment 1)	21566	45.581	573.75769	2+	2+	1145.5005705113203	0	0.22357444387061898	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 95.81151832460732)	Y3	1		0	99.22077922077922	Confident
1440	P14649, P60660	ILYSQCGDVMR	Phosphorylation of Y(3)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26610 (Experiment 1)	26610	51.775	711.300598	2+	2+	1420.58802270007	0	-0.9697955829297841	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
1441	O00116	EYVDPNNIFGNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41971 (Experiment 1)	41971	70.651	759.325012	2+	2+	1516.6347725683504	0	0.4599468842187935	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1442	Q13625	KPQTVAASSIYSMYTQQQAPGK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32626 (Experiment 1)	32626	58.773	822.058044	3+	3+	2463.1505260438107	0	0.72036966476339	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 3.117461394557014)	Phosphorylation of Y (11: 0.17452006980802792)		0	Y14-{Y11 Y14}	1	100.0	Confident
1443	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13150 (Experiment 1)	13150	33.938	600.786926	2+	2+	1199.5587540937802	0	0.45354918628356355	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
1444	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29926 (Experiment 1)	29926	55.642	528.261963	2+	2+	1054.5100129962104	0	-0.6056932845122232	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	99.46091644204851	Confident
1445	Q16881	KVVYENAYGQFIGPHR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26130 (Experiment 1)	26130	51.225	653.31665	3+	3+	1956.9247469907903	0	1.7212758828343941	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 9.440360040453784)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y4 Y8}	1	100.0	Confident
1446	Q9H4A4	KKPFVYTQGQAVLNR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23015 (Experiment 1)	23015	47.466	610.654663	3+	3+	1827.9396687789404	1	-0.47189259698452185	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
1447	P19623	YQDILVFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42482 (Experiment 1)	42482	71.46	527.289673	2+	2+	1052.5654805492002	0	-0.6519019917930354								99.01477832512316	Confident
1448	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44455 (Experiment 1)	44455	75.298	612.981079	3+	3+	1835.9222873793005	0	-0.47841569976887044	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
1449	P61158, Q9P1U1	LSEELSGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14260 (Experiment 1)	14260	35.684	474.243042	2+	2+	946.4719740871801	0	-0.4670818102383712								100.0	Confident
1450	Q92499	HYYEVSCHDQGLCR	Phosphorylation of Y(2, 3)	Carbamidomethylation of C(7, 13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16473 (Experiment 1)	16473	38.926	661.903198	3+	3+	1982.6841981734	0	1.7960494223813037	Phosphorylation of Y (2: Very Confident, 3: Very Confident)		Phosphorylation of Y (2: 97.4151857835218, 3: 97.4151857835218)	Y2, Y3	2		0	98.54014598540147	Confident
1451	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44553 (Experiment 1)	44553	75.549	612.981995	3+	3+	1835.9222873793005	0	1.015920084994036	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
1452	P40939	DGPGFYTTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23241 (Experiment 1)	23241	47.733	507.237793	2+	2+	1012.4614094034803	0	-0.3709669998532144								99.73474801061008	Confident
1453	P32942	IALETSLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26204 (Experiment 1)	26204	51.309	481.281647	2+	2+	960.5491617787202	0	-0.4370748010091097								95.23809523809523	Confident
1454	P30086	LYTLVLTDPDAPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42393 (Experiment 1)	42393	71.329	780.920654	2+	2+	1559.8195229553903	0	4.6305245206362295								100.0	Confident
1455	O94903	ILSLCPEIK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36545 (Experiment 1)	36545	63.385	536.80481	2+	2+	1071.5998174525903	0	-4.424667129570309								99.73333333333333	Doubtful
1456	P11021	VLEDSDLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17060 (Experiment 1)	17060	39.667	459.742401	2+	2+	917.4705771048502	0	-0.35676321834007646								99.72972972972973	Confident
1457	Q13813	EELYQNLTR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25974 (Experiment 1)	25974	51.04	623.278809	2+	2+	1244.5438323056303	0	-0.6154860161272447	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
1458	P00519	TNLFSALIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46533 (Experiment 1)	46533	79.619	503.800049	2+	2+	1005.5858816406103	0	-0.33403541985708374								99.50372208436724	Confident
1459	A6NHR9	EAIYSGYIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30698 (Experiment 1)	30698	56.534	576.259705	2+	2+	1150.5059902449302	0	-0.9832176623333749	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 7: 0.0)	Phosphorylation of Y (4: 98.42931937172776)		0	Y4-{Y4 Y7}	1	99.73544973544973	Confident
1460	P0C0S8, P20671, Q16777, Q6FI13, Q96KK5, Q99878, Q9BTM1	NDEELNKLLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32577 (Experiment 1)	32577	58.718	424.89801	3+	3+	1271.67213044571	0	0.05503584086530519								98.7012987012987	Confident
1461	P13639	QFAEMYVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29010 (Experiment 1)	29010	54.587	543.767822	2+	2+	1085.5215671318904	0	-0.43774685336221536								100.0	Confident
1462	P37802	GPAYGLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16562 (Experiment 1)	16562	39.035	410.719391	2+	2+	819.4239016959502	0	0.3985331146217005								100.0	Confident
1463	Q9Y277	LSQNNFALGYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30929 (Experiment 1)	30929	56.802	627.827576	2+	2+	1253.6404363946103	0	0.1295513233714144								100.0	Confident
1464	P22626	NYYEQWGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26705 (Experiment 1)	26705	51.882	584.231873	2+	2+	1166.4433899883702	0	4.966441488723251	Phosphorylation of Y (3: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (3: 5.597456644577062)		0	Y3-{Y2 Y3}	1	92.43243243243244	Doubtful
1465	Q13422	SGLIYLTNHIAPHAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35552 (Experiment 1)	35552	62.159	581.630249	3+	3+	1741.8665038386803	0	1.383332582321765	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1466	Q9NWQ8	ENDYESISDLQQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30697 (Experiment 1)	30697	56.533	867.353638	2+	2+	1732.6941379192701	0	-0.8156141152958293	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
1467	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17907 (Experiment 1)	17907	40.82	532.894531	3+	3+	1595.6617155921804	0	0.03002932255685624	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1468	P12004	AEDNADTLALVFEAPNQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46040 (Experiment 1)	46040	78.811	1038.000366	2+	2+	2073.9854786331707	0	0.3373955657324388								98.91598915989161	Doubtful
1469	P38159, Q96E39	DSYESYGNSR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12113 (Experiment 1)	12113	32.296	629.224731	2+	2+	1256.4346757794704	0	0.18537649371788345	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 8.577578916590632)	Phosphorylation of Y (3: 77.46707916864986)		0	Y3-{Y3 Y6}	1	100.0	Confident
1470	P23193	EMLAAALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29831 (Experiment 1)	29831	55.532	437.744171	2+	2+	873.4742230166501	0	-0.4956662905423541								98.6737400530504	Confident
1471	P78527	MYAALGDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21615 (Experiment 1)	21615	45.671	523.224915	2+	2+	1044.4351338037902	0	0.13690346269680348	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.12277867528272)	Y2	1		0	95.67567567567568	Confident
1472	P50990	AVDDGVNTFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20782 (Experiment 1)	20782	44.451	533.264343	2+	2+	1064.5138388991604	0	0.2758175195293865								100.0	Confident
1473	P04843	ALTSEIALLQSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41976 (Experiment 1)	41976	70.661	651.375244	2+	2+	1300.7350650554401	0	0.6678266672279474								100.0	Confident
1474	P63000	HHCPNTPIILVGTK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20830 (Experiment 1)	20830	44.51	529.620422	3+	3+	1585.8398815604903	0	-0.28005012848655425								100.0	Confident
1475	P63244	TNHIGHTGYLNTVTVSPDGSLCASGGK		Carbamidomethylation of C(22)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28092 (Experiment 1)	28092	53.507	686.582764	4+	4+	2742.3031414387706	0	-0.43378073430493697								100.0	Doubtful
1476	E9PAV3, Q13765	SPASDTYIVFGEAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40183 (Experiment 1)	40183	67.99	522.570313	3+	3+	1563.6858050817007	1	-0.032118268498523325	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.33507853403141)	Y7	1		0	92.90780141843972	Doubtful
1477	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34175 (Experiment 1)	34175	60.562	932.89563	2+	2+	1863.7750310922602	0	0.8982653403100836	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 47.636544895360416)		0	Y6-{Y6 Y11}	1	91.05691056910568	Confident
1478	O75526, P38159, Q8N7X1, Q96E39	GFAFVTFESPADAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45514 (Experiment 1)	45514	77.692	743.865479	2+	2+	1485.7139952576904	0	1.6197905783954076								92.73182957393485	Confident
1479	P35579	VIQYLAYVASSHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35883 (Experiment 1)	35883	62.565	493.604736	3+	3+	1477.7929142847306	0	-0.3617502924144102								100.0	Confident
1480	P34932	EDIYAVEIVGGATR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42720 (Experiment 1)	42720	71.932	786.870544	2+	2+	1571.7232532195803	0	2.0853834626612477	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.68411867364746)	Y4	1		0	96.53333333333333	Confident
1481	P62277	DSHGVAQVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.36 min, Period: 1, Cycle(s): 6826 (Experiment 1)	6826	21.843	484.750244	2+	2+	967.4835418303903	0	2.4685308807756425								91.30434782608697	Confident
1482	Q12765	VECTYISIDQVPR	Phosphorylation of Y(5)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38449 (Experiment 1)	38449	65.691	830.376587	2+	2+	1658.7375233847301	0	0.6609545526469471	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1483	P49915	ELGLPEELVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42088 (Experiment 1)	42088	70.854	621.341431	2+	2+	1240.6663167892802	0	1.6032089525451227								99.45652173913044	Confident
1484	P78527	LQETLSAADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17587 (Experiment 1)	17587	40.406	552.289307	2+	2+	1102.5618517207402	0	2.0001745704599405								99.72972972972973	Confident
1485	P31153	YLDEDTIYHLQPSGR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34916 (Experiment 1)	34916	61.424	629.615173	3+	3+	1885.8247581660003	0	-0.565724311913292	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 11.523774852758244)	Phosphorylation of Y (8: 0.6980802792321117)		0	Y8-{Y1 Y8}	1	100.0	Confident
1486	Q99798	SQFTITPGSEQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30823 (Experiment 1)	30823	56.678	732.379456	2+	2+	1462.7416069878602	0	1.8788646130620865								99.45799457994579	Confident
1487	O00571, O15523	SPILVATAVAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34100 (Experiment 1)	34100	60.474	584.857544	2+	2+	1167.6975573479103	0	2.5456849076549486								99.73190348525469	Confident
1488	P62917	ASGNYATVISHNPETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19053 (Experiment 1)	19053	42.355	563.613953	3+	3+	1687.8165628332702	0	2.0503238569563944								99.24812030075188	Confident
1489	P22090, P62701, Q8TD47	GIPHLVTHDAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14365 (Experiment 1)	14365	35.84	405.890808	3+	3+	1214.65200413782	0	-1.157566350918755								100.0	Confident
1490	Q9Y490	VLVQNAAGSQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11379 (Experiment 1)	11379	31.143	622.336853	2+	2+	1242.6568147347405	0	1.8786739184085082								99.72826086956522	Confident
1491	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	QVHPDTGISSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7949 (Experiment 1)	7949	24.341	584.802063	2+	2+	1167.5884008217504	0	1.0022586055025593								99.73474801061008	Confident
1492	P13796	IGNFSTDIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26569 (Experiment 1)	26569	51.727	497.764923	2+	2+	993.5131106231702	0	2.1922476750946145								99.75247524752476	Confident
1493	P52272	MGPAMGPALGAGIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35122 (Experiment 1)	35122	61.662	714.361511	2+	2+	1426.70609050962	0	1.6648158383134755								99.7289972899729	Confident
1494	Q07955	TKDIEDVFYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32974 (Experiment 1)	32974	59.167	669.30365	2+	2+	1336.5951991721504	0	-1.8318302035223684	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
1495	P10809	GANPVEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16044 (Experiment 1)	16044	38.4	428.237976	2+	2+	854.4610154806601	0	0.4478653334135036								100.0	Confident
1496	P00558, P07205	VDFNVPMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32452 (Experiment 1)	32452	58.575	475.244659	2+	2+	948.4738886634802	0	0.922055290221956								100.0	Confident
1497	P16949	SKESVPEFPLSPPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32355 (Experiment 1)	32355	58.461	514.611389	3+	3+	1540.8137092989602	0	-0.8885009844941986								100.0	Confident
1498	P50991	TDMDNQIVVSDYAQMDR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36393 (Experiment 1)	36393	63.21	1040.9198	2+	2+	2079.8278715941	0	-1.3567442430629986	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 89.87783595113437)	Y12	1		0	91.08108108108108	Doubtful
1499	Q9Y2W1	SPLQSVVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25850 (Experiment 1)	25850	50.9	492.795471	2+	2+	983.5763795860703	0	0.00961890528999626								94.03794037940379	Confident
1500	P62805	KTVTAMDVVYALK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45694 (Experiment 1)	45694	78.092	506.925934	3+	3+	1517.7564679241605	0	-0.32570467195275027	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.83844911147011)	Y10	1		0	100.0	Confident
1501	P22626	GGSDGYGSGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4409 (Experiment 1)	4409	17.032	496.677704	2+	2+	991.3396531958201	0	1.2099113775910937	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	99.7289972899729	Confident
1502	P15531, P22392	TFIAIKPDGVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25977 (Experiment 1)	25977	51.044	448.925995	3+	3+	1343.7561348531901	0	0.015404450049045705								100.0	Confident
1503	P09429	KHPDASVNFSEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23577 (Experiment 1)	23577	48.162	531.594055	3+	3+	1591.7630707084304	0	-1.715033084552714								100.0	Confident
1504	O14602, P47813	ELVFKEDGQEYAQVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35729 (Experiment 1)	35729	62.379	632.664673	3+	3+	1894.9676437410606	0	2.395091525874514								96.71052631578947	Confident
1505	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23573 (Experiment 1)	23573	48.156	420.235016	3+	3+	1257.68296991293	0	0.19726000405482413								99.28057553956835	Confident
1506	P52209	VDDFLANEAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29080 (Experiment 1)	29080	54.67	561.277405	2+	2+	1120.5400536470004	0	0.1812111182598556								100.0	Confident
1507	P07237	KSNFAEALAAHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17689 (Experiment 1)	17689	40.543	429.565979	3+	3+	1285.6778845324905	0	-1.378857236556458								99.27007299270073	Confident
1508	Q02790	RGEAHLAVNDFELAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29401 (Experiment 1)	29401	55.037	566.625977	3+	3+	1696.8645160852006	0	-4.950028370423403								100.0	Doubtful
1509	P54886	GPVGLEGLLTTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43968 (Experiment 1)	43968	74.08	592.848816	2+	2+	1183.6812385774301	0	1.5522438040365178								99.45799457994579	Confident
1510	P26599	DYGNSPLHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12895 (Experiment 1)	12895	33.59	569.737976	2+	2+	1137.4604370348402	0	0.8442761307914571	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1511	P07900, P08238	SLTNDWEDHLAVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35454 (Experiment 1)	35454	62.047	764.375549	2+	2+	1526.7365216074204	0	0.015345176727452548								100.0	Confident
1512	P02786	VEYHFLSPYVSPK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36541 (Experiment 1)	36541	63.379	823.387207	2+	2+	1644.7589104523104	0	0.5772585523116317	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 30.274027793080897)	Phosphorylation of Y (3: 99.19224555735056)		0	Y3-{Y3 Y9}	1	99.73190348525469	Confident
1513	P14618	GDYPLEAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28667 (Experiment 1)	28667	54.189	510.262726	2+	2+	1018.5083595959002	0	2.4884012349967906								99.45799457994579	Confident
1514	P27797	EQFLDGDGWTSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38326 (Experiment 1)	38326	65.542	705.817505	2+	2+	1409.6211575020102	0	-0.49618724518893886								100.0	Confident
1515	Q14203	ASEQIYGTPSSSPYECLR	Phosphorylation of Y(6)	Carbamidomethylation of C(16)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33803 (Experiment 1)	33803	60.116	1062.95166	2+	2+	2123.88710072238	0	0.7838292955371375	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 14: 0.0)	Phosphorylation of Y (6: 86.03839441535777)		0	Y6-{Y6 Y14}	1	95.67567567567568	Confident
1516	P00505	IGASFLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29687 (Experiment 1)	29687	55.366	446.256226	2+	2+	890.4974009893801	0	0.5580619887570237								99.72972972972973	Confident
1517	O14979	DLTEYLSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39093 (Experiment 1)	39093	66.478	538.736511	2+	2+	1075.4587056993403	0	-0.21961841059129308	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 90.92495636998254)	Y5	1		0	98.68421052631578	Confident
1518	P49327	HGLYLPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20352 (Experiment 1)	20352	43.955	478.770081	2+	2+	955.5239500903901	0	1.732542326713627								99.1891891891892	Confident
1519	O15371	GAVIATELK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22587 (Experiment 1)	22587	46.957	451.273956	2+	2+	900.5280324113203	0	5.90183238141681								99.46524064171123	Doubtful
1520	Q9BV40	NKTEDLEATSEHFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17583 (Experiment 1)	17583	40.398	550.265442	3+	3+	1647.7740293149507	0	0.28306626225834164								100.0	Confident
1521	O14979	KDLTEYLSR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30017 (Experiment 1)	30017	55.75	602.78418	2+	2+	1203.5536687133401	0	0.11476168102693672	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
1522	P26038	ESEAVEWQQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19969 (Experiment 1)	19969	43.509	617.290283	2+	2+	1232.5673310240004	0	-1.0675335849139351								96.52406417112299	Confident
1523	P00505	DAGMQLQGYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25378 (Experiment 1)	25378	50.347	569.768982	2+	2+	1137.52369239021	0	-0.24687528939214906								100.0	Confident
1524	Q4VC31	QLYESLMAAHASR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28335 (Experiment 1)	28335	53.8	519.569031	3+	3+	1555.6854282422205	0	-0.10562769608790554	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1525	P60660	EAFQLFDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41395 (Experiment 1)	41395	69.754	513.255005	2+	2+	1024.4977949122	0	-2.277464883098618								99.45799457994579	Confident
1526	P31948	TVDLKPDWGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26138 (Experiment 1)	26138	51.233	386.876892	3+	3+	1157.60807363717	0	0.6659852480854509								99.3006993006993	Confident
1527	P22626	IDTIEIITDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40188 (Experiment 1)	40188	67.996	594.827332	2+	2+	1187.6397676882702	0	0.28863687507722796								100.0	Confident
1528	P38159, Q96E39	DRDYSDHPSGGSYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8984 (Experiment 1)	8984	26.6	537.898132	3+	3+	1610.6709612287402	0	0.994842905170027								100.0	Confident
1529	P00505	EFSIYMTK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39266 (Experiment 1)	39266	66.712	549.732422	2+	2+	1097.4504495147603	0	-0.1441140773026592	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.74358974358975	Confident
1530	P29401	MPSLPSYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29688 (Experiment 1)	29688	55.367	461.738647	2+	2+	921.4629896266101	0	-0.2691567716133953								99.46666666666667	Confident
1531	O60234, P60983	LVQTAELTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17903 (Experiment 1)	17903	40.815	501.795227	2+	2+	1001.5757108797302	0	0.18950626841142582								100.0	Confident
1532	P62888	SLESINSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14179 (Experiment 1)	14179	35.571	453.238953	2+	2+	904.4614094034803	0	2.1441968419746975								92.56410256410257	Confident
1533	P42677, Q71UM5	LTEGCSFR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15882 (Experiment 1)	15882	38.183	485.22702	2+	2+	968.43856578392	0	0.9493322637275873								99.45799457994579	Confident
1534	Q9Y490, Q9Y4G6	SIAAATSALVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28331 (Experiment 1)	28331	53.796	516.307739	2+	2+	1030.6022599807404	0	-1.2927490119652327								99.7289972899729	Confident
1535	P62249	GPLQSVQVFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37894 (Experiment 1)	37894	65.005	594.330505	2+	2+	1186.6458561282202	0	0.505559158110906								100.0	Confident
1536	P18669	HGESAWNLENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20789 (Experiment 1)	20789	44.461	656.805664	2+	2+	1311.59561146051	0	0.8858075989765657								99.73045822102425	Confident
1537	Q9HCS7	RAAEIYGVTHTR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13327 (Experiment 1)	13327	34.202	485.237549	3+	3+	1452.68747684755	0	2.294930725269324	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 90.30694668820678)	Y6	1		0	92.51700680272108	Doubtful
1538	Q9Y285	VNLQMVYDSPLCR	Phosphorylation of Y(7)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43670 (Experiment 1)	43670	73.547	837.87384	2+	2+	1673.73066418248	0	1.4697245563369068	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	100.0	Confident
1539	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25374 (Experiment 1)	25374	50.341	757.295837	3+	3+	2268.8644082151895	0	0.5604965395222332	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 11.01847218721501)	Phosphorylation of Y (22: 0.0)		0	Y6-{Y6 Y11 Y22}	1	100.0	Confident
1540	P62851	AALQELLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37131 (Experiment 1)	37131	64.084	486.789703	2+	2+	971.5651461960301	0	-0.30108439438342266								100.0	Confident
1541	P25788	AVENSSTAIGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20400 (Experiment 1)	20400	44.009	609.32605	2+	2+	1216.6411646706001	0	-2.968520290010915								100.0	Confident
1542	Q9Y5B9	INFYCPGSALGR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38720 (Experiment 1)	38720	66.017	717.815491	2+	2+	1433.61628605324	0	0.09961692931653893	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 94.18416801292408)	Y4	1		0	99.1869918699187	Confident
1543	O75083	LYSILGTTLKDEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36710 (Experiment 1)	36710	63.58	513.286682	3+	3+	1536.8399240468004	0	-1.108831511895883								99.28057553956835	Confident
1544	P07900, P08238, Q14568, Q58FF7, Q58FF8	YESLTDPSKLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22305 (Experiment 1)	22305	46.615	513.92334	3+	3+	1538.7464175847801	0	1.1499878709880171								100.0	Confident
1545	P62805	TVTAMDVVYALKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46572 (Experiment 1)	46572	79.684	773.888977	2+	2+	1545.7626159337606	0	0.5072646314887383	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
1546	P10599, THIO_HUMAN	MIKPFFHSLSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28813 (Experiment 1)	28813	54.363	488.595184	3+	3+	1462.7642570087405	0	-0.3645887905526029								100.0	Confident
1547	Q9UBQ7	GDVVNQDDLYQALASGK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41399 (Experiment 1)	41399	69.758	624.951477	3+	3+	1871.8302374692603	0	1.260968982822776	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 98.60383944153578)	Y10	1		0	96.71052631578947	Confident
1548	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38519 (Experiment 1)	38519	65.775	621.324463	3+	3+	1860.9498991094704	0	0.8908343770614258	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
1549	Q9Y399	DCGEYAHTR	Phosphorylation of Y(5)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5633 (Experiment 1)	5633	19.32	594.710754	2+	2+	1187.4066872098203	0	0.22519906856406363	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1550	P30101	GFPTIYFSPANK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45742 (Experiment 1)	45742	78.189	711.329041	2+	2+	1420.6428180709106	0	0.4997657761176783	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1551	P23921	HPDYAILAAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22157 (Experiment 1)	22157	46.43	603.787781	2+	2+	1205.5594228001203	0	1.3135975827965778	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.90575916230367)	Y4	1		0	97.8891820580475	Confident
1552	P22626	GGNFGFGDSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25420 (Experiment 1)	25420	50.399	507.226379	2+	2+	1012.4362572847999	0	1.9200355074467286								100.0	Confident
1553	Q9NY33	VILGSEAAQQHPEEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19389 (Experiment 1)	19389	42.77	588.64209	3+	3+	1761.9009611635706	1	0.0705969656188442								100.0	Confident
1554	P49327	GYAVLGGER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21563 (Experiment 1)	21563	45.576	501.226074	2+	2+	1000.43791068511	0	-0.3148465841142629	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	99.73190348525469	Confident
1555	P78527	TYSVVPMTSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26800 (Experiment 1)	26800	51.993	610.771301	2+	2+	1219.5308250937803	0	-2.272553647546269	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
1556	O43707, P12814, Q08043	ALDFIASK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32023 (Experiment 1)	32023	58.084	432.74588	2+	2+	863.4752685624703	0	2.239776664746361								96.53333333333333	Confident
1557	P49588	AVFDETYPDPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35457 (Experiment 1)	35457	62.05	704.843994	2+	2+	1407.6670450652703	0	4.5329392925126015								100.0	Confident
1558	P27824	TPYTIMFGPDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41443 (Experiment 1)	41443	69.816	635.313232	2+	2+	1268.6111104122801	0	0.6301258653531615								100.0	Confident
1559	P22695	VTSEELHYFVQNHFTSAR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41472 (Experiment 1)	41472	69.858	749.00769	3+	3+	2244.000096759021	0	0.5090473438732034	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
1560	P30101	GFPTIYFSPANK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45845 (Experiment 1)	45845	78.441	711.328552	2+	2+	1420.6428180709106	0	-0.1876801402109557	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 95.6369982547993)	Y6	1		0	95.25065963060686	Confident
1561	P46778	VYNVTQHAVGIVVNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30418 (Experiment 1)	30418	56.213	574.298218	3+	3+	1719.8709205127805	0	1.10516849269539	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1562	Q5JS13	YLKSVRYIEELQKFVEDDNYK	Phosphorylation of Y(1, 7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17303 (Experiment 1)	17303	40.018	947.430054	3+	3+	2838.2918437210706	1	-9.455471094548855	Phosphorylation of Y (1: Confident, 7: Confident)		Phosphorylation of Y (1: 98.25479930191972, 7: 98.25479930191972)	Y1, Y7	2		0	94.02985074626866	Doubtful
1563	O75083	LYSILGTTLKDEGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39163 (Experiment 1)	39163	66.565	539.943176	3+	3+	1616.8062545675505	0	0.891472390003619	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	97.74436090225565	Confident
1564	P05388, Q8NHW5	AGAIAPCEVTVPAQNTGLGPEK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32774 (Experiment 1)	32774	58.943	727.372253	3+	3+	2179.0943178895004	0	0.28032882851509827								100.0	Confident
1565	P05198	AGLNCSTENMPIK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24716 (Experiment 1)	24716	49.579	717.840637	2+	2+	1433.6642852672903	0	1.6966183666905172								91.44385026737967	Confident
1566	Q9UBB6	LQAGEETASHYR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10920 (Experiment 1)	10920	30.363	481.207916	3+	3+	1440.6034724400704	0	-1.0763461296423626	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.82547993019197)	Y11	1		0	100.0	Confident
1567	P06733	LMIEMDGTENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30802 (Experiment 1)	30802	56.654	640.796204	2+	2+	1279.5788243078302	0	-0.7562784512039056								99.46091644204851	Confident
1568	A8MUU1, Q01469	TQTVCNFTDGALVQHQEWDGK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36179 (Experiment 1)	36179	62.954	812.041626	3+	3+	2433.1019224510806	0	0.462270638801307								100.0	Confident
1569	P47756	KLEVEANNAFDQYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28878 (Experiment 1)	28878	54.438	566.281982	3+	3+	1695.8216482137104	0	1.452980151573615								100.0	Confident
1570	Q9UGN4	EELHYASVVFDSNTNR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35830 (Experiment 1)	35830	62.5	654.287109	3+	3+	1959.8363854788604	0	1.5855045871877995	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.60383944153578)	Y5	1		0	99.28057553956835	Confident
1571	P50914	VAYVSFGPHAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24129 (Experiment 1)	24129	48.874	438.207611	3+	3+	1311.6012876121004	0	-0.21604103309227293	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1572	P62158	VFDKDGNGYISAAELR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32538 (Experiment 1)	32538	58.675	612.612976	3+	3+	1833.8298435464403	1	-8.764880100704294	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	99.28057553956835	Doubtful
1573	Q10471	NFYYAAVPSAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35132 (Experiment 1)	35132	61.673	669.796875	2+	2+	1337.5805521675204	0	-1.0115751687909962	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.34904013961605584)		0	Y3-{Y3 Y4}	1	100.0	Confident
1574	O00148, Q13838	GSYVSIHSSGFR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22489 (Experiment 1)	22489	46.841	688.800903	2+	2+	1375.5921794803803	0	-3.5760670216276553	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.70759289176091)	Y3	1		0	99.72826086956522	Confident
1575	P62158	VFDKDGNGYISAAELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32026 (Experiment 1)	32026	58.087	585.629883	3+	3+	1753.8635130256903	0	2.4512549393978302								100.0	Confident
1576	P37802	TLMNLGGLAVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42714 (Experiment 1)	42714	71.924	608.346985	2+	2+	1214.6805273847801	0	-0.9125691573877822								100.0	Confident
1577	P14174	PMFIVNTNVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38561 (Experiment 1)	38561	65.823	644.348389	2+	2+	1286.6805273847801	0	1.317364845759778								100.0	Confident
1578	Q04917	AVTELNEPLSNEDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26243 (Experiment 1)	26243	51.355	794.390015	2+	2+	1585.7583792508103	1	2.3573759757901653								97.84366576819407	Confident
1579	P15880	ATFDAISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20486 (Experiment 1)	20486	44.113	426.726013	2+	2+	851.4388830537503	0	-1.652096429256651								100.0	Confident
1580	P78527	QITQSALLAEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31030 (Experiment 1)	31030	56.921	650.864624	2+	2+	1299.7146639640303	0	0.023893099500146578								100.0	Confident
1581	Q9H4A4	KKPFVYTQGQAVLNR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22910 (Experiment 1)	22910	47.335	610.319702	3+	3+	1827.9396687789404	0	-1.3065153903135893	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82578397212544)	Y6	1		0	99.24812030075188	Confident
1582	P31146	VSQTTWDSGFCAVNPK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36509 (Experiment 1)	36509	63.344	898.914185	2+	2+	1795.8199339615503	0	-3.4023683598728125								100.0	Confident
1583	Q99832	TATQLAVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11417 (Experiment 1)	11417	31.197	473.271332	2+	2+	944.5290950404803	0	-1.0395443532067166								100.0	Confident
1584	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39325 (Experiment 1)	39325	66.8	621.323303	3+	3+	1860.9498991094704	0	-0.9761467293866825	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
1585	P22234	TKEVYELLDSPGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32012 (Experiment 1)	32012	58.072	520.250793	3+	3+	1557.73275527412	0	-1.4132103647242442	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.51534733441034)	Y5	1		0	100.0	Confident
1586	P50402	DSAYQSITHYRPVSASR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24614 (Experiment 1)	24614	49.459	505.232635	4+	4+	2016.9054680981903	0	-1.9960890819060084	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 4.888743976284718)	Phosphorylation of Y (4: 99.82547993019197)		0	Y4-{Y4 Y10}	1	100.0	Doubtful
1587	Q15717	SLFSSIGEVESAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42633 (Experiment 1)	42633	71.766	677.350708	2+	2+	1352.6823607762406	0	3.3234667399339655								99.73118279569893	Confident
1588	Q08211	VFDPVPVGVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35213 (Experiment 1)	35213	61.768	579.331299	2+	2+	1156.6492101731603	0	-1.0055607344266968								99.19354838709677	Confident
1589	P15104	DIVEAHYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14823 (Experiment 1)	14823	36.521	541.736633	2+	2+	1081.4593744056801	0	-0.610387834564132	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1590	P63244	YWLCAATGPSIK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39032 (Experiment 1)	39032	66.396	683.844116	2+	2+	1365.6751076511703	0	-1.0445240873053547								98.91598915989161	Confident
1591	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	HQGVMVGMGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13133 (Experiment 1)	13133	33.915	391.195282	3+	3+	1170.56378338038	0	0.19872362225391138								100.0	Confident
1592	Q00839	GYFEYIEENKYSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35344 (Experiment 1)	35344	61.921	566.597656	3+	3+	1696.7733010389602	0	-1.2721764860821525								100.0	Confident
1593	P60709, P62736, P63261, P63267, P68032, P68133	EITALAPSTMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27674 (Experiment 1)	27674	53.024	581.312378	2+	2+	1160.6111104122804	0	-0.7804282437462948								100.0	Confident
1594	Q07666	GDSKKDDEENYLDLFSHK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31792 (Experiment 1)	31792	57.821	555.742859	4+	4+	2218.9419727462105	0	0.16076976641430374	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.82547993019197)	Y11	1		0	100.0	Doubtful
1595	P16885	HYCAIADAK	Phosphorylation of Y(2)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9622 (Experiment 1)	9622	27.895	564.730347	2+	2+	1127.4470954698202	0	-0.8450073940629989	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.54604200323102)	Y2	1		0	98.93899204244032	Confident
1596	P62249	GGGHVAQIYAIR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22425 (Experiment 1)	22425	46.759	441.218811	3+	3+	1320.6339847227102	0	0.4675511920551823	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.67689822294022)	Y9	1		0	100.0	Confident
1597	P11940, Q4VXU2, Q5JQF8, Q9H361	FSPAGPILSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41193 (Experiment 1)	41193	69.459	579.337158	2+	2+	1156.6604435632	0	-0.5873060402148889								99.73262032085562	Confident
1598	P33316	ARPAEVGGMQLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18596 (Experiment 1)	18596	41.79	428.900269	3+	3+	1283.67683898667	0	1.6620930343134859								100.0	Confident
1599	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28828 (Experiment 1)	28828	54.381	523.25293	2+	2+	1044.4892775516303	0	1.939328539898035	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 84.32956381260097)	Y7	1		0	92.97297297297298	Confident
1600	P23284	HYGPGWVSMANAGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29708 (Experiment 1)	29708	55.39	518.889893	3+	3+	1553.6486488106805	0	-0.5134105950317518	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1601	P29401	HQPTAIIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9695 (Experiment 1)	9695	28.027	489.790314	2+	2+	977.5658149023702	0	0.2655871988156202								99.46091644204851	Confident
1602	P61978	TDYNASVSVPDSSGPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23446 (Experiment 1)	23446	47.993	890.901123	2+	2+	1779.7911359310704	0	-1.9322335291947799								100.0	Confident
1603	P62244	IVVNLTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27205 (Experiment 1)	27205	52.463	436.271454	2+	2+	870.5287011176601	0	-0.39660072145191183								100.0	Confident
1604	Q07020	ILTFDQLALDSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45859 (Experiment 1)	45859	78.476	730.904663	2+	2+	1459.7922455783903	0	1.7290164392378824								100.0	Confident
1605	P00558, P07205	VDFNVPMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32224 (Experiment 1)	32224	58.311	475.243835	2+	2+	948.4738886634802	0	-0.8117900969733699								99.45652173913044	Confident
1606	Q96ST3	RLDDQESPVYAAQQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20965 (Experiment 1)	20965	44.676	619.282471	3+	3+	1854.8261551483306	0	-0.30764022211869285	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.83844911147011)	Y10	1		0	100.0	Confident
1607	Q00610	ENPYYDSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13845 (Experiment 1)	13845	35.011	562.208435	2+	2+	1122.40191909921	0	0.35393217342518984	Phosphorylation of Y (5: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.5235602094240838)		0	Y5-{Y4 Y5}	1	99.73190348525469	Confident
1608	P06733	IGAEVYHNLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18204 (Experiment 1)	18204	41.272	612.294678	2+	2+	1222.5747385110903	0	0.05271586638321874	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1609	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31410 (Experiment 1)	31410	57.365	630.798218	2+	2+	1259.5798834611805	0	1.5849825725812665	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1610	P59044	KYFYKYFR	Phosphorylation of Y(6, 4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36812 (Experiment 1)	36812	63.702	687.782898	2+	2+	1373.5610762004303	0	-7.148377629044672	Phosphorylation of Y (4: Doubtfull, 6: Confident)		Phosphorylation of Y (4: 82.98429319371728, 6: 99.65095986038395)	Y6	1	Y4-{Y4}	1	99.7289972899729	Doubtful
1611	Q9GZT3	SINQPVAFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30104 (Experiment 1)	30104	55.851	565.818909	2+	2+	1129.6243924076505	0	-0.9962022598612122								100.0	Confident
1612	P08238	YHTSQSGDEMTSLSEYVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34443 (Experiment 1)	34443	60.878	726.32074	3+	3+	2175.9378768177503	0	1.1536614496895656								100.0	Confident
1613	P31150, P50395	LYSESLAR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18677 (Experiment 1)	18677	41.895	509.733948	2+	2+	1017.4532263960803	0	0.11444235726715772	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
1614	P24752	NEQDAYAINSYTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26522 (Experiment 1)	26522	51.675	772.853638	2+	2+	1543.6902996909903	0	1.5678124976742596								99.46091644204851	Confident
1615	Q14019	YDGSTIVPGEQGAEYQHFIQQCTDDVR	Phosphorylation of Y(15)	Carbamidomethylation of C(22)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38315 (Experiment 1)	38315	65.524	1065.123901	3+	3+	3192.3495727550207	0	0.09415010181039658	Phosphorylation of Y (15: Doubtfull)	Phosphorylation of Y (15: 5.152885441528807)	Phosphorylation of Y (15: 71.9022687609075)		0	Y15-{Y1 Y15}	1	100.0	Confident
1616	P16401	NGLSLAALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34969 (Experiment 1)	34969	61.488	443.771545	2+	2+	885.5283667644903	0	0.19188016937553065								100.0	Confident
1617	P50914	VAYVSFGPHAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24072 (Experiment 1)	24072	48.801	656.808411	2+	2+	1311.6012876121004	0	0.747139494795841	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1618	B0I1T2	LISVEPRPEQPEPDFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29884 (Experiment 1)	29884	55.594	636.998535	3+	3+	1907.9741261038303	0	-0.18341444694538525								91.72932330827068	Doubtful
1619	P55769	NVPYVFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36650 (Experiment 1)	36650	63.508	497.280182	2+	2+	992.5443511818003	0	1.4678714049259736								91.30434782608697	Confident
1620	O00567	YPASTVQILGAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32855 (Experiment 1)	32855	59.032	689.380005	2+	2+	1375.7347307022703	1	5.350412003809549								99.21259842519686	Doubtful
1621	P23193	DTYVSSFPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28497 (Experiment 1)	28497	53.99	576.242737	2+	2+	1150.4696047362102	0	1.1421676879494784	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
1622	Q9BZK7	HQEPVYSVAFSPDGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29398 (Experiment 1)	29398	55.032	590.261108	3+	3+	1767.7617639866203	0	-0.15212872836862212	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1623	P78527	MYAALGDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21968 (Experiment 1)	21968	46.188	523.225647	2+	2+	1044.4351338037902	0	1.535919601261615	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.70759289176091)	Y2	1		0	99.21465968586386	Confident
1624	P62314	NREPVQLETLSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32143 (Experiment 1)	32143	58.22	518.958862	3+	3+	1553.8525544191702	0	1.414488167132205								100.0	Confident
1625	O43707, P12814	TINEVENQILTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35996 (Experiment 1)	35996	62.708	715.387024	2+	2+	1428.757257052	0	1.5642007761929917								99.73045822102425	Confident
1626	O94868	EYAQGMQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7984 (Experiment 1)	7984	24.42	517.703918	2+	2+	1033.3939972678002	0	-0.6897774062976018	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 94.9389179755672)	Y2	1		0	94.02173913043478	Confident
1627	P31146	ADQCYEDVR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14280 (Experiment 1)	14280	35.71	578.239197	2+	2+	1154.4662370837402	0	-2.071817694744428								100.0	Confident
1628	Q15365	IANPVEGSSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14362 (Experiment 1)	14362	35.835	543.780396	2+	2+	1085.54653600977	0	-0.273036059538574								99.73890339425587	Confident
1629	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36432 (Experiment 1)	36432	63.255	643.259033	3+	3+	1926.7560694694905	0	-0.4144880749419135	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 14: 0.0)	Phosphorylation of Y (10: 81.50087260034904)		0	Y10-{Y10 Y14}	1	98.7012987012987	Confident
1630	P62937, PPIA_HUMAN	VSFELFADK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44011 (Experiment 1)	44011	74.156	528.274658	2+	2+	1054.5335117145803	0	1.1843775380551278								99.72826086956522	Confident
1631	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18941 (Experiment 1)	18941	42.222	636.765137	2+	2+	1271.5183458337801	0	-2.061012641961416	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.73333333333333	Confident
1632	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33033 (Experiment 1)	33033	59.234	932.896912	2+	2+	1863.7750310922602	0	2.2724824664384866	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 7.2728660645085945)	Phosphorylation of Y (6: 2.10016155088853)		0	Y11-{Y6 Y11}	1	100.0	Confident
1633	O00116	EYVDPNNIFGNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41817 (Experiment 1)	41817	70.395	759.325867	2+	2+	1516.6347725683504	0	1.5859474501740323	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1634	P07195	SADTLWDIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37713 (Experiment 1)	37713	64.79	588.798584	2+	2+	1175.5822528121503	0	0.30762161023622564								100.0	Confident
1635	Q5JQS6	SETEYALLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31474 (Experiment 1)	31474	57.442	581.263977	2+	2+	1160.5114695481902	0	1.6614838276097794	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
1636	P49411	DKPHVNVGTIGHVDHGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11952 (Experiment 1)	11952	32.03	453.239563	4+	4+	1808.9281789709205	0	0.5334719352898726								100.0	Doubtful
1637	P26641	VLSAPPHFHFGQTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26075 (Experiment 1)	26075	51.16	569.96344	3+	3+	1706.8641221623802	0	2.5548120211632295								100.0	Confident
1638	Q8NBQ5	EDIYSSAK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10110 (Experiment 1)	10110	28.834	496.702118	2+	2+	991.3899574331804	0	-0.27618840206207956	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.47643979057592)	Y4	1		0	99.45652173913044	Confident
1639	GSTP1_HUMAN, P09211	ASCLYGQLPK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27624 (Experiment 1)	27624	52.965	568.791931	2+	2+	1135.56957995347	0	-0.23812488805989512								100.0	Confident
1640	P08708	IAGYVTHLMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25670 (Experiment 1)	25670	50.694	566.811279	2+	2+	1131.6110508426302	0	-2.6867567600743487								100.0	Confident
1641	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33563 (Experiment 1)	33563	59.843	977.537354	2+	2+	1953.0571274518006	0	1.5485951772027358								99.7289972899729	Confident
1642	Q9Y295	GQLPDYTSPVVLPYSR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43129 (Experiment 1)	43129	72.658	936.449524	2+	2+	1870.8866301465703	0	-1.1399855014825195	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 14: 0.0)	Phosphorylation of Y (6: 99.82547993019197)		0	Y6-{Y6 Y14}	1	100.0	Confident
1643	Q02543	SSGEIVYCGQVFEK	Phosphorylation of Y(7)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35789 (Experiment 1)	35789	62.452	561.575806	3+	3+	1681.7058889032805	0	-0.17825059410873484	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1644	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10382 (Experiment 1)	10382	29.352	607.758667	2+	2+	1213.5016331404804	0	0.9443937550895326	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1645	Q15056	TVATPLNQVANPNSAIFGGARPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38273 (Experiment 1)	38273	65.466	784.425659	3+	3+	2350.250575720451	0	1.9427751342813293								100.0	Confident
1646	Q96AE4	LLDQIVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28630 (Experiment 1)	28630	54.146	479.284637	2+	2+	956.5542471591605	0	0.49439040319121963								95.39295392953929	Confident
1647	P46778	VYNVTQHAVGIVVNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30443 (Experiment 1)	30443	56.241	860.944031	2+	2+	1719.8709205127805	0	1.5033250673789005	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	99.73753280839895	Confident
1648	P60866	TPVEPEVAIHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19370 (Experiment 1)	19370	42.748	624.342163	2+	2+	1246.6669854956203	0	2.2324112832474525								98.93899204244032	Confident
1649	P08238	KHLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24600 (Experiment 1)	24600	49.443	637.687622	3+	3+	1910.0373950667304	0	1.9035128589675827								100.0	Confident
1650	P30101	GFPTIYFSPANKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40585 (Experiment 1)	40585	68.592	517.253845	3+	3+	1548.7377810849107	0	1.2402144250083782	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1651	P23246	FAQHGTFEYEYSQR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24216 (Experiment 1)	24216	48.986	614.920959	3+	3+	1841.7410285420403	0	0.010330609063517517	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 8.110867614846923)	Phosphorylation of Y (11: 99.30191972076788)		0	Y11-{Y9 Y11}	1	98.7012987012987	Confident
1652	P62241	QWYESHYALPLGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39519 (Experiment 1)	39519	67.067	567.260071	3+	3+	1698.7555564073702	0	1.661317289406227	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 4.763690703687442)	Phosphorylation of Y (7: 0.17452006980802792)		0	Y7-{Y3 Y7}	1	100.0	Confident
1653	P49736	ESLVVNYEDLAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40899 (Experiment 1)	40899	69.026	740.376038	2+	2+	1477.7412726346902	1	-4.80106649466548								99.48051948051948	Doubtful
1654	P11310	NTYYASIAK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20465 (Experiment 1)	20465	44.09	555.749207	2+	2+	1109.4794411439204	0	3.9765599084455157	Phosphorylation of Y (4: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (4: 1.222860908724783)		0	Y4-{Y3 Y4}	1	100.0	Confident
1655	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31637 (Experiment 1)	31637	57.638	630.796631	2+	2+	1259.5798834611805	0	-0.9308814074586899	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1656	P68363, P68366, Q13748, Q71U36, Q9BQE3	LSVDYGKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11928 (Experiment 1)	11928	31.987	455.256378	2+	2+	908.4967322830403	0	1.615337843315274								99.20212765957447	Confident
1657	P38159	VEQATKPSFESGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12039 (Experiment 1)	12039	32.171	479.245209	3+	3+	1434.7103068595802	0	2.4279487782643225								100.0	Confident
1658	P62249	GPLQSVQVFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38103 (Experiment 1)	38103	65.262	594.331177	2+	2+	1186.6458561282202	0	1.636243742009927								100.0	Confident
1659	P78527	VCLDIIYK	Phosphorylation of Y(7)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40628 (Experiment 1)	40628	68.649	552.264038	2+	2+	1102.5133841244901	0	0.12579300271014876	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.70759289176091)	Y7	1		0	99.45799457994579	Confident
1660	O94905	VAQVAEITYGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23981 (Experiment 1)	23981	48.692	653.852539	2+	2+	1305.6928658902905	0	-1.7900211323798578								100.0	Confident
1661	O15264, P45983, P45984, P53778, P53779, Q15746, Q15759, Q16539, Q32MK0, Q86YV6, Q9H1R3	IIDFGLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41599 (Experiment 1)	41599	70.056	452.766266	2+	2+	903.5178020807903	0	0.1954492125955899								92.7807486631016	Confident
1662	Q9BUL8	VNLSAAQTLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24559 (Experiment 1)	24559	49.396	536.809204	2+	2+	1071.6036569630703	0	0.1845193233186024								98.91598915989161	Confident
1663	Q9Y2S6	GPLATGGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16583 (Experiment 1)	16583	39.061	407.244568	2+	2+	812.4756029156401	0	-1.2521320935576699								99.45799457994579	Confident
1664	Q9UFW8	TALYVTPLDR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36583 (Experiment 1)	36583	63.427	614.803284	2+	2+	1227.5900542220602	0	1.594694997220374	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
1665	Q8WXF1	AELDGTILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29190 (Experiment 1)	29190	54.795	480.274506	2+	2+	958.5335117145803	0	0.9862617297316802								92.93478260869566	Confident
1666	O00567	LAQFIGNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23682 (Experiment 1)	23682	48.294	459.761597	2+	2+	917.5083000262503	0	0.37088814565091455								96.19565217391303	Confident
1667	Q14103	IFVGGLSPDTPEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34150 (Experiment 1)	34150	60.533	744.88324	2+	2+	1487.7507746892304	0	0.7735293096689985								100.0	Confident
1668	Q96RP9	EYGCPCITGKPK	Phosphorylation of Y(2)	Carbamidomethylation of C(4, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14323 (Experiment 1)	14323	35.773	497.209869	3+	3+	1488.61423744791	0	-4.330713429059094	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Doubtful
1669	P52907	DVQDSLTVSNEAQTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24114 (Experiment 1)	24114	48.857	853.413757	2+	2+	1704.8166224029208	0	-2.1451076109595566								100.0	Confident
1670	Q9NR30	APQVLVLAPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33969 (Experiment 1)	33969	60.316	582.858215	2+	2+	1163.7026427283504	0	-0.6568162307567732								100.0	Confident
1671	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27635 (Experiment 1)	27635	52.978	609.259521	2+	2+	1216.5053215385904	0	-0.6831831240813536	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 14.38605341316958)	Phosphorylation of Y (3: 16.666666666666668)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
1672	P63244	TNHIGHTGYLNTVTVSPDGSLCASGGK		Carbamidomethylation of C(22)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28063 (Experiment 1)	28063	53.474	686.834839	4+	4+	2742.3031414387706	1	1.3668616332473038								100.0	Doubtful
1673	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19807 (Experiment 1)	19807	43.297	713.289246	2+	2+	1424.5666150733405	0	-1.8758182321018655	Phosphorylation of Y (4: Doubtfull, 9: Doubtfull)		Phosphorylation of Y (4: 77.48340228706721, 9: 81.67539267015707)		0	Y4-{Y4}, Y9-{Y9}	2	93.28165374677002	Confident
1674	P04350, P68371, Q3ZCM7	AVLVDLEPGTMDSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42080 (Experiment 1)	42080	70.84	801.413635	2+	2+	1600.8130576759604	0	-0.21250543870110938								99.7289972899729	Confident
1675	Q15843	EIEIDIEPTDKVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32562 (Experiment 1)	32562	58.702	562.625549	3+	3+	1684.8519452824803	0	1.7017368991758814								100.0	Confident
1676	P10412, P16402, P16403	KASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23658 (Experiment 1)	23658	48.262	442.925873	3+	3+	1325.7554661468505	0	0.24342131267173187								100.0	Confident
1677	P10809	VGEVIVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16259 (Experiment 1)	16259	38.668	422.76059	2+	2+	843.5065686907501	0	0.06904100258086406								100.0	Confident
1678	P62333	GCLLYGPPGTGK	Phosphorylation of Y(5)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30904 (Experiment 1)	30904	56.774	650.29425	2+	2+	1298.5730242589302	0	0.7095311856631261	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.86914378029078)	Y5	1		0	99.7289972899729	Confident
1679	HBA_HUMAN, P69905	MFLSFPTTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43311 (Experiment 1)	43311	72.994	536.279968	2+	2+	1070.5470536037403	0	-1.557521129023873								100.0	Confident
1680	Q7KZF4	DYVAPTANLDQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23298 (Experiment 1)	23298	47.809	707.815674	2+	2+	1413.6177255218804	0	-0.6572720323059217	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1681	P19338	KFGYVDFESAEDLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39674 (Experiment 1)	39674	67.286	592.949402	3+	3+	1775.8253961814705	0	0.5511536231315712								100.0	Confident
1682	Q14978	NKPGPYSSVPPPSAPPPKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11766 (Experiment 1)	11766	31.734	675.678162	3+	3+	2024.0132276420204	0	-0.28171316237206323	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.60383944153578)	Y6	1		0	96.71052631578947	Confident
1683	P29350	HKEDVYENLHTK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8584 (Experiment 1)	8584	25.746	531.576294	3+	3+	1591.7031864813405	0	2.4243165340717114	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.38219895287958)	Y6	1		0	92.14285714285715	Doubtful
1684	P43686	GVLMYGPPGCGK	Phosphorylation of Y(5)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30605 (Experiment 1)	30605	56.426	658.283447	2+	2+	1314.55018063937	0	1.6409576763338125	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	99.73045822102425	Confident
1685	P13010	YGSDIVPFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33993 (Experiment 1)	33993	60.347	556.78479	2+	2+	1111.5549754351503	0	0.04636551591293569								92.38845144356955	Confident
1686	Q14566	QNINLSAPIMSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35359 (Experiment 1)	35359	61.938	672.357971	2+	2+	1342.70271938134	0	-0.9892897128604743								99.5	Confident
1687	O00116	EYVDPNNIFGNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42111 (Experiment 1)	42111	70.908	759.323181	2+	2+	1516.6347725683504	0	-1.9514063746161396	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1688	P51149	FQSLGVAFYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41352 (Experiment 1)	41352	69.69	594.31488	2+	2+	1186.6134933707804	0	1.4417425205931198								91.30434782608697	Confident
1689	P55084	LAAAFAVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26282 (Experiment 1)	26282	51.398	453.263458	2+	2+	904.5130510535203	0	-0.7589257526423098								100.0	Confident
1690	O43390	LKDYAFVHFEDR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32446 (Experiment 1)	32446	58.568	540.581604	3+	3+	1618.7181082694906	0	3.0056175839293653	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.47643979057592)	Y4	1		0	99.24812030075188	Confident
1691	O14910, Q9HAP6, Q9NUP9	EQNSPIYISR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27750 (Experiment 1)	27750	53.114	643.792969	2+	2+	1285.57038140664	0	0.7794901205720912	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 91.97207678883072)	Y7	1		0	95.6639566395664	Confident
1692	P31930	NALVSHLDGTTPVCEDIGR		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32587 (Experiment 1)	32587	58.73	685.337646	3+	3+	2052.9898528209606	0	0.61078378788102								100.0	Confident
1693	P07900	NPDDITNEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36059 (Experiment 1)	36059	62.789	957.376648	2+	2+	1912.7404194053506	0	-0.875484852575124	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 14: 0.0)	Phosphorylation of Y (10: 26.957110844754812)		0	Y10-{Y10 Y14}	1	100.0	Confident
1694	P62805	TVTAMDVVYALKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42834 (Experiment 1)	42834	72.13	733.904846	2+	2+	1465.7962854130105	0	-0.7809907139891181								100.0	Confident
1695	P36578	MINTDLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19818 (Experiment 1)	19818	43.31	475.241791	2+	2+	948.4698659122	0	-0.8804413911372654								99.7289972899729	Confident
1696	Q00796	VAIEPGAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15774 (Experiment 1)	15774	38.016	455.262787	2+	2+	908.50796567308	0	3.3556482499562876								99.1869918699187	Confident
1697	Q96G03	DTYMLSSTVSSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28236 (Experiment 1)	28236	53.689	699.795654	2+	2+	1397.5785631318404	0	-1.2918507841655322	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	99.72826086956522	Confident
1698	P60866	TPVEPEVAIHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19320 (Experiment 1)	19320	42.69	416.562988	3+	3+	1246.6669854956203	0	0.11931285773423439								100.0	Confident
1699	P08134, P61586	EVFEMATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26952 (Experiment 1)	26952	52.173	491.736694	2+	2+	981.4589668753304	0	-0.13402389756749825								99.73118279569893	Confident
1700	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35841 (Experiment 1)	35841	62.516	964.386719	2+	2+	1926.7560694694905	0	1.4597883504552154	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 4.116630425851677)	Phosphorylation of Y (10: 36.65908251500619)		0	Y10-{Y10 Y14}	1	100.0	Confident
1701	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43752 (Experiment 1)	43752	73.686	597.635132	3+	3+	1789.88464239309	0	-0.600027688557416								92.14285714285715	Doubtful
1702	P46777	NSVTPDMMEEMYKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32273 (Experiment 1)	32273	58.367	568.255188	3+	3+	1701.7412152586505	0	1.4778246872421612								100.0	Confident
1703	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32132 (Experiment 1)	32132	58.206	616.268188	2+	2+	1230.5209716027305	0	0.6908228026320616	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 26.414230404338767)	Phosphorylation of Y (3: 83.0715532286213)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
1704	O75608	TLVNPANVTFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34944 (Experiment 1)	34944	61.46	602.34021	2+	2+	1202.6659228664603	0	-0.046319406374772096								100.0	Confident
1705	Q7L5N7	KHLDEYASIASSSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15499 (Experiment 1)	15499	37.61	539.250671	3+	3+	1614.7290668760104	0	0.6902938865438376	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1706	Q9UKM9	GYAFVQYSNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30520 (Experiment 1)	30520	56.33	707.294678	2+	2+	1412.5761950630704	0	-0.9840278515438698	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 30.191465881448934)	Phosphorylation of Y (2: 100.0)		0	Y2-{Y2 Y7}	1	100.0	Confident
1707	P27797	FYGDEEKDKGLQTSQDAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16360 (Experiment 1)	16360	38.792	522.497314	4+	4+	2085.9603265144906	0	-0.0843936032907737								100.0	Doubtful
1708	P07195	IVADKDYSVTANSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14088 (Experiment 1)	14088	35.424	504.262939	3+	3+	1509.7674873825306	0	-0.33037182444425817								100.0	Confident
1709	P23526	VADIGLAAWGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41433 (Experiment 1)	41433	69.803	564.811523	2+	2+	1127.6087423435101	0	-0.22067279896430217								99.7289972899729	Confident
1710	Q08170, Q13247	QAGEVTYADAHK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9032 (Experiment 1)	9032	26.689	457.198456	3+	3+	1368.5711096826305	0	1.77087302239142	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.30191972076788)	Y7	1		0	98.7012987012987	Confident
1711	Q8TCJ2	ESDYFTPQGEFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37696 (Experiment 1)	37696	64.77	778.310669	2+	2+	1554.6028037337305	0	2.557682289870505	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65156794425087)	Y4	1		0	99.72972972972973	Confident
1712	P50914	VAYVSFGPHAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23407 (Experiment 1)	23407	47.946	411.552094	3+	3+	1231.6349570913503	0	-0.40860892828658146								99.28057553956835	Confident
1713	P50990	AIADTGANVVVTGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23061 (Experiment 1)	23061	47.524	686.87616	2+	2+	1371.7357933314304	0	1.436749370719975								100.0	Confident
1714	P08670	SLYASSPGGVYATR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27786 (Experiment 1)	27786	53.157	754.84375	2+	2+	1507.6708237239004	0	1.406480123788371	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 6.913166293054822)	Phosphorylation of Y (3: 99.83844911147011)		0	Y3-{Y3 Y11}	1	100.0	Confident
1715	P51531, P51532	LTQVLNTHYVAPR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26339 (Experiment 1)	26339	51.465	796.404419	2+	2+	1590.7919419160903	0	1.4710828296128005	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
1716	P22090, P62701, Q8TD47	YALTGDEVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20659 (Experiment 1)	20659	44.31	498.256653	2+	2+	994.4971262058605	0	1.6325553925892988								99.73045822102425	Confident
1717	P27635	FNADEFEDMVAEKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40704 (Experiment 1)	40704	68.751	567.590698	3+	3+	1699.7511856953906	0	-0.540938703306552								100.0	Confident
1718	P09874	NREELGFRPEYSASQLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26025 (Experiment 1)	26025	51.102	506.760742	4+	4+	2023.0123025177004	0	0.7694046333083974								100.0	Doubtful
1719	P62263	TPGPGAQSALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13539 (Experiment 1)	13539	34.553	527.78595	2+	2+	1053.5567067706502	0	0.6065869259911841								100.0	Confident
1720	Q03252	SVFEEEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24360 (Experiment 1)	24360	49.164	497.745514	2+	2+	993.4767251144503	0	-0.2511805776197765								99.72826086956522	Confident
1721	P51991	SSGSPYGGGYGSGGGSGGYGSR	Phosphorylation of Y(19)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18047 (Experiment 1)	18047	41.045	995.881165	2+	2+	1989.7490270264398	0	-0.6275644742498097	Phosphorylation of Y (19: Doubtfull)	Phosphorylation of Y (19: 7.164095801608415)	Phosphorylation of Y (19: 2.6178010471204187)		0	Y19-{Y6 Y10 Y19}	1	100.0	Confident
1722	Q9P107	DYYQPLAAK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26740 (Experiment 1)	26740	51.924	574.754395	2+	2+	1147.4950912080603	0	-0.743048732769213	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 1.9197207678883073)		0	Y2-{Y2 Y3}	1	99.73544973544973	Confident
1723	P22626	EESGKPGAHVTVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5590 (Experiment 1)	5590	19.25	446.905365	3+	3+	1337.6939285194503	0	0.25141802933314256								100.0	Confident
1724	O75396	DLQQYQSQAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12641 (Experiment 1)	12641	33.17	644.782532	2+	2+	1287.5496459620604	0	0.6708501338058854	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.33507853403141)	Y5	1		0	96.19565217391303	Confident
1725	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25146 (Experiment 1)	25146	50.077	757.296082	3+	3+	2268.8644082151895	0	0.8840162596914077	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 20.167409345742612)	Phosphorylation of Y (11: 0.0)		0	Y6-{Y6 Y11 Y22}	1	100.0	Confident
1726	P61586	IGAFGYMECSAK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34958 (Experiment 1)	34958	61.477	667.299377	2+	2+	1332.5842440414403	0	-0.03220073664556638								100.0	Confident
1727	P04350, P07437, P68371	YLTVAAVFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43442 (Experiment 1)	43442	73.175	520.300354	2+	2+	1038.5862159937803	0	-0.058550220571265944								99.46236559139786	Confident
1728	Q96ST3	KTQYEEHIYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11128 (Experiment 1)	11128	30.751	482.885864	3+	3+	1445.6340442923604	0	1.1861389822847554	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 11.018447226771594)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y4 Y9}	1	100.0	Confident
1729	P61978	NTDEMVELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25674 (Experiment 1)	25674	50.698	553.760132	2+	2+	1105.5073736197303	0	-1.5011471236597371								100.0	Confident
1730	P06753, P07951, P09493, P67936	IQLVEEELDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35158 (Experiment 1)	35158	61.704	622.332214	2+	2+	1242.6455813447003	0	3.449714148741553								100.0	Confident
1731	P31943	YGDGGSTFQSTTGHCVHMR		Carbamidomethylation of C(15)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17488 (Experiment 1)	17488	40.276	525.22699	4+	4+	2096.8792568261606	0	-0.19167585604292037								100.0	Doubtful
1732	P47755, P52907	LLLNNDNLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40096 (Experiment 1)	40096	67.858	599.350403	2+	2+	1196.6877209402003	0	-1.2245524650785176								99.72972972972973	Confident
1733	P23396	ELAEDGYSGVEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26885 (Experiment 1)	26885	52.093	712.341125	2+	2+	1422.6626879608202	0	3.5159581496196393								100.0	Confident
1734	Q8TCJ2	ESDYFTPQGEFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38283 (Experiment 1)	38283	65.478	778.811829	2+	2+	1554.6028037337305	1	1.8928832012557042	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.38219895287958)	Y4	1		0	97.289972899729	Confident
1735	O14744	YSQYQQAIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21693 (Experiment 1)	21693	45.805	686.303284	2+	2+	1370.5907824980504	0	0.8979772215162737	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 22.008726686274073)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y1 Y4 Y9}	1	99.73333333333333	Confident
1736	Q15181, Q9H2U2	YVANIFPYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40141 (Experiment 1)	40141	67.918	557.800537	2+	2+	1113.5858816406103	0	0.5731673685917282								99.45652173913044	Confident
1737	P07741	AAIGLLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30210 (Experiment 1)	30210	55.976	392.755859	2+	2+	783.4966727133901	0	0.6267930614539748								99.1869918699187	Confident
1738	P62906	AVDIPHMDIEALKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35016 (Experiment 1)	35016	61.543	527.288452	3+	3+	1578.8439638814204	0	-0.2764342324600437								98.49624060150376	Confident
1739	P07900, P08238, Q14568, Q58FF8, Q58FG1	TLTLVDTGIGMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39822 (Experiment 1)	39822	67.486	675.371155	2+	2+	1348.7272027936804	0	0.41034690253023337								100.0	Confident
1740	Q14687	VDTSVHYNIPELQSSSR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30817 (Experiment 1)	30817	56.67	671.304932	3+	3+	2010.9047993918505	0	-5.875483305733369	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.51534733441034)	Y7	1		0	100.0	Doubtful
1741	P35579	HSQAVEELAEQLEQTKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34580 (Experiment 1)	34580	61.036	666.008911	3+	3+	1995.0021317568205	0	1.387292043302484								91.7910447761194	Doubtful
1742	P11142	HWPFMVVNDAGRPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34270 (Experiment 1)	34270	60.676	551.948975	3+	3+	1652.8245658495202	0	0.319927044838193								100.0	Confident
1743	P00505	IGASFLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29677 (Experiment 1)	29677	55.353	446.76062	2+	2+	890.4974009893801	1	6.64555714904599								98.72773536895674	Doubtful
1744	Q9NWU5	RPAEIYHCR	Phosphorylation of Y(6)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7020 (Experiment 1)	7020	22.327	427.85556	3+	3+	1280.5485408465902	0	-2.874986141499645	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.47643979057592)	Y6	1		0	99.24812030075188	Confident
1745	P49327	VFTTVGSAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17146 (Experiment 1)	17146	39.788	519.776794	2+	2+	1037.5393253710104	0	-0.279258863419013								96.24664879356568	Confident
1746	P0CB38, P11940, Q13310	EFTNVYIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30289 (Experiment 1)	30289	56.065	507.268799	2+	2+	1012.5229470308802	0	0.09663072666735836								97.289972899729	Confident
1747	P36578	QPYAVSELAGHQTSAESWGTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32632 (Experiment 1)	32632	58.78	778.033691	3+	3+	2331.0879866391	0	-3.745770433092465								100.0	Confident
1748	P45880	VNNSSLIGVGYTQTLRPGVK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33365 (Experiment 1)	33365	59.616	728.377869	3+	3+	2182.1147325884403	0	-1.352313135827288	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 98.08027923211169)	Y11	1		0	99.24812030075188	Confident
1749	O43776	IGALEGYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22816 (Experiment 1)	22816	47.227	439.740417	2+	2+	877.4657665079301	0	0.5850710181708977								100.0	Confident
1750	P11940	EFSPFGTITSAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41285 (Experiment 1)	41285	69.579	642.827881	2+	2+	1283.6397676882705	0	1.121124148507902								100.0	Confident
1751	Q9BZZ5	ELPQFATGENLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37196 (Experiment 1)	37196	64.16	736.382568	2+	2+	1470.7466923683003	0	2.6417710867778226								100.0	Confident
1752	Q92820	FFNVLTTNTDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39928 (Experiment 1)	39928	67.643	678.844849	2+	2+	1355.6721304457103	0	2.220409688301606								98.91891891891892	Confident
1753	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28363 (Experiment 1)	28363	53.834	573.632629	3+	3+	1717.87474641573	0	0.761919020695218								91.7910447761194	Doubtful
1754	P60866	LIDLHSPSEIVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31686 (Experiment 1)	31686	57.692	450.925415	3+	3+	1349.7554661468505	0	-0.7765855400142488								100.0	Confident
1755	P36969	TEVNYTQLVDLHAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33574 (Experiment 1)	33574	59.856	870.417725	2+	2+	1737.8087141790404	1	5.074107067234634	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Doubtful
1756	P52272	FESPEVAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19134 (Experiment 1)	19134	42.465	532.25647	2+	2+	1062.4981888350203	0	0.18621792661317832								100.0	Confident
1757	P13639	ARPFPDGLAEDIDKGEVSAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35239 (Experiment 1)	35239	61.798	536.52594	4+	4+	2142.0705456698106	0	1.9143859131301835								100.0	Doubtful
1758	P31146	AVFVSEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15752 (Experiment 1)	15752	37.984	418.729309	2+	2+	835.4439684341903	0	0.11538742911748208								99.73045822102425	Confident
1759	P49327	GNAGQSNYGFANSAMER	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27042 (Experiment 1)	27042	52.276	618.580994	3+	3+	1852.7199758276302	0	0.6341248177093856	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 98.42931937172776)	Y8	1		0	100.0	Confident
1760	P25788	SNFGYNIPLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36707 (Experiment 1)	36707	63.577	576.806213	2+	2+	1151.5975089534702	0	0.3156285527880447								98.91598915989161	Confident
1761	P35232	ILFRPVASQLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32981 (Experiment 1)	32981	59.175	466.286255	3+	3+	1395.8350538802301	0	1.345183596917035								100.0	Confident
1762	P62244	IVVNLTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27423 (Experiment 1)	27423	52.722	436.271362	2+	2+	870.5287011176601	0	-0.6074785193557591								99.48849104859335	Confident
1763	P10599, THIO_HUMAN	TAFQEALDAAGDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36534 (Experiment 1)	36534	63.372	668.823303	2+	2+	1335.6306595565502	0	1.0417634008355903								100.0	Confident
1764	P17844, Q92841	STCIYGGAPK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15805 (Experiment 1)	15805	38.06	527.26001	2+	2+	1052.4960806600402	0	8.901196475934633								98.67724867724867	Doubtful
1765	P42704	LQDAINILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36206 (Experiment 1)	36206	62.985	514.310852	2+	2+	1026.6073453611803	0	-0.18888845824608982								96.4769647696477	Confident
1766	P04406	RVIISAPSADAPMFVMGVNHEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38491 (Experiment 1)	38491	65.744	593.058716	4+	4+	2368.20315714583	0	1.0964301270834198								100.0	Doubtful
1767	Q9HDC9	LLEYDTVTR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27370 (Experiment 1)	27370	52.659	595.279724	2+	2+	1188.5427696764702	0	1.785205857141646	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.50959860383944)	Y4	1		0	98.91891891891892	Confident
1768	Q9BZZ5	QIYNPPSGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10343 (Experiment 1)	10343	29.271	542.247131	2+	2+	1082.4797754970903	0	-0.06125501326042504	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1769	O43390, O60506	LFVGSIPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31894 (Experiment 1)	31894	57.938	430.765717	2+	2+	859.5167394516302	0	0.16437562642581227								93.13984168865436	Confident
1770	Q96IX5	AGPESDAQYQFTGIKK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25695 (Experiment 1)	25695	50.722	910.419006	2+	2+	1818.8189445095704	0	2.479390241722046	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 85.34031413612566)	Y9	1		0	95.67567567567568	Confident
1771	P49458	PQYQTWEEFSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39582 (Experiment 1)	39582	67.155	775.820557	2+	2+	1549.6238735314805	0	1.73206260525577	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1772	Q16629	VYVGNLGTGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21330 (Experiment 1)	21330	45.189	568.309204	2+	2+	1134.6033226099	0	0.4684568906784267								99.7289972899729	Confident
1773	P49736	ISHLPLVEELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36827 (Experiment 1)	36827	63.721	435.922668	3+	3+	1304.7452358163202	0	0.717852030955362								91.72932330827068	Doubtful
1774	P07900, P08238, Q14568, Q58FF8	YIDQEELNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18282 (Experiment 1)	18282	41.377	576.282532	2+	2+	1150.5506183307002	0	-0.09306573471421091								100.0	Confident
1775	Q13242	GSPHYFSPFRPY	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40208 (Experiment 1)	40208	68.028	512.222534	3+	3+	1533.6442150532403	0	1.0135880398175345	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 22.07206573010752)	Phosphorylation of Y (5: 85.29886914378028)		0	Y12-{Y5 Y12}	1	92.99363057324841	Doubtful
1776	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27081 (Experiment 1)	27081	52.319	523.251953	2+	2+	1044.4892775516303	0	0.07215907224038404	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1777	P40939	FVDLYGAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29349 (Experiment 1)	29349	54.977	520.774048	2+	2+	1039.5338460677503	0	-0.2909143490549157								100.0	Confident
1778	P08238, P14625, Q58FF6, Q58FF7, Q58FF8	ELISNASDALDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28487 (Experiment 1)	28487	53.979	638.326355	2+	2+	1274.6354105838202	0	2.151319965697248								100.0	Confident
1779	Q9NQR4	AVDNQVYVATASPAR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22971 (Experiment 1)	22971	47.412	547.927002	3+	3+	1640.7559503301907	0	1.9627162583462177	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1780	Q86UX7	LTQLYEQAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19896 (Experiment 1)	19896	43.416	601.284546	2+	2+	1200.5540030665104	0	0.4457125231916477	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.33507853403141)	Y5	1		0	96.19565217391303	Confident
1781	P01903	NGKPVTTGVSETVFLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38350 (Experiment 1)	38350	65.571	601.660278	3+	3+	1800.9733978278402	1	-9.838200128455998								99.28057553956835	Doubtful
1782	P32969	TICSHVQNMIK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22626 (Experiment 1)	22626	47.004	444.225067	3+	3+	1329.6533266607703	0	0.033720741055632365								100.0	Confident
1783	P11142	HWPFMVVNDAGRPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33831 (Experiment 1)	33831	60.15	551.948059	3+	3+	1652.8245658495202	0	-1.3396471814350217								100.0	Confident
1784	P31948	ALDLDSSCK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18490 (Experiment 1)	18490	41.655	504.738434	2+	2+	1007.4593607981501	0	2.9265424155714075								100.0	Confident
1785	P11142	HWPFMVVNDAGRPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34049 (Experiment 1)	34049	60.412	551.949158	3+	3+	1652.8245658495202	0	0.6514795376014343								100.0	Confident
1786	Q06830	TIAQDYGVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30496 (Experiment 1)	30496	56.301	554.305725	2+	2+	1106.5971746003001	0	-0.25034366613465914								100.0	Confident
1787	P07900	KHLEINPDHSIIETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28824 (Experiment 1)	28824	54.375	479.515778	4+	4+	1914.0323096862903	0	0.8844588853664569								100.0	Doubtful
1788	Q14739	TFEVTPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29747 (Experiment 1)	29747	55.436	481.767975	2+	2+	961.52328138405	0	-1.9556239588104547								99.46091644204851	Confident
1789	Q14697	DAQHYGGWEHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13007 (Experiment 1)	13007	33.738	479.18985	3+	3+	1434.5466262702903	0	0.7612362870665373	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1790	P54727	IDIDPEETVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29095 (Experiment 1)	29095	54.687	579.798279	2+	2+	1157.5815841058104	0	0.3630234285547146								96.4769647696477	Confident
1791	P26641	QVLEPSFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27113 (Experiment 1)	27113	52.357	488.266235	2+	2+	974.5185303567803	0	-0.6280282918187053								99.72972972972973	Confident
1792	P00519	LATGEEEGGGSSSKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5502 (Experiment 1)	5502	19.106	488.902405	3+	3+	1463.6852143105502	0	0.11678474884946692								100.0	Confident
1793	Q9UKK9	TTYMDPTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17381 (Experiment 1)	17381	40.123	507.234009	2+	2+	1012.45354714172	0	-0.08090480510879032								91.30434782608697	Confident
1794	Q8NBX0	FYGEPVIK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30351 (Experiment 1)	30351	56.135	516.743591	2+	2+	1031.4728992115004	0	-0.2613917797175977	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.35379644588045)	Y2	1		0	99.73614775725594	Confident
1795	Q9Y5V0	AALIYTCTVCR	Phosphorylation of Y(5)	Carbamidomethylation of C(7, 10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30524 (Experiment 1)	30524	56.334	704.312683	2+	2+	1406.6087581446502	0	1.4588156460773476	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 93.36823734729494)	Y5	1		0	98.95833333333334	Confident
1796	Q14978	DNQLSEVANK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17107 (Experiment 1)	17107	39.738	559.277527	2+	2+	1116.5411162761604	0	-0.550003724973167								98.92183288409704	Confident
1797	P63220	DHASIQMNVAEVDKVTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31256 (Experiment 1)	31256	57.184	657.330322	3+	3+	1968.9687234535604	0	0.20950709066756099								100.0	Confident
1798	P78344	LDPSPQTIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22749 (Experiment 1)	22749	47.148	621.294434	2+	2+	1240.5740698047505	0	0.19737958398706007	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 96.50959860383944)	Y9	1		0	96.22641509433963	Confident
1799	Q16630	GAAPNVVYTYTGK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32929 (Experiment 1)	32929	59.115	710.82489	2+	2+	1419.6435463469004	0	-5.851815235171284	Phosphorylation of Y (8: Random)	Phosphorylation of Y (8: 0.0, 10: 0.0)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y8 Y10}	1	100.0	Doubtful
1800	P19338	SISLYYTGEK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33471 (Experiment 1)	33471	59.738	620.77771	2+	2+	1239.5424353233002	0	-1.2631372858935963	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (5: 0.0)		0	Y5-{Y5 Y6}	1	100.0	Confident
1801	P62805	TVTAMDVVYALKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42789 (Experiment 1)	42789	72.067	489.606049	3+	3+	1465.7962854130105	0	0.02191323285342033								100.0	Confident
1802	P14625	SGYLLPDTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27853 (Experiment 1)	27853	53.233	497.26651	2+	2+	992.5178616504402	0	0.6087442973074868								100.0	Confident
1803	P68104, Q5VTE0	YYVTIIDAPGHR	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34404 (Experiment 1)	34404	60.831	495.569427	3+	3+	1483.68607986522	0	0.25003858635631787	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (1: 0.0)		0	Y1-{Y1 Y2}	1	100.0	Confident
1804	P78527	SIGEYDVLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33578 (Experiment 1)	33578	59.861	566.257568	2+	2+	1130.5009048644902	0	-0.2841445669568428	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.51534733441034)	Y5	1		0	99.74093264248705	Confident
1805	Q16698	VAFITGGGTGLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32778 (Experiment 1)	32778	58.947	589.332275	2+	2+	1176.6502728023202	0	-0.2339392321901122								100.0	Confident
1806	ALDOA_RABIT, P04075	ALSDHHIYLEGTLLKPNMVTPGHACTQK	Phosphorylation of Y(8)	Carbamidomethylation of C(25)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34873 (Experiment 1)	34873	61.372	803.640869	4+	4+	3210.5355401332404	0	-0.36396856734892247	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Doubtful
1807	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	KESYSIYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25554 (Experiment 1)	25554	50.561	680.316528	2+	2+	1358.6159346167303	0	1.887690794028448	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.33452891645359)	Phosphorylation of Y (9: 15.457995359288612)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
1808	P62888	VCTLAIIDPGDSDIIR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45404 (Experiment 1)	45404	77.445	879.460327	2+	2+	1756.9029353095198	0	1.7998324976960227								99.72826086956522	Confident
1809	P62888	KSEIEYYAMLAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35136 (Experiment 1)	35136	61.679	509.23822	3+	3+	1524.6935333144304	0	-0.4599776133041394	Phosphorylation of Y (7: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (7: 0.17452006980802792)		0	Y7-{Y6 Y7}	1	100.0	Confident
1810	P26368	AMQGLTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13919 (Experiment 1)	13919	35.139	417.218842	2+	2+	832.4225217969602	0	0.7301562147326625								96.19565217391303	Confident
1811	P42704	LIASYCNVGDIEGASK	Phosphorylation of Y(5)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33640 (Experiment 1)	33640	59.931	888.897522	2+	2+	1775.7801164727002	0	0.21070694047742144	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.5767366720517)	Y5	1		0	99.72972972972973	Confident
1812	P32969	KFLDGIYVSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32157 (Experiment 1)	32157	58.235	433.571198	3+	3+	1297.6918032611304	0	-0.029723349887447247								99.39024390243902	Confident
1813	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29247 (Experiment 1)	29247	54.857	528.26239	2+	2+	1054.5100129962104	0	0.20261730989276847	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
1814	P46736	VLYTCFQSIQAQK	Phosphorylation of Y(3)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36530 (Experiment 1)	36530	63.367	833.388428	2+	2+	1664.7633442097504	0	-0.6246443370377521	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.38219895287958)	Y3	1		0	99.7289972899729	Confident
1815	P04843	LPVALDPGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28296 (Experiment 1)	28296	53.757	490.792572	2+	2+	979.5702315764702	0	0.3662341873987724								99.72972972972973	Confident
1816	P62942	RGQTCVVHYTGMLEDGKK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19254 (Experiment 1)	19254	42.613	520.509094	4+	4+	2078.0037290632904	0	1.7007750319426824								100.0	Doubtful
1817	P27635, Q96L21	LIPDGCGVK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18096 (Experiment 1)	18096	41.131	479.755035	2+	2+	957.4953523840502	0	0.1716317101241133								94.03794037940379	Confident
1818	Q6UB35	TIAQAVYGAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23238 (Experiment 1)	23238	47.728	551.27063	2+	2+	1100.5267256895104	0	-0.016891099613421254	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 90.40139616055846)	Y7	1		0	94.10187667560321	Confident
1819	Q14566	HVEEFSPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11572 (Experiment 1)	11572	31.413	500.745697	2+	2+	999.4773938207902	0	-0.5519309625077783								99.73190348525469	Confident
1820	Q14103	IFVGGLSPDTPEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34377 (Experiment 1)	34377	60.799	744.883484	2+	2+	1487.7507746892304	0	1.101097679570226								100.0	Confident
1821	P62906	DTLYEAVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24963 (Experiment 1)	24963	49.865	523.729004	2+	2+	1045.4481410156402	0	-4.473619243295169	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.30191972076788)	Y4	1		0	99.73118279569893	Doubtful
1822	Q02878	HQEGEIFDTEKEKYEITEQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25195 (Experiment 1)	25195	50.135	628.051025	4+	4+	2508.1768612131505	0	-0.7432035522924045								100.0	Doubtful
1823	P05141	AAYFGIYDTAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39614 (Experiment 1)	39614	67.207	650.285889	2+	2+	1298.5584197406101	0	-0.9185753197898886	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 18.111436865187635)	Phosphorylation of Y (7: 99.30191972076788)		0	Y7-{Y3 Y7}	1	99.45652173913044	Confident
1824	P15153	AVLCPQPTR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14549 (Experiment 1)	14549	36.123	521.278992	2+	2+	1040.5436995588002	0	-0.2575322996766675								99.47643979057592	Confident
1825	P37802	NVIGLQMGTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30710 (Experiment 1)	30710	56.547	601.819397	2+	2+	1201.6237407846502	0	0.4156412505703551								100.0	Confident
1826	Q14240	DQIYEIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42936 (Experiment 1)	42936	72.331	632.286682	2+	2+	1262.5584197406104	0	0.3094528936113643	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
1827	P17174	HIYLLPSGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31393 (Experiment 1)	31393	57.346	568.28656	2+	2+	1134.55869452413	0	-0.11214213817356668	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
1828	P30041	LPFPIIDDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44406 (Experiment 1)	44406	75.153	543.302795	2+	2+	1084.5916952970401	0	-0.6057674207715806								99.45945945945947	Confident
1829	P30086	GNDISSGTVLSDYVGSGPPK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37474 (Experiment 1)	37474	64.496	1015.459656	2+	2+	2028.9041306855102	0	0.3094072011647154	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 100.0)	Y13	1		0	100.0	Confident
1830	P62854, Q5JNZ5	NIVEAAAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20595 (Experiment 1)	20595	44.239	471.77182	2+	2+	941.5294293936504	0	-0.3628100870088299								100.0	Confident
1831	Q9HB71	WDYLTQVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37206 (Experiment 1)	37206	64.173	591.296814	2+	2+	1180.5764391557204	0	2.2289284064663595								99.73190348525469	Confident
1832	Q16666	QASGNIVYGVFMLHK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45450 (Experiment 1)	45450	77.55	581.947571	3+	3+	1742.8215277922104	0	-0.3689865094430883	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 97.38219895287958)	Y8	1		0	92.14285714285715	Doubtful
1833	P39019	KLTPQGQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4563 (Experiment 1)	4563	17.257	464.272156	2+	2+	926.5297637468202	0	-0.005040625472898171								99.7289972899729	Confident
1834	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37361 (Experiment 1)	37361	64.36	964.391602	2+	2+	1926.7560694694905	0	6.523117232953016	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 6.912389302791533)	Phosphorylation of Y (14: 0.4398244085630429)		0	Y14-{Y10 Y14}	1	99.7289972899729	Doubtful
1835	P62888	TGVHHYSGNNIELGTACGK		Carbamidomethylation of C(17)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15372 (Experiment 1)	15372	37.445	504.490112	4+	4+	2013.9326722980104	0	-0.6591627615626173								100.0	Doubtful
1836	P60842	GFKDQIYDIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45517 (Experiment 1)	45517	77.702	791.370911	2+	2+	1580.7276103240304	0	-0.21561165329158546	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1837	P13796	EITENLMATGDLDQDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37968 (Experiment 1)	37968	65.096	939.431702	2+	2+	1876.8472709082002	0	0.8410188314570908								99.45652173913044	Doubtful
1838	P10809	NAGVEGSLIVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26663 (Experiment 1)	26663	51.834	608.333008	2+	2+	1214.6506667251404	0	0.6545278212387181								100.0	Confident
1839	P68104, Q5VTE0	YYVTIIDAPGHR	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34415 (Experiment 1)	34415	60.843	742.850647	2+	2+	1483.68607986522	0	0.4450433291278245	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.0)		0	Y1-{Y1 Y2}	1	100.0	Confident
1840	Q16891	VVSQYHELVVQAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23153 (Experiment 1)	23153	47.628	536.602234	3+	3+	1606.7868565356505	0	-1.2324048839239716	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1841	P62993	NYVTPVNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13623 (Experiment 1)	13623	34.683	521.741211	2+	2+	1041.4644597861204	0	3.267224557393211	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 98.95287958115183)	Y2	1		0	99.72972972972973	Confident
1842	P51149	VIILGDSGVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30806 (Experiment 1)	30806	56.658	529.31604	2+	2+	1056.6179100448803	0	-0.3617672022816791								100.0	Confident
1843	Q86V81	SLGTADVHFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22833 (Experiment 1)	22833	47.245	411.207367	3+	3+	1230.5992998586205	0	0.7877142507132973								100.0	Confident
1844	P11766	LVSEYMSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19641 (Experiment 1)	19641	43.084	518.72522	2+	2+	1035.4347994506202	0	1.048355520441468	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 94.06631762652705)	Y5	1		0	93.65079365079364	Confident
1845	P49411	GITINAAHVEYSTAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26631 (Experiment 1)	26631	51.797	558.625061	3+	3+	1672.8532826951605	0	0.042308882550755156								100.0	Confident
1846	P68104, Q05639, Q5VTE0	EHALLAYTLGVK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41950 (Experiment 1)	41950	70.611	697.85907	2+	2+	1393.7006673002004	0	2.0919497997023546	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 74.79806138933765)	Y7	1		0	92.54498714652956	Confident
1847	Q02790	DKFSFDLGKGEVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34648 (Experiment 1)	34648	61.112	528.287781	3+	3+	1581.8402583999703	0	0.7919929458160291								100.0	Confident
1848	P17987	AFHNEAQVNPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11265 (Experiment 1)	11265	30.97	471.230103	3+	3+	1410.6640253735002	0	3.1507891578201486								100.0	Confident
1849	P61158	AEPEDHYFLLTEPPLNTPENR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44568 (Experiment 1)	44568	75.596	854.724121	3+	3+	2561.1475488383503	0	1.1640265415383548	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1850	P02786	SSGLPNIPVQTISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37026 (Experiment 1)	37026	63.959	734.911438	2+	2+	1467.8045415975903	0	2.5727443598934516								96.4769647696477	Confident
1851	O00232	AIYDTPCIQAESEK	Phosphorylation of Y(3)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28560 (Experiment 1)	28560	54.064	852.863464	2+	2+	1703.7113682065406	0	0.5902823090533483	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1852	P62937, PPIA_HUMAN	VKEGMNIVEAMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34041 (Experiment 1)	34041	60.404	502.586823	3+	3+	1504.7377845607205	0	0.5670922841564439								100.0	Confident
1853	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34366 (Experiment 1)	34366	60.788	636.640686	3+	3+	1906.8978635366104	0	1.2383049204658756	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y5}	1	100.0	Confident
1854	P20618	DVYTGDALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23555 (Experiment 1)	23555	48.134	505.250214	2+	2+	1008.4876241513202	0	-1.7309066558771178								99.72826086956522	Confident
1855	Q13310	IVGSKPLYVALAQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34884 (Experiment 1)	34884	61.386	532.296997	3+	3+	1593.8643785803604	0	2.995216052158412	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
1856	P30050	CTGGEVGATSALAPK		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20306 (Experiment 1)	20306	43.904	709.851746	2+	2+	1417.6871288868501	0	1.2750421789300026								99.46236559139786	Confident
1857	P51114	IYGESADAVKK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9871 (Experiment 1)	9871	28.328	630.797485	2+	2+	1259.5798834611805	0	0.4229609611623073	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
1858	P04350, P07437, P68371, Q13509, Q13885, Q9BVA1	MREIVHIQAGQCGNQIGAK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20419 (Experiment 1)	20419	44.029	704.02771	3+	3+	2109.05716161848	0	1.9596715374484464								100.0	Confident
1859	P60174	HVFGESDELIGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26459 (Experiment 1)	26459	51.602	486.912506	3+	3+	1457.7150578868502	0	0.43177708405020354								100.0	Confident
1860	P68431, Q16695, Q71DI3	SAPATGGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5338 (Experiment 1)	5338	18.835	394.219666	2+	2+	786.4235673427802	0	1.5368658170722063								92.63157894736842	Confident
1861	P38159, Q96E39	DSYGGPPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8611 (Experiment 1)	8611	25.8	464.68161	2+	2+	927.3487613275402	0	-0.10142552721384479	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 90.14539579967689)	Y3	1		0	99.22680412371135	Confident
1862	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28592 (Experiment 1)	28592	54.1	573.632874	3+	3+	1717.87474641573	0	1.1890219683793806								100.0	Confident
1863	P35579	ALELDSNLYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35753 (Experiment 1)	35753	62.411	597.310364	2+	2+	1192.6088019131603	0	-2.198891201704903								99.45945945945947	Confident
1864	P04844	FELDTSER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24681 (Experiment 1)	24681	49.538	498.735321	2+	2+	995.4559896698702	0	0.0996485626963684								96.4769647696477	Confident
1865	P08238, Q58FF7	IDIIPNPQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32679 (Experiment 1)	32679	58.833	597.827637	2+	2+	1193.6404363946103	0	0.23808855232117163								99.7289972899729	Confident
1866	P62917	ASGNYATVISHNPETK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17875 (Experiment 1)	17875	40.78	884.899231	2+	2+	1767.7828933540202	0	0.5739144656179822	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1867	P11586	QPSQGPTFGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25050 (Experiment 1)	25050	49.967	580.308228	2+	2+	1158.6033226099	0	-1.2230929353405622								91.30434782608697	Confident
1868	P53041	AEGYEVAHGGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7703 (Experiment 1)	7703	23.868	409.171265	3+	3+	1224.4924654391102	0	-0.4071965175789812	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.33507853403141)	Y4	1		0	94.73684210526316	Confident
1869	P37802	GPAYGLSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13961 (Experiment 1)	13961	35.216	450.702301	2+	2+	899.3902322167003	0	-0.20318321718509652	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
1870	P36578	SGQGAFGNMCR		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19649 (Experiment 1)	19649	43.094	592.750488	2+	2+	1183.4862613356702	0	0.13642395160463167								99.72972972972973	Confident
1871	P46777	IEGDMIVCAAYAHELPK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39379 (Experiment 1)	39379	66.87	639.981018	3+	3+	1915.9172054746707	1	0.34617415201834345								92.99363057324841	Doubtful
1872	C9J202, Q9BT22	AVTVYDKPASFFK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35785 (Experiment 1)	35785	62.448	776.874634	2+	2+	1551.7374467317406	0	-1.758108993810742	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.38219895287958)	Y5	1		0	98.94179894179894	Confident
1873	P06744	NLVTEDVMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30464 (Experiment 1)	30464	56.264	538.774109	2+	2+	1075.5331944447503	0	0.4367524563312649								100.0	Confident
1874	P15880	GTGIVSAPVPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21278 (Experiment 1)	21278	45.121	513.303284	2+	2+	1024.5916952970401	0	0.3114819690587707								100.0	Confident
1875	P50990	LFVTNDAATILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42340 (Experiment 1)	42340	71.257	667.379211	2+	2+	1332.7401504358804	0	2.786002915856951								100.0	Confident
1876	P14625	IYFMAGSSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34398 (Experiment 1)	34398	60.824	556.236633	2+	2+	1110.4569318775302	0	1.601109664307884	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
1877	P13796	EGICAIGGTSEQSSVGTQHSYSEEEK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22485 (Experiment 1)	22485	46.836	924.07605	3+	3+	2769.2035465368003	0	1.0006627843310218								100.0	Confident
1878	P07900	DNSTMGYMAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21757 (Experiment 1)	21757	45.892	594.754517	2+	2+	1187.4950946838703	0	-0.5158575180670829								100.0	Confident
1879	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44699 (Experiment 1)	44699	75.892	625.279297	2+	2+	1248.5427696764702	0	1.0166586390799115	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
1880	P37837	LSSTWEGIQAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29722 (Experiment 1)	29722	55.406	638.829224	2+	2+	1275.6459156978704	0	-1.5815089722173148								100.0	Confident
1881	O43390	ENILEEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43696 (Experiment 1)	43696	73.585	554.779907	2+	2+	1107.5448046742704	0	0.4113273456753787								100.0	Confident
1882	P09651, P22626, P51991, Q13151, Q32P51	KIFVGGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18952 (Experiment 1)	18952	42.235	431.281036	2+	2+	860.5483739330803	0	-0.991077494294655								93.15789473684211	Confident
1883	P61353	YSVDIPLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35023 (Experiment 1)	35023	61.551	525.278687	2+	2+	1048.5440763982801	0	-1.1949184645714848								100.0	Confident
1884	P61978	GSDFDCELR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24058 (Experiment 1)	24058	48.785	549.729858	2+	2+	1097.44477336317	0	0.35444986145658763								100.0	Confident
1885	P10809	GYISPYFINTSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42034 (Experiment 1)	42034	70.761	735.340027	2+	2+	1468.6639474383103	0	1.0564022422992396	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 23.671064608583478)	Phosphorylation of Y (2: 9.598603839441536)		0	Y2-{Y2 Y6}	1	100.0	Confident
1886	Q9ULW0	AQPVPHYGVPFKPQIPEAR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32284 (Experiment 1)	32284	58.38	737.710083	3+	3+	2210.1037739819203	0	2.0991206448680373	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1887	P50914	VAYVSFGPHAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23918 (Experiment 1)	23918	48.613	438.207611	3+	3+	1311.6012876121004	0	-0.21604103309227293	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
1888	P62805	RISGLIYEETR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28923 (Experiment 1)	28923	54.489	472.901276	3+	3+	1415.6809944847805	0	0.7077696375322452	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
1889	P26599	GQPIYIQFSNHK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31650 (Experiment 1)	31650	57.652	504.573608	3+	3+	1510.6969789020904	0	1.3316194939885697	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1890	P55209, Q99733	FYEEVHDLER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26079 (Experiment 1)	26079	51.164	472.865845	3+	3+	1415.5758607099003	0	-0.10934060975685986	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.28057553956835	Confident
1891	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34753 (Experiment 1)	34753	61.231	630.796997	2+	2+	1259.5798834611805	0	-0.3506632495040093	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1892	P06753	KLVIIEGDLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30545 (Experiment 1)	30545	56.358	428.921844	3+	3+	1283.7449014631502	0	-0.9316868064068755								100.0	Confident
1893	O00231	VVDSLYNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17438 (Experiment 1)	17438	40.206	469.25293	2+	2+	936.4916469026002	0	-0.3621033342307182								99.7289972899729	Confident
1894	P06753	AADAEAEVASLNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21496 (Experiment 1)	21496	45.459	658.82489	2+	2+	1315.6368075661503	0	-1.1994825200888852								99.1869918699187	Confident
1895	O75347	LEAAYLDLQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36012 (Experiment 1)	36012	62.727	596.32312	2+	2+	1190.62953735774	0	1.8024728864187134								99.46666666666667	Confident
1896	O60496	GQEGEYAVPFDAVAR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39952 (Experiment 1)	39952	67.674	844.869019	2+	2+	1687.7243158487404	0	-0.4916631675593433	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 95.47657512116317)	Y6	1		0	99.22279792746113	Confident
1897	P11142	FDDAVVQSDMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26607 (Experiment 1)	26607	51.77	627.786926	2+	2+	1253.5598031154102	0	-0.4014489718855466								100.0	Confident
1898	Q00610	LASTLVHLGEYQAAVDGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37625 (Experiment 1)	37625	64.685	657.681396	3+	3+	1970.0221389254104	0	0.11133768776892321								100.0	Confident
1899	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32900 (Experiment 1)	32900	59.083	622.26709	3+	3+	1863.7750310922602	0	2.362071309108435	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 68.84816753926702)		0	Y6-{Y6 Y11}	1	99.26470588235294	Confident
1900	P23528	HELQANCYEEVKDR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14077 (Experiment 1)	14077	35.409	448.45871	4+	4+	1789.8053465265702	0	0.2160768967048149								100.0	Doubtful
1901	P30041	LSILYPATTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36288 (Experiment 1)	36288	63.084	596.340088	2+	2+	1190.6659228664603	0	-0.25136664046414436								97.911227154047	Confident
1902	P15311, P26038, P35241	APDFVFYAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42855 (Experiment 1)	42855	72.171	591.801392	2+	2+	1181.5869442697701	0	1.0871873757300126								100.0	Confident
1903	O75874	ATDFVVPGPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28166 (Experiment 1)	28166	53.602	544.292969	2+	2+	1086.5709598524602	0	0.3906114040750467								100.0	Confident
1904	P62805	ISGLIYEETR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31228 (Experiment 1)	31228	57.152	590.814819	2+	2+	1179.6135529404305	0	1.2966228019146215								100.0	Confident
1905	P22626	TLETVPLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26733 (Experiment 1)	26733	51.915	529.297058	2+	2+	1056.5815245361603	0	-1.8528972723073496								99.73684210526315	Confident
1906	Q6UXN9	YTHAANTVVYSSNK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11526 (Experiment 1)	11526	31.353	817.865173	2+	2+	1633.7137511650405	0	1.2483132621987956	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 12.992178784560455)	Phosphorylation of Y (10: 99.65095986038395)		0	Y10-{Y1 Y10}	1	99.45799457994579	Confident
1907	P62805	DAVTYTEHAKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8742 (Experiment 1)	8742	26.092	457.541321	3+	3+	1369.6027441640804	0	-0.44481537641335434	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
1908	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44810 (Experiment 1)	44810	76.144	625.278748	2+	2+	1248.5427696764702	0	0.13865010613878317	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
1909	Q96AP0	GLLLRPRPAKELPLPRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11751 (Experiment 1)	11751	31.711	489.569611	3+	4+	1953.2363696568002	1	4.911770156832274								100.0	Doubtful
1910	P05387	ILDSVGIEADDDRLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29793 (Experiment 1)	29793	55.488	591.639099	3+	3+	1771.8952070767903	0	0.1467802542172175								100.0	Confident
1911	P21281	KDHADVSNQLYACYAIGK	Phosphorylation of Y(11)	Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27483 (Experiment 1)	27483	52.792	711.654541	3+	3+	2131.9398050015807	0	0.931444364693098	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 5.529825963312794)	Phosphorylation of Y (11: 15.560050769474854)		0	Y11-{Y11 Y14}	1	100.0	Confident
1912	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44923 (Experiment 1)	44923	76.396	625.279053	2+	2+	1248.5427696764702	0	0.626432624399006	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
1913	P09651	SESPKEPEQLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7931 (Experiment 1)	7931	24.301	476.588013	3+	3+	1426.7416069878602	0	0.42147651036178796								100.0	Confident
1914	P63244	DETNYGIPQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22354 (Experiment 1)	22354	46.673	596.783325	2+	2+	1191.55201531303	0	0.06849500305579036								100.0	Confident
1915	Q92945	HSVGVVIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14030 (Experiment 1)	14030	35.33	462.274719	2+	2+	922.53484912726	0	0.0388720342903522								96.51474530831099	Confident
1916	P29692	ATAPQTQHVSPMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10551 (Experiment 1)	10551	29.684	475.241943	3+	3+	1422.7037820105002	0	0.1526163674701831								100.0	Confident
1917	P50991	VIDPATATSVDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32600 (Experiment 1)	32600	58.744	679.368591	2+	2+	1356.72489429456	0	-1.6671542058602333								100.0	Confident
1918	P31942, P31943, P55795	GLPFGCSK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25783 (Experiment 1)	25783	50.823	433.215057	2+	2+	864.41637378736	0	-0.9380101274019852								99.73333333333333	Confident
1919	P60709, P63261	GYSFTTTAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22682 (Experiment 1)	22682	47.07	566.767334	2+	2+	1131.5196525555903	0	0.40802543352485876								100.0	Confident
1920	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43157 (Experiment 1)	43157	72.709	586.326294	3+	3+	1755.9559568585505	0	0.6229419278816982								100.0	Confident
1921	Q9Y224	EGLPVALDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30281 (Experiment 1)	30281	56.057	471.268738	2+	2+	940.5229470308802	0	-0.02542551800972113								99.73118279569893	Confident
1922	P27105	VIAAEGEMNASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17480 (Experiment 1)	17480	40.266	624.306702	2+	2+	1246.5975856064601	0	1.0134932030512247								99.73118279569893	Confident
1923	P43243	VIHLSNLPHSGYSDSAVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29786 (Experiment 1)	29786	55.481	510.024567	4+	4+	2036.0690891178306	0	0.03578990536157234								100.0	Doubtful
1924	P51991	SSGSPYGGGYGSGGGSGGYGSR	Phosphorylation of Y(19)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17008 (Experiment 1)	17008	39.601	995.883484	2+	2+	1989.7490270264398	0	1.7010251468031206	Phosphorylation of Y (19: Doubtfull)	Phosphorylation of Y (19: 11.426346708140507)	Phosphorylation of Y (6: 0.0)		0	Y19-{Y6 Y10 Y19}	1	100.0	Confident
1925	P00492	SIPMTVDFIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44269 (Experiment 1)	44269	74.765	589.815735	2+	2+	1177.6165301458902	0	0.3280012634481655								99.7289972899729	Confident
1926	P10696	VQHASPAGAYAHTVNR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8882 (Experiment 1)	8882	26.407	586.941467	3+	3+	1757.7998808308407	0	1.52813240971911	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
1927	P68104, Q5VTE0	YYVTIIDAPGHR	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34633 (Experiment 1)	34633	61.096	495.568848	3+	3+	1483.68607986522	0	-0.9183146518438181	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.0)		0	Y1-{Y1 Y2}	1	100.0	Confident
1928	P25705	AVDSLVPIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33659 (Experiment 1)	33659	59.954	513.800598	2+	2+	1025.5869442697701	0	-0.29311303556980745								100.0	Confident
1929	P22626	EESGKPGAHVTVKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4335 (Experiment 1)	4335	16.934	489.603302	3+	3+	1465.7888915334504	0	-0.5548256659736568								99.28057553956835	Confident
1930	Q9NR30	TAITVEHLAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27021 (Experiment 1)	27021	52.252	399.239777	3+	3+	1194.6972229947403	0	0.23261283451810907								94.8905109489051	Confident
1931	P49368	TAVETAVLLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45144 (Experiment 1)	45144	76.902	593.363281	2+	2+	1184.7128730588802	0	-0.7280462938166269								99.7289972899729	Confident
1932	Q15785	NGQYAEASALYGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27271 (Experiment 1)	27271	52.542	740.316711	2+	2+	1478.6191225042103	0	-0.17116849259972386	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 20.07335466941329)	Phosphorylation of Y (4: 100.0)		0	Y4-{Y4 Y11}	1	100.0	Confident
1933	P54819	NLETPLCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22566 (Experiment 1)	22566	46.932	487.75235	2+	2+	973.4902670036101	0	-0.12294888928497014								99.45799457994579	Confident
1934	P30086	LYEQLSGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17163 (Experiment 1)	17163	39.81	509.236755	2+	2+	1016.4579774233503	0	0.9618747650603285	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
1935	O43809	LPGGELNPGEDEVEGLKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30115 (Experiment 1)	30115	55.863	636.992981	3+	3+	1907.9588699625106	0	-0.9190898407781812								100.0	Confident
1936	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27885 (Experiment 1)	27885	53.27	528.26123	2+	2+	1054.5100129962104	0	-1.993261588590273	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
1937	P51858	IDEMPEAAVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22234 (Experiment 1)	22234	46.527	551.776794	2+	2+	1101.5376111188505	0	1.2903309619299101								99.18478260869566	Confident
1938	P43243	SFQQSSLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14785 (Experiment 1)	14785	36.467	520.26239	2+	2+	1038.5094222250602	0	0.7734961757724413								99.45799457994579	Confident
1939	P31946, P61981	YDDMAAAMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21327 (Experiment 1)	21327	45.186	508.21524	2+	2+	1014.4150534580203	0	0.8594873174087226								100.0	Confident
1940	P50502, Q8NFI4	QDPSVLHTEEMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19490 (Experiment 1)	19490	42.899	481.229889	3+	3+	1440.6667277954402	0	0.7687282123458776								99.40119760479041	Confident
1941	Q13404, Q15819	LLEELEEGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29469 (Experiment 1)	29469	55.114	594.31134	2+	2+	1186.6081332068204	0	-0.00516601667042475								100.0	Confident
1942	Q15717	VLVDQTTGLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22707 (Experiment 1)	22707	47.099	594.833191	2+	2+	1187.6510010783102	0	0.6959838948026354								99.73474801061008	Confident
1943	P09874	TLGDFAAEYAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36735 (Experiment 1)	36735	63.609	593.294006	2+	2+	1184.5713537752806	0	1.7742424575190299								100.0	Confident
1944	Q9Y2W1	GSFSDTGLGDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20940 (Experiment 1)	20940	44.639	570.762878	2+	2+	1139.50948179471	0	1.5078715940819964								99.72972972972973	Confident
1945	P00338	QVVESAYEVIK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31929 (Experiment 1)	31929	57.976	672.825439	2+	2+	1343.6373983373005	0	-0.7975843409741283	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1946	P51570	HIQEHYGGTATFYLSQAADGAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32249 (Experiment 1)	32249	58.34	815.703857	3+	3+	2444.0798036317005	0	4.061117743902039	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 19.598659964886828)	Phosphorylation of Y (6: 0.0)		0	Y6-{Y6 Y13}	1	100.0	Confident
1947	Q92841	LIDFLESGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42066 (Experiment 1)	42066	70.811	511.282349	2+	2+	1020.5491617787202	0	0.9615905999457967								100.0	Confident
1948	P61160	DLMVGDEASELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36249 (Experiment 1)	36249	63.038	667.816345	2+	2+	1333.6183806206905	0	-0.18235123481486407								100.0	Confident
1949	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43470 (Experiment 1)	43470	73.217	586.326294	3+	3+	1755.9559568585505	0	0.6229419278816982								100.0	Confident
1950	P62333	HGEIDYEAIVK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28602 (Experiment 1)	28602	54.113	677.308838	2+	2+	1352.6013471817505	0	1.3109875834764197	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.67689822294022)	Y6	1		0	99.45652173913044	Confident
1951	Q6PI48	FYSLPQSPQQFK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37230 (Experiment 1)	37230	64.201	775.360657	2+	2+	1548.7013955761904	0	3.460008385479403	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 94.9389179755672)	Y2	1		0	98.91598915989161	Confident
1952	P62280	VLLGETGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17174 (Experiment 1)	17174	39.83	408.744598	2+	2+	815.4752685624701	0	-0.7651423633289135								98.91891891891892	Confident
1953	P42766	VLTVINQTQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20760 (Experiment 1)	20760	44.428	572.340332	2+	2+	1142.6659228664603	0	0.1644126195340218								100.0	Confident
1954	P55769	QQIQSIQQSIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26498 (Experiment 1)	26498	51.647	729.389221	2+	2+	1456.7634050616002	0	0.33178783173878296								99.47368421052632	Confident
1955	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30764 (Experiment 1)	30764	56.61	609.260254	2+	2+	1216.5053215385904	0	0.519915841209661	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 8: 0.0)	Phosphorylation of Y (6: 0.8726003490401396)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
1956	P46783, Q9NQ39	KAEAGAGSATEFQFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24118 (Experiment 1)	24118	48.863	523.925842	3+	3+	1568.7583196811604	0	-1.6688603670633009								100.0	Confident
1957	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19335 (Experiment 1)	19335	42.707	424.847015	3+	3+	1271.5183458337801	0	0.6824153532197419	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.12277867528272)	Y5	1		0	92.46575342465754	Doubtful
1958	P61158	YSYVCPDLVK	Phosphorylation of Y(3)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32996 (Experiment 1)	32996	59.192	662.289917	2+	2+	1322.5617908688903	0	2.6349538113013002	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 12.61099850106637)	Phosphorylation of Y (3: 0.1745200698080279)		0	Y3-{Y1 Y3}	1	99.73262032085562	Confident
1959	Q13247	DKYGPPVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9928 (Experiment 1)	9928	28.425	506.236877	2+	2+	1010.4586461296901	0	0.5481001239909193	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 83.24607329842932)	Y3	1		0	93.76693766937669	Confident
1960	P04843	NIEIDSPYEISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36460 (Experiment 1)	36460	63.286	718.356812	2+	2+	1434.6990734695403	0	-0.0016726815978961352								99.7289972899729	Confident
1961	P61254, Q9UNX3	FNPFVTSDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34764 (Experiment 1)	34764	61.245	541.767944	2+	2+	1081.5192586327703	0	1.916353309435014								99.45799457994579	Confident
1962	P26038	LNKDQWEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13867 (Experiment 1)	13867	35.051	406.53479	3+	3+	1216.5836497944804	0	-0.909470263355214								94.02985074626866	Confident
1963	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21464 (Experiment 1)	21464	45.394	759.858521	2+	2+	1517.7014551458406	0	0.680337990647784	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
1964	P30101	LAPEYEAAATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19162 (Experiment 1)	19162	42.499	596.30481	2+	2+	1190.5931518490206	0	1.6059072463725463								96.19565217391303	Confident
1965	P29401	AVELAANTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12215 (Experiment 1)	12215	32.48	458.758453	2+	2+	915.5025459394703	0	-0.21021198901172244								97.8891820580475	Confident
1966	O14745	AGLLAGDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17783 (Experiment 1)	17783	40.659	386.719086	2+	2+	771.4239016959502	0	-0.3654196044333317								98.91598915989161	Confident
1967	P18077	DETEFYLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35186 (Experiment 1)	35186	61.736	551.257568	2+	2+	1100.5026055091203	0	-1.8343866387310506								100.0	Confident
1968	P62913	VLEQLTGQTPVFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37788 (Experiment 1)	37788	64.877	773.92395	2+	2+	1545.8402583999705	0	-4.465104571848945								100.0	Doubtful
1969	P48735	TIEAEAAHGTVTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12966 (Experiment 1)	12966	33.685	452.569672	3+	3+	1354.6840921117405	0	2.2792033050964835								100.0	Confident
1970	Q9Y230	VYSLFLDESR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42552 (Experiment 1)	42552	71.609	614.812805	2+	2+	1227.6135529404303	0	-2.029779607714072								100.0	Confident
1971	O94903	IGSTIFGER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29944 (Experiment 1)	29944	55.665	490.265533	3+	2+	978.5134449763402	0	3.12901828648163								99.73684210526315	Confident
1972	P06733	YISPDQLADLYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42372 (Experiment 1)	42372	71.301	753.347168	2+	2+	1504.6850768057104	0	-3.513466937974355	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 19.26171777773863)	Phosphorylation of Y (11: 99.82547993019197)		0	Y11-{Y1 Y11}	1	99.73890339425587	Confident
1973	P26599	LSLDGQNIYNACCTLR	Phosphorylation of Y(9)	Carbamidomethylation of C(12, 13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40138 (Experiment 1)	40138	67.915	989.433777	2+	2+	1976.8485474690306	0	2.250583855099543	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	99.7289972899729	Confident
1974	P55084	TPFLLSGTSYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39036 (Experiment 1)	39036	66.401	607.325256	2+	2+	1212.6390394122802	0	-2.535987152095945								99.23469387755102	Confident
1975	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33528 (Experiment 1)	33528	59.804	616.267334	2+	2+	1230.5209716027305	0	-0.6949384724032491	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.33452891645359)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
1976	A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536	IIPGFMCQGGDFTR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42549 (Experiment 1)	42549	71.605	799.875916	2+	2+	1597.73811891389	0	-0.5249858487820637								100.0	Confident
1977	P14866	NDQDTWDYTNPNLSGQGDPGSNPNKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28680 (Experiment 1)	28680	54.205	964.092957	3+	3+	2889.25500494604	0	0.704169635227554								100.0	Confident
1978	P05141, P12235, P12236	GAWSNVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32767 (Experiment 1)	32767	58.934	451.745453	2+	2+	901.47699989797	0	-0.7159243403138316								99.75247524752476	Confident
1979	Q15046	MLVVGGIDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31267 (Experiment 1)	31267	57.197	480.270477	2+	2+	958.5269868655	0	-0.6098633943568821								93.19371727748691	Confident
1980	P62937, PPIA_HUMAN	VSFELFADK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43865 (Experiment 1)	43865	73.902	528.274902	2+	2+	1054.5335117145803	0	1.6462590333066238								100.0	Confident
1981	P62891, Q59GN2	QNRPIPQWIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28264 (Experiment 1)	28264	53.72	436.582703	3+	3+	1306.72583778442	0	0.33732844500118087								100.0	Confident
1982	Q15102	LGYTPVCR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19761 (Experiment 1)	19761	43.241	483.24762	2+	2+	964.4800366730801	0	0.6729404415934779								93.6	Confident
1983	P62316	EMWTEVPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30947 (Experiment 1)	30947	56.824	510.246368	2+	2+	1018.4793679667403	0	-1.1611047747270293								99.45945945945947	Confident
1984	P55072	GVLFYGPPGCGK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35534 (Experiment 1)	35534	62.138	626.312683	2+	2+	1250.61177911862	0	-0.7712214085294009								98.65951742627345	Confident
1985	P09651, P22626, P51991, Q32P51	LTDCVVMR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21506 (Experiment 1)	21506	45.473	497.246429	2+	2+	992.4783224209202	0	-0.01745064707251732								98.6449864498645	Confident
1986	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28998 (Experiment 1)	28998	54.574	609.260498	2+	2+	1216.5053215385904	0	0.9204017176637955	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.33452891645359)	Phosphorylation of Y (6: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
1987	O43670	ETIDAVPNAIPGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30862 (Experiment 1)	30862	56.722	676.861023	2+	2+	1351.70957858359	0	-1.5405777037378294								99.73684210526315	Confident
1988	P50995	DAQELYAAGENR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19814 (Experiment 1)	19814	43.305	708.793579	2+	2+	1415.5718379586206	0	0.5411365122192034	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
1989	P07195	IVADKDYSVTANSK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12356 (Experiment 1)	12356	32.73	795.875488	2+	2+	1589.7338179032806	0	1.6366676687083344	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
1990	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28123 (Experiment 1)	28123	53.543	528.261902	2+	2+	1054.5100129962104	0	-0.7211662267237998	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
1991	Q07955	DGYDYDGYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23985 (Experiment 1)	23985	48.696	562.220459	2+	2+	1122.4254178175802	0	0.8424182885013641								100.0	Confident
1992	P11142, P54652	IINEPTAAAIAYGLDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37795 (Experiment 1)	37795	64.885	596.668274	3+	3+	1786.9828998823805	0	0.05179717237800596								100.0	Confident
1993	P46781	LDYILGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42468 (Experiment 1)	42468	71.441	467.783417	2+	2+	933.5535188831702	0	-1.32306438351365								99.72826086956522	Confident
1994	Q06830	DISLSDYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29711 (Experiment 1)	29711	55.394	470.734558	2+	2+	939.4549270407103	0	-0.3866023721632433								99.74293059125964	Confident
1995	Q5SSJ5	EASYSLIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24931 (Experiment 1)	24931	49.827	509.733887	2+	2+	1017.45322639608	0	-0.005227927835801535	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 88.1326352530541)	Y4	1		0	93.08510638297872	Confident
1996	O95399, P11021	LTPEEIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20422 (Experiment 1)	20422	44.033	493.762024	2+	2+	985.5080252427301	0	1.488394977927856								98.74055415617129	Confident
1997	P49321	SIEVIENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20479 (Experiment 1)	20479	44.106	480.258911	2+	2+	958.5083595959004	0	-5.299748145403132								99.45799457994579	Doubtful
1998	P25685	VSLEEIYSGCTKK	Phosphorylation of Y(7)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26857 (Experiment 1)	26857	52.06	797.363342	2+	2+	1592.7157253109904	0	-2.253826031627781	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
1999	P22087	NLVPGESVYGEKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20764 (Experiment 1)	20764	44.432	509.911987	3+	3+	1526.7130228890503	0	0.724772997146633	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	100.0	Confident
2000	Q9UBB6	LQAGEETASHYR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10931 (Experiment 1)	10931	30.38	721.308228	2+	2+	1440.6034724400704	0	-1.0878650252262532	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 85.51483420593368)	Y11	1		0	94.93333333333334	Confident
2001	Q14444	SFMALSQDIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37065 (Experiment 1)	37065	64.008	634.321533	2+	2+	1266.6278231055803	0	0.54385759821438								100.0	Confident
2002	P63244	LTRDETNYGIPQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16886 (Experiment 1)	16886	39.438	548.258423	3+	3+	1641.7511993029202	0	1.3620703918212391	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
2003	P61088, Q5JXB2	IYHPNVDK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9931 (Experiment 1)	9931	28.429	533.241943	2+	2+	1064.4692108133902	0	0.11463183013512776	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.30191972076788)	Y2	1		0	99.75247524752476	Confident
2004	P30101	YGVSGYPTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28786 (Experiment 1)	28786	54.333	542.78595	2+	2+	1083.5600608155903	0	-2.4998274463726826								100.0	Confident
2005	Q14444	YQEVTNNLEFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30841 (Experiment 1)	30841	56.698	728.360229	2+	2+	1454.7041588499806	0	1.198732727999409								99.46091644204851	Confident
2006	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19602 (Experiment 1)	19602	43.033	514.763672	2+	2+	1027.5120650773501	0	0.7051678053726937								100.0	Confident
2007	Q92688	KLELSENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11357 (Experiment 1)	11357	31.104	494.774719	2+	2+	987.5349086969104	0	-0.023880094155325562								99.73684210526315	Confident
2008	P06748	ADKDYHFKVDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21425 (Experiment 1)	21425	45.331	515.446777	5+	5+	2572.1942426127903	0	1.264944284951813								100.0	Doubtful
2009	P61626	STDYGIFQINSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42256 (Experiment 1)	42256	71.124	740.828674	2+	2+	1479.6395235956202	0	2.2079855260807855	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.73474801061008	Confident
2010	O43684	LYDVPANSMR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24854 (Experiment 1)	24854	49.737	623.26947	2+	2+	1244.5260740665103	0	-1.353345489117525	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 72.53634894991923)	Y2	1		0	92.42819843342036	Confident
2011	O60256	VQVYQEPNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12303 (Experiment 1)	12303	32.642	606.77417	2+	2+	1211.5336019751003	0	0.15252075072315807	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
2012	P56381, Q5VTU8	DALKTEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16548 (Experiment 1)	16548	39.014	476.261597	2+	2+	950.5072969667403	0	1.41109585661572								96.24664879356568	Confident
2013	P49411	GITINAAHVEYSTAAR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26984 (Experiment 1)	26984	52.209	877.414429	2+	2+	1752.8196132159105	0	-3.024872456314316	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.03069466882067)	Y11	1		0	99.7289972899729	Confident
2014	Q9BXJ9	LEDAADVYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19035 (Experiment 1)	19035	42.334	566.236572	2+	2+	1130.4645193557703	0	-5.234789356811952	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Doubtful
2015	O43264	NCLVYSIPTNSSK	Phosphorylation of Y(5)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31577 (Experiment 1)	31577	57.567	781.849487	2+	2+	1561.6847595358802	0	-0.21645434113465323	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2016	P06576	IMDPNIVGSEHYDVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30429 (Experiment 1)	30429	56.225	605.963074	3+	3+	1814.8621331267004	0	2.8931840382164595								100.0	Confident
2017	P25205	LIVNVNDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37277 (Experiment 1)	37277	64.255	528.314758	2+	2+	1054.6134933707801	0	1.3909299500691807								100.0	Confident
2018	P78527	MYAALGDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21404 (Experiment 1)	21404	45.297	523.222717	2+	2+	1044.4351338037902	0	-4.063967401671437	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 94.66882067851373)	Y2	1		0	99.21671018276761	Confident
2019	Q13905	CFQQAHYDMRR	Phosphorylation of Y(7)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40568 (Experiment 1)	40568	68.569	796.817322	2+	2+	1590.62211679301	1	-3.378400445353098	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.70759289176091)	Y7	1		0	99.19354838709677	Confident
2020	P09874	LTVNPGTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11170 (Experiment 1)	11170	30.821	415.243103	2+	2+	828.4705175352001	0	1.367310763806473								99.46091644204851	Confident
2021	P54920	IEEACEIYAR	Phosphorylation of Y(8)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22611 (Experiment 1)	22611	46.986	667.278198	2+	2+	1332.5421180534702	0	-0.20605126807263224	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	99.73614775725594	Confident
2022	Q13263	DIVENYFMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44261 (Experiment 1)	44261	74.747	593.782471	2+	2+	1185.5488445088902	0	1.3006105518112197								93.76693766937669	Confident
2023	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43294 (Experiment 1)	43294	72.963	586.327332	3+	3+	1755.9559568585505	0	2.3932883326564776								100.0	Confident
2024	P26599	DYGNSPLHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13567 (Experiment 1)	13567	34.59	529.754028	2+	2+	1057.4941065140902	0	-0.5695543014493041								99.73544973544973	Confident
2025	P27824	AEEDEILNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21429 (Experiment 1)	21429	45.339	544.764282	2+	2+	1087.5145671751502	0	-0.5104120340853495								100.0	Confident
2026	P52565	TDYMVGSYGPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29187 (Experiment 1)	29187	54.79	663.265564	2+	2+	1324.51590330563	0	0.5064043141907587	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 13.100114832749988)	Phosphorylation of Y (3: 100.0)		0	Y3-{Y3 Y8}	1	100.0	Confident
2027	A6NIZ1, P01111, P01112, P01116, P61224, P62834	YDPTIEDSYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25272 (Experiment 1)	25272	50.224	629.782471	2+	2+	1257.5513466066902	0	-0.7602145427659713								100.0	Confident
2028	Q8NC51	SSFSHYSGLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18515 (Experiment 1)	18515	41.686	596.755859	2+	2+	1191.4961538372202	0	0.8472727977457204	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.73890339425587	Confident
2029	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44240 (Experiment 1)	44240	74.689	935.9328	2+	2+	1869.85097291384	0	0.03961424307490135	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2030	Q96KP4	TVFGVEPDLTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37668 (Experiment 1)	37668	64.738	617.330994	2+	2+	1232.64010204144	0	5.939332837981827								99.73958333333334	Doubtful
2031	P30086	VLTPTQVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15076 (Experiment 1)	15076	36.967	443.274017	2+	2+	884.5331177917603	0	0.4097632059445637								100.0	Confident
2032	O00462	FQSAVLYAAQQSK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33185 (Experiment 1)	33185	59.408	760.863342	2+	2+	1519.7072092326205	0	3.2343848118165046	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
2033	P11310	IYQIYEGTSQIQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31055 (Experiment 1)	31055	56.95	560.266479	3+	3+	1677.7763514216003	0	0.7473698971726344	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 18.118711502856215)	Phosphorylation of Y (2: 0.0)		0	Y2-{Y2 Y5}	1	100.0	Confident
2034	P09651, P22626, P51991, Q13151, Q32P51	KIFVGGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20972 (Experiment 1)	20972	44.685	431.281494	2+	2+	860.5483739330803	0	0.07087401271267042								99.7289972899729	Confident
2035	P61981	EHMQPTHPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6944 (Experiment 1)	6944	22.121	415.876709	3+	3+	1244.60842507368	0	-0.1021729920599671								97.87234042553192	Confident
2036	P35579, P35749, Q7Z406	KEEELQAALAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20528 (Experiment 1)	20528	44.162	419.898621	3+	3+	1256.6724647988804	0	1.2453820668311628								100.0	Confident
2037	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37407 (Experiment 1)	37407	64.415	964.379761	2+	2+	1926.7560694694905	0	-5.755170151215995	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 4.197843481395482)	Phosphorylation of Y (14: 89.17609046849758)		0	Y14-{Y10 Y14}	1	90.86021505376344	Doubtful
2038	Q12904	IGCIITAR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22658 (Experiment 1)	22658	47.042	452.256805	2+	2+	902.5007721176601	0	-1.8960997525516894								100.0	Confident
2039	P62424	HWGGNVLGPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20161 (Experiment 1)	20161	43.742	532.785461	2+	2+	1063.5563128478302	0	0.052759086754759314								100.0	Confident
2040	P22626	LTDCVVMRDPASKR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16544 (Experiment 1)	16544	39.009	412.713318	4+	4+	1646.8232455201803	0	0.5576589395873953								100.0	Doubtful
2041	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18254 (Experiment 1)	18254	41.339	514.763306	2+	2+	1027.5120650773501	0	-0.005838580856008839								99.73333333333333	Confident
2042	P28070	FQIATVTEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27881 (Experiment 1)	27881	53.265	518.787292	2+	2+	1035.5600608155903	0	-0.028671879686272717								100.0	Confident
2043	P13693	DLISHDEMFSDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43604 (Experiment 1)	43604	73.43	598.256348	3+	3+	1791.7426683348203	0	2.5330703550821085	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 96.50959860383944)	Y13	1		0	99.28571428571429	Confident
2044	P54578	PLYSVTVK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23643 (Experiment 1)	23643	48.242	493.751038	2+	2+	985.4885492756403	0	-1.0391959902571848	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	98.64864864864865	Confident
2045	P63244	LWNTLGVCK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34556 (Experiment 1)	34556	61.009	545.789917	2+	2+	1089.56410065021	0	1.0813844350815072								99.73333333333333	Confident
2046	P78527	NELEIPGQYDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32001 (Experiment 1)	32001	58.06	695.833862	2+	2+	1389.65245763029	0	0.5126485577177755								99.7289972899729	Confident
2047	P68104, Q05639, Q5VTE0	STTTGHLIYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13221 (Experiment 1)	13221	34.036	560.803772	2+	2+	1119.5924235730301	0	0.5059645290704318								100.0	Confident
2048	P08559, P29803	LEEGPPVTTVLTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35267 (Experiment 1)	35267	61.831	706.392395	2+	2+	1410.7718444869802	0	-1.137766195457104								98.9247311827957	Confident
2049	P22234	DQITAGNAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9798 (Experiment 1)	9798	28.21	508.759674	2+	2+	1015.5046711977902	0	0.12173586793282877								98.67724867724867	Confident
2050	P36873, P62136, P62140	IYGFYDECK	Phosphorylation of Y(2)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33447 (Experiment 1)	33447	59.709	637.744385	2+	2+	1273.4726415113203	0	1.2352574470257447	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 17.267902710535417)	Phosphorylation of Y (2: 12.401756184478698)		0	Y2-{Y2 Y5}	1	100.0	Confident
2051	Q9Y2X3	TQLYEYLQNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37921 (Experiment 1)	37921	65.036	469.881561	3+	3+	1406.6231452554903	0	-0.20690027033495612	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 6: 0.0)	Phosphorylation of Y (4: 6.457242582897034)		0	Y4-{Y4 Y6}	1	100.0	Confident
2052	P08708	IAGYVTHLMK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25871 (Experiment 1)	25871	50.924	606.796082	2+	2+	1211.5773813633803	0	0.189275314889659	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2053	P25398	LVEALCAEHQINLIK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36682 (Experiment 1)	36682	63.547	584.321838	3+	3+	1749.9447405518501	0	-0.602380161994425								99.24812030075188	Confident
2054	P15311, P26038, P35241	FVIKPIDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22654 (Experiment 1)	22654	47.037	480.300293	2+	2+	958.5851533646203	0	0.9157839108767473								99.7289972899729	Confident
2055	P16401	KATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24163 (Experiment 1)	24163	48.917	670.891968	2+	2+	1339.7711162109902	0	-1.291670237742451								100.0	Confident
2056	P24752	NEQDAYAINSYTR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26191 (Experiment 1)	26191	51.294	812.837524	2+	2+	1623.6566302117403	0	2.377390136249217	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 6.921055469795117)	Phosphorylation of Y (6: 5.49738219895288)		0	Y11-{Y6 Y11}	1	100.0	Confident
2057	P07814	LNLNNTVLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30034 (Experiment 1)	30034	55.768	558.324829	2+	2+	1114.6346227381803	0	0.4319424633438365								99.73045822102425	Confident
2058	Q13905	CFQQAHYDMRR	Phosphorylation of Y(7)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40564 (Experiment 1)	40564	68.563	796.820007	2+	2+	1590.62211679301	1	-0.006633298357669629	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.76898222940227)	Y7	1		0	97.58064516129032	Confident
2059	P62249	GGGHVAQIYAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21119 (Experiment 1)	21119	44.881	414.563202	3+	3+	1240.6676542019602	0	0.09841492220424766								99.25925925925925	Confident
2060	O00629	IEQLQNHENEDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18701 (Experiment 1)	18701	41.923	926.90979	2+	2+	1851.8040227214206	0	0.5417708985010009	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 85.16579406631763)	Y13	1		0	94.86486486486486	Confident
2061	P08238, Q58FF7	DNSTMGYMMAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31414 (Experiment 1)	31414	57.37	664.741211	2+	2+	1327.4647963329003	0	2.3112306914090444	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	99.73474801061008	Confident
2062	O43390, O60506	AGPIWDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40391 (Experiment 1)	40391	68.318	464.256592	2+	2+	926.4974009893799	0	1.3247831554529805								98.69451697127938	Confident
2063	Q9NUU7, Q9UMR2	LKPQLLQGVYAMGFNRPSK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41891 (Experiment 1)	41891	70.493	557.541626	4+	4+	2226.1384452384805	0	-0.46951886123474024	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Doubtful
2064	Q9UBT2	ESVLQFYPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38869 (Experiment 1)	38869	66.198	555.795105	2+	2+	1109.5757108797302	0	-0.048411142146793484								99.7289972899729	Confident
2065	Q08211	NFLYAWCGK	Phosphorylation of Y(4)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46249 (Experiment 1)	46249	79.188	619.757507	2+	2+	1237.4991310426801	0	1.0730205829867145	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.50959860383944)	Y4	1		0	99.7289972899729	Confident
2066	P13725	AGRGASQPPTPTPASDAFQRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38294 (Experiment 1)	38294	65.5	1071.052124	2+	2+	2139.08211341302	1	1.9741357885310566								99.1869918699187	Confident
2067	P13796	VYALPEDLVEVNPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44842 (Experiment 1)	44842	76.216	833.410767	2+	2+	1664.8062545675507	0	0.43585898485228547	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2068	P61978	NLPLPPPPPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29754 (Experiment 1)	29754	55.444	597.85321	2+	2+	1193.6920780446499	0	-0.17644652004117548								99.1869918699187	Confident
2069	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30468 (Experiment 1)	30468	56.268	528.76001	2+	2+	1054.5100129962104	1	-7.4780728148843165	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	99.45799457994579	Doubtful
2070	P00338	VHPVSTMIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14034 (Experiment 1)	14034	35.335	506.286774	2+	2+	1010.5582869937803	0	0.6992806520819133								99.45652173913044	Confident
2071	P37837	VSTEVDAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8843 (Experiment 1)	8843	26.333	438.725098	2+	2+	875.4348603024703	0	0.8920900669713668								98.6522911051213	Confident
2072	O14818, Q8TAA3	ALLEVVQSGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30796 (Experiment 1)	30796	56.646	550.819641	2+	2+	1099.6237237013102	0	0.9126090542757184								100.0	Confident
2073	A0FGR8	VDVGQQPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17396 (Experiment 1)	17396	40.148	506.282471	2+	2+	1010.5508931142201	0	-0.4977928548005525								99.72826086956522	Confident
2074	Q9P258	TVVSGSCAAHSLLITTEGK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31104 (Experiment 1)	31104	57.008	644.335815	3+	3+	1929.9829765353704	0	1.3652652002938803								100.0	Confident
2075	ALDOA_RABIT, P04075	IGEHTPSALAIMENANVLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45091 (Experiment 1)	45091	76.763	703.037842	3+	3+	2106.0891729394107	0	1.1965516041062116								100.0	Confident
2076	P27695	VSYGIGDEEHDQEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17569 (Experiment 1)	17569	40.379	564.248474	3+	3+	1689.7230563712503	0	0.3167803478658401								100.0	Confident
2077	P30084	AFAAGADIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19198 (Experiment 1)	19198	42.546	432.23468	2+	2+	862.4548674710602	0	-0.06987486501866623								96.19565217391303	Confident
2078	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33899 (Experiment 1)	33899	60.23	652.026184	3+	3+	1953.0571274518006	0	-0.2069713165101806								100.0	Confident
2079	P16035	KEYLIAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13779 (Experiment 1)	13779	34.913	501.256805	2+	2+	1000.4994483125104	0	-0.39026500759798155	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	98.91891891891892	Confident
2080	Q99714	GGIVGMTLPIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43196 (Experiment 1)	43196	72.782	592.844482	2+	2+	1183.67471372835	0	-0.25526247287888537								99.73262032085562	Confident
2081	P37108	ISTVVSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10629 (Experiment 1)	10629	29.826	410.742401	2+	2+	819.4701831820303	0	0.08020154588645799								99.7340425531915	Confident
2082	P22314	LQTSSVLVSGLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34845 (Experiment 1)	34845	61.341	630.369751	2+	2+	1258.72450037174	0	0.35589810159590946								99.73890339425587	Confident
2083	P12955	AVYEAVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27412 (Experiment 1)	27412	52.708	460.763641	2+	2+	919.5127167003502	0	0.01341905583539538								96.22641509433963	Confident
2084	P49321	SGNVAELALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27487 (Experiment 1)	27487	52.797	501.285065	2+	2+	1000.5553097883203	0	0.26659294845030207								99.74226804123711	Confident
2085	Q13242	FEDPRDAEDAIYGR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30242 (Experiment 1)	30242	56.011	578.5755	3+	3+	1732.7093940605903	0	-2.7213090150878396	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 99.82547993019197)	Y12	1		0	100.0	Confident
2086	P14618	GIFPVLCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41687 (Experiment 1)	41687	70.202	467.264771	2+	2+	932.5153595526401	0	-0.3964413113973674								96.52406417112299	Confident
2087	P62263	VKADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33397 (Experiment 1)	33397	59.65	858.068237	3+	3+	2571.1788660499706	0	1.5599209495546664	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
2088	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36044 (Experiment 1)	36044	62.771	964.385925	2+	2+	1926.7560694694905	0	0.6364659805419387	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 7.759123926083362)	Phosphorylation of Y (10: 33.21334635162652)		0	Y10-{Y10 Y14}	1	100.0	Confident
2089	Q8WX92	NVHYCTLR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11667 (Experiment 1)	11667	31.573	571.745911	2+	2+	1141.4739789240002	0	2.8772849783157044	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 91.44851657940663)	Y4	1		0	92.11956521739131	Confident
2090	P35232	IFTSIGEDYDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33820 (Experiment 1)	33820	60.138	722.834045	2+	2+	1443.65178892395	0	1.2092295262225028								100.0	Confident
2091	P33241	DIVAGDMSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18466 (Experiment 1)	18466	41.623	468.22818	2+	2+	934.4429824580202	0	-1.255146762853549								94.3089430894309	Confident
2092	P11142	SFYPEEVSSMVLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44966 (Experiment 1)	44966	76.477	808.897644	2+	2+	1615.7803605653505	0	0.2314885664663349								98.91304347826086	Confident
2093	P50552	VQIYHNPTANSFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22960 (Experiment 1)	22960	47.396	542.918884	3+	3+	1625.7351553159604	0	-0.20427626663132673	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2094	P14174	PMFIVNTNVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38343 (Experiment 1)	38343	65.562	644.34906	2+	2+	1286.6805273847801	0	2.3587283308215867								100.0	Confident
2095	O00487	HYYSITINYR	Phosphorylation of Y(2, 3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32816 (Experiment 1)	32816	58.989	497.201813	3+	3+	1488.5839964729803	0	-0.2593670590303274	Phosphorylation of Y (2: Confident, 3: Confident)		Phosphorylation of Y (2: 100.0, 3: 100.0)	Y2, Y3	2		0	100.0	Confident
2096	P29350	DSNIPGSDYINANYIK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42154 (Experiment 1)	42154	70.969	932.411072	2+	2+	1862.8087737486903	0	-0.6342060921111592	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 6.216338154907346)	Phosphorylation of Y (9: 81.50087260034904)		0	Y14-{Y9 Y14}	1	95.23809523809523	Confident
2097	B2RXH8, B7ZW38, O60812, P07910	QKVDSLLENLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36168 (Experiment 1)	36168	62.941	472.596863	3+	3+	1414.7667591065403	0	1.4109952921676308								99.24812030075188	Confident
2098	Q01469	FEETTADGRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6891 (Experiment 1)	6891	22.01	577.275391	2+	2+	1152.5411162761602	0	-4.232978897997727								99.72826086956522	Doubtful
2099	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13137 (Experiment 1)	13137	33.921	411.954346	4+	4+	1643.7903480854304	0	-1.2561768666913131								100.0	Doubtful
2100	P52272	MGPLGLDHMASSIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37548 (Experiment 1)	37548	64.59	538.597778	3+	3+	1612.7701473181603	0	0.8400099908364228								100.0	Confident
2101	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26635 (Experiment 1)	26635	51.803	565.215881	2+	2+	1128.4165065341901	0	0.6214728264565701	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 25.354249434789267)	Phosphorylation of Y (6: 99.82547993019197)		0	Y6-{Y2 Y6}	1	99.72826086956522	Confident
2102	P15259, P18669, Q8N0Y7	HYGGLTGLNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17086 (Experiment 1)	17086	39.71	570.265808	2+	2+	1138.5172236349702	0	-0.14078397253739716	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2103	P22626	LTDCVVMRDPASKR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16491 (Experiment 1)	16491	38.947	549.947388	3+	3+	1646.8232455201803	0	-1.7643599756862152								100.0	Confident
2104	Q15397	TNYDIVVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24505 (Experiment 1)	24505	49.335	530.247559	2+	2+	1058.4797754970903	0	0.7445294750534355	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.65095986038395)	Y3	1		0	99.72826086956522	Confident
2105	Q15365	LVVPATQCGSLIGK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33238 (Experiment 1)	33238	59.468	721.904724	2+	2+	1441.79628541301	0	-0.9629700770530154								100.0	Confident
2106	Q14204	TLMAQSIYGGR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28782 (Experiment 1)	28782	54.327	638.791138	2+	2+	1275.56827323166	0	-0.43062983688559553	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	99.73045822102425	Confident
2107	P62906	DTLYEAVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25188 (Experiment 1)	25188	50.127	523.731384	2+	2+	1045.4481410156402	0	0.07069534425950588	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
2108	P26038	ALELEQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20214 (Experiment 1)	20214	43.802	494.256714	2+	2+	986.5032742154601	0	-4.450247596194233								99.74293059125964	Doubtful
2109	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	QVHPDTGISSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 8075 (Experiment 1)	8075	24.594	584.802002	2+	2+	1167.5884008217504	0	0.8979497034707764								100.0	Confident
2110	P13073	SEDFSLPAYMDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42305 (Experiment 1)	42305	71.205	715.816284	2+	2+	1429.6183806206902	0	-0.2553408110537431								96.49595687331536	Confident
2111	Q14204	QYASYEFVQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31573 (Experiment 1)	31573	57.563	685.793335	2+	2+	1369.5703814066403	0	1.2654409449999175	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 26.721827155411724)	Phosphorylation of Y (2: 21.98952879581152)		0	Y2-{Y2 Y5}	1	100.0	Confident
2112	P08865	KSDGIYIINLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35481 (Experiment 1)	35481	62.077	421.914398	3+	3+	1262.7234377425802	0	-1.6378832851217262								97.74436090225565	Confident
2113	P06576	FTQAGSEVSALLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41848 (Experiment 1)	41848	70.439	718.381348	2+	2+	1434.7466923683003	0	1.0097001713614495								99.48186528497409	Confident
2114	P42704	VIQALAMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25599 (Experiment 1)	25599	50.612	437.264618	2+	2+	872.5153595526403	0	-0.7735427395199046								99.45652173913044	Confident
2115	P62312	GNNVLYISTQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31655 (Experiment 1)	31655	57.658	658.816833	2+	2+	1315.6173315990602	0	1.3520220150312963	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
2116	P23526	IILLAEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33027 (Experiment 1)	33027	59.227	442.782196	2+	2+	883.54910220907	0	0.8320771767884166								99.45799457994579	Confident
2117	Q9Y490	TSTPEDFIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30042 (Experiment 1)	30042	55.778	533.262024	2+	2+	1064.5138388991602	0	-4.072871212437724								100.0	Confident
2118	Q86UE4	SQEPIPDDQKVSDDDKEKGEGALPTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17453 (Experiment 1)	17453	40.225	577.484253	5+	5+	2882.3781397704906	0	2.3352710175690796								100.0	Doubtful
2119	P42704	LIASYCNVGDIEGASK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33438 (Experiment 1)	33438	59.698	848.909302	2+	2+	1695.8137859519502	0	-5.733727816487725								100.0	Doubtful
2120	P49736	DTVDPVQDEMLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35178 (Experiment 1)	35178	61.727	744.851257	2+	2+	1487.6926081901104	0	-3.1194880817731723								100.0	Confident
2121	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30649 (Experiment 1)	30649	56.478	528.262573	2+	2+	1054.5100129962104	0	0.5490361360970805	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.47643979057592)	Y7	1		0	99.73190348525469	Confident
2122	P19338	FGYVDFESAEDLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44513 (Experiment 1)	44513	75.439	824.874268	2+	2+	1647.7304331674707	0	2.151786448909352								100.0	Confident
2123	P05141, P12235, P12236, Q9H0C2	GNLANVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23479 (Experiment 1)	23479	48.032	428.753723	2+	2+	855.4926499621101	0	0.2835011357158452								100.0	Confident
2124	Q02790	GEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38988 (Experiment 1)	38988	66.343	707.013977	3+	3+	2118.0187069452804	0	0.65753306422898	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 25.042367110267527)	Phosphorylation of Y (7: 0.0)		0	Y7-{Y7 Y12}	1	100.0	Confident
2125	Q05516	HQLETHYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5759 (Experiment 1)	5759	19.532	388.504303	3+	3+	1162.4920715162903	0	-0.8510552516162397	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Confident
2126	P19338	ALVATPGKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8331 (Experiment 1)	8331	25.173	442.781647	2+	2+	883.5491022090703	0	-0.40781110657473646								98.91891891891892	Confident
2127	P06744	VWYVSNIDGTHIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34394 (Experiment 1)	34394	60.819	534.946777	3+	3+	1601.8201916617304	0	-1.0531018904722433								99.28057553956835	Confident
2128	P14550	GLEVTAYSPLGSSDR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37049 (Experiment 1)	37049	63.987	816.369202	2+	2+	1630.7239814955701	0	-0.07988369941906984	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
2129	P15311, P26038, P35241	APDFVFYAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42709 (Experiment 1)	42709	71.915	591.80072	2+	2+	1181.5869442697701	0	-0.04832994424037069								100.0	Confident
2130	P49368	TLIQNCGASTIR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21592 (Experiment 1)	21592	45.63	667.347717	2+	2+	1332.6819839367602	0	-0.8263079687877677								100.0	Confident
2131	P06576	TIAMDGTEGLVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31736 (Experiment 1)	31736	57.752	631.82373	2+	2+	1261.6336367620102	0	-0.5774515726299527								100.0	Confident
2132	P13798	SFNLSALEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38543 (Experiment 1)	38543	65.803	504.771454	2+	2+	1007.5287606873103	0	-0.4017865590606963								96.19565217391303	Confident
2133	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	KLAVNMVPFPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35919 (Experiment 1)	35919	62.607	424.580933	3+	3+	1270.7219982739402	0	-0.8075991057517993								100.0	Confident
2134	P07195	FIIPQIVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43722 (Experiment 1)	43722	73.626	479.309937	2+	2+	956.6058888092002	0	-0.5922498618196951								98.6449864498645	Confident
2135	P62318	VLHEAEGHIVTCETNTGEVYR		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20302 (Experiment 1)	20302	43.9	604.290344	4+	4+	2413.1332225793603	0	-0.39403502089981934								100.0	Doubtful
2136	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44176 (Experiment 1)	44176	74.529	936.434387	2+	2+	1869.85097291384	1	-0.05699408570039666	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2137	P00519	SSTLTSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6292 (Experiment 1)	6292	20.671	419.71817	2+	2+	837.4192102383302	0	3.0697217087936703								99.45652173913044	Confident
2138	P06733	IGAEVYHNLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18318 (Experiment 1)	18318	41.433	408.532013	3+	3+	1222.5747385110903	0	-0.43155434685564315	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
2139	P08238, Q58FF8	SIYYITGESK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31210 (Experiment 1)	31210	57.133	620.777527	2+	2+	1239.5424353233002	0	-1.5579284259275925	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 1.9197207678883073)		0	Y3-{Y3 Y4}	1	99.74811083123426	Confident
2140	P52597	HSGPNSADSANDGFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13351 (Experiment 1)	13351	34.24	544.245117	3+	3+	1629.7131603938901	0	0.22122737381356958								100.0	Confident
2141	P78527	DLCNTHLMR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19812 (Experiment 1)	19812	43.302	387.183289	3+	3+	1158.52739787166	0	0.5507540180288546								99.37888198757764	Confident
2142	P15153	KLAPITYPQGLALAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36346 (Experiment 1)	36346	63.153	528.656006	3+	3+	1582.9446638988604	0	0.9613700604988697								100.0	Confident
2143	Q14697	YRVPDVLVADPPIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39131 (Experiment 1)	39131	66.525	560.985962	3+	3+	1679.9358901203102	0	0.09892063941372899								97.76119402985076	Confident
2144	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32823 (Experiment 1)	32823	58.997	616.267456	2+	2+	1230.5209716027305	0	-0.4969725759169258	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 8: 0.0)	Phosphorylation of Y (3: 39.703315881326354)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
2145	P60709, P63261	KDLYANTVLSGGTTMYPGIADR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41268 (Experiment 1)	41268	69.552	808.381836	3+	3+	2422.1239769428003	0	-0.12302074193998255	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 2.2863038692227615)	Phosphorylation of Y (4: 86.98880985206675)		0	Y4-{Y4 Y16}	1	100.0	Confident
2146	P62851	AALQELLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37352 (Experiment 1)	37352	64.347	486.790161	2+	2+	971.5651461960301	0	0.6397733503842812								99.7289972899729	Confident
2147	P47756	KLEVEANNAFDQYR	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27861 (Experiment 1)	27861	53.243	592.936218	3+	3+	1775.7879787344605	0	-0.6488242256884483	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 93.36823734729494)	Y13	1		0	91.7910447761194	Doubtful
2148	Q02790	FDSSLDRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10966 (Experiment 1)	10966	30.436	484.245758	2+	2+	966.4770594676202	0	-0.09953751049769138								99.7289972899729	Confident
2149	P49321	EAQLYAAQAHLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20248 (Experiment 1)	20248	43.84	448.24173	3+	3+	1341.7040992803304	0	-0.5493169653322671								100.0	Confident
2150	P30086	LYTLVLTDPDAPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42362 (Experiment 1)	42362	71.289	781.419983	2+	2+	1559.8195229553903	1	1.6232666610344644								100.0	Confident
2151	P13639	TGTITTFEHAHNMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17898 (Experiment 1)	17898	40.807	539.259644	3+	3+	1614.7572741353406	0	-0.10603164317637721								100.0	Confident
2152	Q96ST3	RLDDQESPVYAAQQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20720 (Experiment 1)	20720	44.382	619.618103	3+	3+	1854.8261551483306	1	1.5984157251778202	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.03069466882067)	Y10	1		0	100.0	Confident
2153	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43473 (Experiment 1)	43473	73.222	895.950623	2+	2+	1789.88464239309	0	1.1444133080376742								99.73190348525469	Confident
2154	Q9H3P7	DCHEEVYAGSHQYPGR	Phosphorylation of Y(7)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15326 (Experiment 1)	15326	37.373	662.260376	3+	3+	1983.7570896123402	0	1.111843498344846	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 4.752026535875183)	Phosphorylation of Y (7: 19.3717277486911)		0	Y7-{Y7 Y13}	1	100.0	Confident
2155	P04843	SEDLLDYGPFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45738 (Experiment 1)	45738	78.181	656.316101	2+	2+	1310.61428121642	0	2.5657290683960947								99.72826086956522	Confident
2156	Q14566	DQVAIHEAMEQQTISITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33195 (Experiment 1)	33195	59.42	681.344238	3+	3+	2041.015004939641	0	-2.0157856294476826								100.0	Confident
2157	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29828 (Experiment 1)	29828	55.529	452.23053	3+	3+	1353.6693671719202	0	0.28999056297061243	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
2158	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36015 (Experiment 1)	36015	62.732	630.798218	2+	2+	1259.5798834611805	0	1.5849825725812665	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
2159	P30040	SLNILTAFQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45826 (Experiment 1)	45826	78.397	567.8302	2+	2+	1133.6444591458903	0	1.2221278312858344								100.0	Confident
2160	P40926	AGAGSATLSMAYAGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29302 (Experiment 1)	29302	54.923	727.856018	2+	2+	1453.6983622768903	0	-0.6039724628074578								99.73262032085562	Confident
2161	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33940 (Experiment 1)	33940	60.28	630.796692	2+	2+	1259.5798834611805	0	-0.8341783811929855	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2162	P62805	TVTAMDVVYALKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46414 (Experiment 1)	46414	79.433	773.888733	2+	2+	1545.7626159337606	0	0.19197376810050912	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2163	O00567	IINDNATYCR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15414 (Experiment 1)	15414	37.501	620.293945	2+	2+	1238.5713708586202	0	1.5849025190254962								96.52406417112299	Confident
2164	O00571, O15523	VRPCVVYGGADIGQQIR	Phosphorylation of Y(7)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30203 (Experiment 1)	30203	55.967	656.656677	3+	3+	1966.9448308123701	0	1.7110884471714531	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2165	P16615	SMSVYCTPNKPSR	Phosphorylation of Y(5)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13601 (Experiment 1)	13601	34.641	803.841492	2+	2+	1605.66806392592	0	0.22836625339749891	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2166	Q01469	MGAMAKPDCIITCDGK		Carbamidomethylation of C(9, 13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24653 (Experiment 1)	24653	49.504	589.935059	3+	3+	1766.78236887798	0	0.5530112229281593								100.0	Confident
2167	P00519	AGGKPSQSPSQEAAGEAVLGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19481 (Experiment 1)	19481	42.888	680.683289	3+	3+	2039.0283465046607	0	-0.151272040417774								100.0	Confident
2168	P78371	NIGVDNPAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15084 (Experiment 1)	15084	36.979	499.767242	2+	2+	997.5192586327705	0	0.6727472325653373								95.2755905511811	Confident
2169	P09874	LQLLEDDKENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22038 (Experiment 1)	22038	46.278	458.239502	3+	3+	1371.6994078227103	0	-1.9867468926188068								100.0	Confident
2170	Q99798	DGYAQILR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28707 (Experiment 1)	28707	54.237	508.234131	2+	2+	1014.4535607492501	0	0.145914194448493	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	100.0	Confident
2171	Q9H3P7	DCHEEVYAGSHQYPGR	Phosphorylation of Y(7)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15165 (Experiment 1)	15165	37.118	662.260254	3+	3+	1983.7570896123402	0	0.9276257193783144	Phosphorylation of Y (7: Random)	Phosphorylation of Y (7: 0.0, 13: 0.0)	Phosphorylation of Y (7: 92.84467713787086)		0	Y7-{Y7 Y13}	1	94.11764705882352	Confident
2172	Q9BUJ2	NYILDQTNVYGSAQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33411 (Experiment 1)	33411	59.667	607.94397	3+	3+	1820.8094424550304	0	0.34989230831993656	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 10.560577283333513)	Phosphorylation of Y (10: 87.16163853598408)		0	Y10-{Y2 Y10}	1	100.0	Confident
2173	P62805	DAVTYTEHAKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8855 (Experiment 1)	8855	26.356	457.541016	3+	3+	1369.6027441640804	0	-1.1114215391826918	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2174	Q9Y2W1	WEGLVYAPPGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39995 (Experiment 1)	39995	67.732	648.805237	2+	2+	1295.5951396025002	0	0.6022333835649274	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2175	P62993	NYVTPVNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13797 (Experiment 1)	13797	34.936	521.74115	2+	2+	1041.4644597861204	0	3.150307974827028	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.16055846422339)	Y2	1		0	99.1869918699187	Confident
2176	P40123, Q01518	VPTISINK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23207 (Experiment 1)	23207	47.69	436.26593	2+	2+	870.5174677276202	0	-0.18413220406424477								97.289972899729	Confident
2177	Q6P2Q9	TNHIYVSSDDIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21923 (Experiment 1)	21923	46.13	491.220642	3+	3+	1470.6391892424504	0	0.6157163025744308	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 91.97207678883072)	Y5	1		0	97.77777777777777	Confident
2178	Q9Y262	VYELQASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18075 (Experiment 1)	18075	41.103	483.256348	2+	2+	964.4977949122001	0	0.3602169974931813								99.73474801061008	Confident
2179	P09429	LGEMWNNTAADDKQPYEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27604 (Experiment 1)	27604	52.944	703.990784	3+	3+	2108.94731930264	0	1.5167347144236647								100.0	Confident
2180	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17534 (Experiment 1)	17534	40.336	798.837708	2+	2+	1595.6617155921804	0	-0.5336035974686074	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2181	Q9BV40	GENLEHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12763 (Experiment 1)	12763	33.362	484.251923	2+	2+	966.4882928576601	0	1.0327369922379892								99.73118279569893	Confident
2182	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22793 (Experiment 1)	22793	47.2	757.295593	3+	3+	2268.8644082151895	0	0.23829730800374674	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 8.312256458652044)	Phosphorylation of Y (6: 0.0)		0	Y6-{Y6 Y11 Y22}	1	100.0	Confident
2183	P29401	TSRPENAIIYNNNEDFQVGQAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29713 (Experiment 1)	29713	55.396	836.741882	3+	3+	2507.2040790205	0	-0.10454076477480792								100.0	Confident
2184	Q9NQR4	FAELAQIYAQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38056 (Experiment 1)	38056	65.205	695.331665	2+	2+	1388.6489660805103	0	-0.1359165116052207	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	99.46666666666667	Confident
2185	P14618	NTGIICTIGPASR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29971 (Experiment 1)	29971	55.695	680.358032	2+	2+	1358.6976340009	0	2.849291358591528								100.0	Confident
2186	P06576	VALVYGQMNEPPGAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31654 (Experiment 1)	31654	57.657	841.394531	2+	2+	1680.76949221935	0	2.981277984153631	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2187	Q96HC4	YTEFYHVPTHSDASK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19231 (Experiment 1)	19231	42.585	621.264587	3+	3+	1860.7719943171505	0	-0.033650495881147456	Phosphorylation of Y (1: Doubtfull)	Phosphorylation of Y (1: 11.10223872207746)	Phosphorylation of Y (1: 0.0)		0	Y1-{Y1 Y5}	1	96.99248120300751	Confident
2188	P55072	EMVELPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37796 (Experiment 1)	37796	64.886	493.770844	2+	2+	985.52665251233	0	0.48864193561606706								99.73958333333334	Confident
2189	Q96AE4	IGGDAGTSLNSNDYGYGGQK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23898 (Experiment 1)	23898	48.586	685.288208	3+	3+	2052.84259305811	0	0.0980324634543979	Phosphorylation of Y (14: Doubtfull)	Phosphorylation of Y (14: 5.743662580281907)	Phosphorylation of Y (14: 0.16155088852988692)		0	Y14-{Y14 Y16}	1	100.0	Confident
2190	P62269	IAFAITAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41240 (Experiment 1)	41240	69.517	474.299957	2+	2+	946.5851533646203	0	0.21895616710943064								92.43243243243244	Confident
2191	P00338	GEMMDLQHGSLFLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42195 (Experiment 1)	42195	71.032	545.266418	3+	3+	1632.7752326986001	0	1.3399589808056676								100.0	Confident
2192	P55209	YAVLYQPLFDK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45472 (Experiment 1)	45472	77.595	718.847656	2+	2+	1435.6788692264604	0	1.3144943743855195	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 11.282608434335703)	Phosphorylation of Y (5: 99.65095986038395)		0	Y5-{Y1 Y5}	1	99.45799457994579	Confident
2193	P55072	WALSQSNPSALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32687 (Experiment 1)	32687	58.842	665.349121	2+	2+	1328.6836981889203	0	-0.006855456892567981								99.45945945945947	Confident
2194	P09651, P22626, Q32P51	IFVGGIKEDTEEHHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20908 (Experiment 1)	20908	44.601	470.747711	4+	4+	1878.9588103928604	0	1.5548373232592316								100.0	Doubtful
2195	Q02790	AWDIAIATMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43474 (Experiment 1)	43474	73.223	560.297852	2+	2+	1118.5794163611802	0	1.5480229621887382								99.22077922077922	Confident
2196	P63279	KDHPFGFVAVPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28057 (Experiment 1)	28057	53.467	481.597412	3+	3+	1441.7717849173303	0	-0.9539893812674272								93.0379746835443	Doubtful
2197	P62937, PPIA_HUMAN	VKEGMNIVEAMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33861 (Experiment 1)	33861	60.186	753.378784	2+	2+	1504.7377845607205	0	3.471377163475048								99.46236559139786	Confident
2198	P62191, P62195, Q8NB90	GVLLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33886 (Experiment 1)	33886	60.214	619.812561	2+	2+	1237.6107896666401	0	-0.1779572075328599	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
2199	P27695	EGYSGVGLLSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34806 (Experiment 1)	34806	61.294	609.282471	2+	2+	1216.5489176860701	0	1.207471207842607	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2200	P07737	STGGAPTFNVTVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28600 (Experiment 1)	28600	54.11	690.361328	2+	2+	1378.7092442304204	0	-0.8264969771327152								99.47229551451187	Confident
2201	P55263	AGHYAASIIIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26355 (Experiment 1)	26355	51.482	417.879974	3+	3+	1250.61727202941	0	0.6545505424723573	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
2202	P05387	NIEDVIAQGIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44230 (Experiment 1)	44230	74.659	628.846252	2+	2+	1255.6772158261501	0	0.5845949254697622								100.0	Confident
2203	P63244	LWDLTTGTTTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37958 (Experiment 1)	37958	65.084	632.828979	2+	2+	1263.6459156978704	0	-1.983653244066685								99.73118279569893	Confident
2204	P47756	STLNEIYFGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39213 (Experiment 1)	39213	66.637	626.286865	2+	2+	1250.5584197406104	0	0.6046160839198972	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2205	Q15459	ASKPLPPAPAPDEYLVSPITGEK	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38386 (Experiment 1)	38386	65.614	819.749695	3+	3+	2456.2240082539	0	1.3204640275210469	Phosphorylation of Y (14: Very Confident)	Phosphorylation of Y (14: 100.0)	Phosphorylation of Y (14: 99.82547993019197)	Y14	1		0	99.28057553956835	Confident
2206	Q99661	GIYAMASR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20802 (Experiment 1)	20802	44.477	474.70459	2+	2+	947.3936033449802	0	1.078273226442856	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
2207	P50991	GIHPTIISESFQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29304 (Experiment 1)	29304	54.925	486.264221	3+	3+	1455.7721788401504	0	-0.9221593855736673								100.0	Confident
2208	O43390	GYAFITFCGK	Phosphorylation of Y(2)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43579 (Experiment 1)	43579	73.387	622.264709	2+	2+	1242.5144467536502	0	0.3361213164555523	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2209	Q9Y5V0	AALIYTCTVCR	Phosphorylation of Y(5)	Carbamidomethylation of C(7, 10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30292 (Experiment 1)	30292	56.069	704.310669	2+	2+	1406.6087581446502	0	-1.4007139161437516	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2210	P54646, Q13131	TSCGSPNYAAPEVISGR	Phosphorylation of Y(8)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26853 (Experiment 1)	26853	52.055	923.394226	2+	2+	1844.7764280745903	0	-1.3694068470288692	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2211	P38117	TALAMGADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16000 (Experiment 1)	16000	38.343	453.732056	2+	2+	904.4436511643601	1	2.816527231484748								95.6639566395664	Confident
2212	P49327	HGLYLPTR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26854 (Experiment 1)	26854	52.057	518.75238	2+	2+	1035.4902806111402	0	-0.07088618955125778	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.67689822294022)	Y4	1		0	99.73821989528795	Confident
2213	Q15393	DYIVVGSDSGR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24621 (Experiment 1)	24621	49.467	624.268127	2+	2+	1246.5230968610501	0	-1.1179435993866134	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2214	P30101	IFRDGEEAGAYDGPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20140 (Experiment 1)	20140	43.718	551.594604	3+	3+	1651.7590479571502	0	1.7734326363016968								100.0	Confident
2215	P0DKV0	QLEQYMGQRGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16607 (Experiment 1)	16607	39.09	455.896149	3+	3+	1364.66191719852	0	3.436760183491343								92.14285714285715	Doubtful
2216	P09429	KKHPDASVNFSEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19597 (Experiment 1)	19597	43.026	574.294373	3+	3+	1719.8580337224305	0	1.8897876764050632								100.0	Confident
2217	P14868	IYVISLAEPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41071 (Experiment 1)	41071	69.285	580.837341	2+	2+	1159.6601092100302	0	0.017092862884231272								99.73333333333333	Confident
2218	P13639	QFAEMYVAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31492 (Experiment 1)	31492	57.464	583.751709	2+	2+	1165.4878976526404	0	0.8286181626141284	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.73544973544973	Confident
2219	P49327	LSPDAIPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18892 (Experiment 1)	18892	42.161	449.255737	2+	2+	896.4967322830403	0	0.21010680548557542								92.44791666666666	Confident
2220	P36873, P62136, P62140	HDLDLICR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24234 (Experiment 1)	24234	49.01	521.261597	2+	2+	1040.5073140500801	0	1.2728906105895879								99.73890339425587	Confident
2221	P78527	GIFTSEIGTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32689 (Experiment 1)	32689	58.844	526.78418	2+	2+	1051.55497543515	0	-1.108962192553992								100.0	Confident
2222	P68371	INVYYNEATGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24564 (Experiment 1)	24564	49.403	664.827393	2+	2+	1327.64083031743	0	-0.44917732946663386								100.0	Confident
2223	P04083	GGPGSAVSPYPTFNPSSDVAALHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37959 (Experiment 1)	37959	65.086	786.05542	3+	3+	2355.1495242665	0	-2.1600071293251037								100.0	Confident
2224	P16401	ALAAGGYDVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20249 (Experiment 1)	20249	43.841	547.278748	2+	2+	1092.5451390274404	0	-2.0062506236981967								100.0	Confident
2225	P32119	RLSEDYGVLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21172 (Experiment 1)	21172	44.958	630.304993	2+	2+	1258.5958678784903	0	-0.34492187854749035	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 95.79967689822294)	Y6	1		0	95.2127659574468	Confident
2226	Q8N163	VQTLSNQPLLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27444 (Experiment 1)	27444	52.746	620.86676	2+	2+	1239.7186867153102	0	0.22577398805193927								99.45799457994579	Confident
2227	P50402	DSAYQSITHYRPVSASR	Phosphorylation of Y(4, 10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22537 (Experiment 1)	22537	46.897	699.96521	3+	3+	2096.8717986189404	0	0.9533723978574481	Phosphorylation of Y (4: Very Confident, 10: Very Confident)		Phosphorylation of Y (4: 100.0, 10: 100.0)	Y4, Y10	2		0	100.0	Confident
2228	P62937, PPIA_HUMAN	FEDENFILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39381 (Experiment 1)	39381	66.872	577.790161	2+	2+	1153.56554011885	0	0.19812345951649663								99.7289972899729	Confident
2229	Q99623	MLGEALSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21174 (Experiment 1)	21174	44.961	424.731354	2+	2+	847.4473395624702	0	0.960024120061411								96.22641509433963	Confident
2230	Q8NFD5	DMGAQYAAASPAWAAAQQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37190 (Experiment 1)	37190	64.153	1022.940613	2+	2+	2042.8669744144906	1	-1.7879695552081731	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 90.40139616055846)	Y6	1		0	96.50537634408603	Doubtful
2231	P61978	DLAGSIIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34145 (Experiment 1)	34145	60.528	437.255371	2+	2+	872.4967322830403	0	-0.6211659853042041								95.6639566395664	Confident
2232	P68104, Q5VTE0	EVSTYIKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10603 (Experiment 1)	10603	29.774	484.276398	2+	2+	966.5385970950204	0	-0.3655231974760695								99.45652173913044	Confident
2233	Q9H299	VYSTSVTGSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11473 (Experiment 1)	11473	31.283	568.753235	2+	2+	1135.4910684567803	0	0.7460267268949085	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2234	P23396	FIMESGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19652 (Experiment 1)	19652	43.097	441.723267	2+	2+	881.4316894983303	0	0.33003484737130967								100.0	Confident
2235	P48047	LVRPPVQVYGIEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31656 (Experiment 1)	31656	57.659	528.305908	3+	3+	1581.8991106887702	0	-2.0291795791197877								100.0	Confident
2236	Q9H0Q0, Q9NUQ9	VMLETPEYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28219 (Experiment 1)	28219	53.67	569.28064	2+	2+	1136.5535955361602	0	-6.03255043947348								99.7340425531915	Doubtful
2237	P23921	HPDYAILAAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22374 (Experiment 1)	22374	46.696	603.786926	2+	2+	1205.5594228001203	0	-0.10246473252761357	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2238	P05107	LGAILTPNDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26688 (Experiment 1)	26688	51.862	563.814087	2+	2+	1125.6142216467701	0	-0.5326047081155368								99.73262032085562	Confident
2239	Q16658	VTGTLDANR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10108 (Experiment 1)	10108	28.832	473.752594	2+	2+	945.4879585044903	0	2.824859938065554								100.0	Confident
2240	O95202	KLEEGGPVYSPPAEVVVKK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22538 (Experiment 1)	22538	46.9	702.702515	3+	3+	2105.0809728486706	0	2.2497721117087206	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.67689822294022)	Y9	1		0	100.0	Confident
2241	P61019, Q8WUD1	YIIIGDTGVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34565 (Experiment 1)	34565	61.019	568.321655	2+	2+	1134.6284747285802	0	0.24839618838413866								99.73262032085562	Confident
2242	Q86UX7	TGSGGPGNHPHGPDASAEGLNPYGLVAPR	Phosphorylation of Y(23)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29078 (Experiment 1)	29078	54.667	954.7724	3+	3+	2861.2882332581503	0	2.4918187127416065	Phosphorylation of Y (23: Very Confident)	Phosphorylation of Y (23: 100.0)	Phosphorylation of Y (23: 98.70759289176091)	Y23	1		0	97.74436090225565	Confident
2243	Q9BXS5, Q9Y6Q5	SGYQALPWVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43632 (Experiment 1)	43632	73.491	628.794678	2+	2+	1255.5750728642602	0	-0.21453571087303533	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2244	P62310	GDGVVLVAPPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38545 (Experiment 1)	38545	65.805	596.856018	2+	2+	1191.69755734791	0	-0.06222734419216874								100.0	Confident
2245	Q02790	LYANMFER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37707 (Experiment 1)	37707	64.783	562.236328	2+	2+	1122.4569318775302	0	1.0415460608529867	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	99.73333333333333	Confident
2246	P25787	LAQQYYLVYQEPIPTAQLVQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46754 (Experiment 1)	46754	79.952	867.776062	3+	3+	2600.3039899101004	0	0.9091022898429838	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 1.9083401175278722)	Phosphorylation of Y (9: 0.0)		0	Y9-{Y5 Y6 Y9}	1	100.0	Confident
2247	P60174	IAVAAQNCYK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15580 (Experiment 1)	15580	37.732	569.289856	2+	2+	1136.5648289262	0	0.2899579783190795								100.0	Confident
2248	Q16658	FLIVAHDDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23308 (Experiment 1)	23308	47.823	571.801819	2+	2+	1141.58800689893	0	0.9427815954673411								100.0	Confident
2249	P51991	SSGSPYGGGYGSGGGSGGYGSR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17559 (Experiment 1)	17559	40.366	995.88269	2+	2+	1989.7490270264398	0	0.9037417664694576	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 10.923954499582685)	Phosphorylation of Y (10: 0.0)		0	Y10-{Y6 Y10 Y19}	1	100.0	Confident
2250	Q92945	VQISPDSGGLPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24568 (Experiment 1)	24568	49.407	677.85144	2+	2+	1353.68884313901	0	-0.38066780360834235								99.72826086956522	Confident
2251	P42704	LIASYCNVGDIEGASK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33451 (Experiment 1)	33451	59.713	848.919556	2+	2+	1695.8137859519502	0	6.345231834578769								100.0	Doubtful
2252	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3, 8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26185 (Experiment 1)	26185	51.287	649.241577	2+	2+	1296.4716520593404	0	-2.3496537373951147	Phosphorylation of Y (3: Doubtfull, 8: Doubtfull)		Phosphorylation of Y (3: 74.93470752633057, 8: 14.921465968586386)		0	Y3-{Y3}, Y8-{Y8}	2	99.73190348525469	Confident
2253	P11586	GALALAQAVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30543 (Experiment 1)	30543	56.356	549.325195	2+	2+	1096.6352914445204	0	0.4966294386698318								100.0	Confident
2254	P61513	TVAGGAWTYNTTSAVTVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34304 (Experiment 1)	34304	60.714	913.968384	2+	2+	1825.9210279018107	0	0.6494564565772533								97.8319783197832	Confident
2255	P56537	NSLPDTVQIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27283 (Experiment 1)	27283	52.555	571.812378	2+	2+	1141.60913626633	0	0.9328243685105975								93.24324324324324	Confident
2256	Q5VWZ2	ASAVYQALQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21947 (Experiment 1)	21947	46.161	579.781616	2+	2+	1157.5481894100803	0	0.42227667171832606	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2257	Q1KMD3	NYYGYQGYR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25655 (Experiment 1)	25655	50.678	632.245178	2+	2+	1262.47575274581	0	0.0397951376988051	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0, 5: 0.0, 8: 0.0)	Phosphorylation of Y (2: 21.291448516579408)		0	Y2-{Y2 Y3 Y5 Y8}	1	99.73045822102425	Confident
2258	Q9UBQ5	YNPENLATLER	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33198 (Experiment 1)	33198	59.423	700.317017	2+	2+	1398.6180598750504	0	1.0146781620948424	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 100.0)	Y1	1		0	100.0	Confident
2259	P38159	SDLYSSGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9688 (Experiment 1)	9688	28.014	482.692139	2+	2+	963.3698906949401	0	-0.17156746732784067	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	100.0	Confident
2260	P49321	EAQLYAAQAHLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21763 (Experiment 1)	21763	45.9	474.8974	3+	3+	1421.6704298010804	0	-0.04155389776007094	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2261	Q9NYF8	TIAPQNAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10441 (Experiment 1)	10441	29.481	484.269775	2+	2+	966.5246783663802	0	0.3290522320498093								99.73890339425587	Confident
2262	P10809	APGFGDNRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7458 (Experiment 1)	7458	23.398	481.245667	2+	2+	960.4777281739603	0	-0.9840157710510373								100.0	Confident
2263	P49327	AGLYGLPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31907 (Experiment 1)	31907	57.952	463.728882	2+	2+	925.4422677895602	0	1.0170573926286426	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.5767366720517)	Y4	1		0	99.72972972972973	Confident
2264	P13639	SDPVVSYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17455 (Experiment 1)	17455	40.23	461.734985	2+	2+	921.4555957470502	0	-0.19348830538221587								99.73118279569893	Confident
2265	P04899, P08754, P09471, P63096	LFDSICNNK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26331 (Experiment 1)	26331	51.455	555.766235	2+	2+	1109.5175443806102	0	0.3352901519417593								100.0	Confident
2266	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21199 (Experiment 1)	21199	44.996	633.32428	2+	2+	1264.6339540318404	0	0.04186997043648676								97.55434782608695	Confident
2267	Q8IZQ5	LEAPELPVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31711 (Experiment 1)	31711	57.722	498.292358	2+	2+	994.5698972233004	0	0.26675418790564576								98.91598915989161	Confident
2268	P50897	ETIPLQETSLYTQDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37350 (Experiment 1)	37350	64.344	897.450317	2+	2+	1792.8843080399206	0	0.9878141291914331								100.0	Confident
2269	P09429	KHPDASVNFSEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23638 (Experiment 1)	23638	48.237	398.947815	4+	4+	1591.7630707084304	0	-0.5743703296435311								100.0	Doubtful
2270	P07741	DISPVLKDPASFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34891 (Experiment 1)	34891	61.395	482.264893	3+	3+	1443.7721788401502	0	0.463617771353647								100.0	Confident
2271	P06733	YISPDQLADLYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42526 (Experiment 1)	42526	71.559	753.350769	2+	2+	1504.6850768057104	0	1.266516980421224	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 18.151971076257574)	Phosphorylation of Y (11: 99.65095986038395)		0	Y11-{Y1 Y11}	1	100.0	Confident
2272	P07437, Q13509, Q13885, Q9BVA1	AILVDLEPGTMDSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43893 (Experiment 1)	43893	73.949	808.422974	2+	2+	1614.8287077401003	0	1.6620821206525822								100.0	Confident
2273	Q99832	QQLLIGAYAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33002 (Experiment 1)	33002	59.199	552.82373	2+	2+	1103.6338944621903	0	-0.893046805986541								99.73118279569893	Confident
2274	P63104	GIVDQSQQAYQEAFEISK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39497 (Experiment 1)	39497	67.038	707.655518	3+	3+	2119.9463298506607	0	-0.7561352674936053	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.82547993019197)	Y10	1		0	100.0	Confident
2275	P62249	GGGHVAQIYAIR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22432 (Experiment 1)	22432	46.768	661.324341	2+	2+	1320.6339847227102	0	0.10913229139489793	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2276	P14174	LLCGLLAER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39736 (Experiment 1)	39736	67.381	522.79718	2+	2+	1043.5797507143502	0	0.053894732878750164								99.47089947089947	Confident
2277	P13796, P13797, Q14651	KLENCNYAVELGK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23069 (Experiment 1)	23069	47.533	513.260681	3+	3+	1536.7606281802803	0	-0.26924629136361883								100.0	Confident
2278	P13639	GEGQLGPAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11725 (Experiment 1)	11725	31.672	507.254395	2+	2+	1012.4937721609201	0	0.4582569156334113								99.45799457994579	Confident
2279	P27824	IVDDWANDGWGLKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38218 (Experiment 1)	38218	65.402	539.607849	3+	3+	1615.7994562171502	0	1.396931479676061								99.24812030075188	Confident
2280	P06733	TIAPALVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21843 (Experiment 1)	21843	46.015	450.281403	2+	2+	898.5487678559002	0	-0.5716305697046051								100.0	Confident
2281	P11142	NQVAMNPTNTVFDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32583 (Experiment 1)	32583	58.724	825.40271	2+	2+	1648.7879055572805	0	1.7939815148838503								100.0	Confident
2282	Q8NFD5	DMGAQYAAASPAWAAAQQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37128 (Experiment 1)	37128	64.081	1022.439575	2+	2+	2042.8669744144906	0	-1.1625847673867644	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.54604200323102)	Y6	1		0	99.73262032085562	Doubtful
2283	Q00325	GVAPLWMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39236 (Experiment 1)	39236	66.672	465.255676	2+	2+	928.4952928144	0	1.6187383539333606								99.74226804123711	Confident
2284	P13796	AECMLQQAER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19507 (Experiment 1)	19507	42.919	618.280151	2+	2+	1234.5434418586203	0	1.8658306082994536								100.0	Confident
2285	Q9NQR4	AVDNQVYVATASPAR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23043 (Experiment 1)	23043	47.501	821.384705	2+	2+	1640.7559503301907	0	-0.6655000272634402	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2286	P62888	LVILANNCPALR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36344 (Experiment 1)	36344	63.15	677.388428	2+	2+	1352.75984033464	0	1.8178168615686128								100.0	Confident
2287	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36820 (Experiment 1)	36820	63.712	473.279663	2+	2+	944.5443511818	0	0.44570345729627614								98.72122762148338	Confident
2288	P49588	IVAVTGAEAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14213 (Experiment 1)	14213	35.621	543.810669	2+	2+	1085.6080736371705	0	-1.1847590912817185								96.22641509433963	Confident
2289	P83731	CESAFLSK		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19990 (Experiment 1)	19990	43.534	471.223145	2+	2+	940.4324177743201	0	-0.7222771839981185								99.7289972899729	Confident
2290	Q969T9	KGTVYLTPYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24655 (Experiment 1)	24655	49.507	639.319397	2+	2+	1276.6216887035102	0	1.9961602701828156	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 8.76745481691588)	Phosphorylation of Y (5: 5.977382875605816)		0	Y9-{Y5 Y9}	1	100.0	Confident
2291	Q15233	GIVEFSGKPAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19837 (Experiment 1)	19837	43.336	616.343811	2+	2+	1230.6720708760602	0	0.809768108400609								98.94179894179894	Confident
2292	P07195	MVVESAYEVIK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37101 (Experiment 1)	37101	64.05	674.316467	2+	2+	1346.6193057450105	0	-0.6856409756407921	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 97.20767888307155)	Y7	1		0	96.75675675675676	Confident
2293	P52597	GLPFGCTK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26434 (Experiment 1)	26434	51.574	440.223633	2+	2+	878.4320238515002	0	0.7828014715555373								99.72826086956522	Confident
2294	P51991	EDTEEYNLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19150 (Experiment 1)	19150	42.485	584.759277	2+	2+	1167.5043964142703	0	-0.33804317125660616								99.72972972972973	Confident
2295	P29692	FYEQMNGPVAGASR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27027 (Experiment 1)	27027	52.258	803.841248	2+	2+	1605.6646927976403	0	2.021714682240424	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2296	P54819	LQAYHTQTTPLIEYYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34645 (Experiment 1)	34645	61.109	666.344727	3+	3+	1996.0054262321103	0	3.464368699435669								100.0	Confident
2297	P62841	HGRPGIGATHSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4091 (Experiment 1)	4091	16.66	444.900024	3+	3+	1331.6806784971502	0	-1.8250490816675662								100.0	Confident
2298	P62241	LTPEEEEILNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30147 (Experiment 1)	30147	55.9	657.842529	2+	2+	1313.6714617393702	0	-0.7271286489825728								100.0	Confident
2299	Q02790	TQLAVCQQR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13602 (Experiment 1)	13602	34.643	552.284607	2+	2+	1102.55532687166	0	-0.6027733476314158								100.0	Confident
2300	O75083	VFASLPQVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33559 (Experiment 1)	33559	59.839	573.320007	2+	2+	1144.6240580544802	0	1.2235868234970544								98.92183288409704	Confident
2301	P33241	FVATGHGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4846 (Experiment 1)	4846	17.748	408.721771	2+	2+	815.4289870763901	0	0.0024344017735001447								99.72826086956522	Confident
2302	Q9ULW0	AQPVPHYGVPFKPQIPEAR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32518 (Experiment 1)	32518	58.652	737.709534	3+	3+	2210.1037739819203	0	1.3549242929943008	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2303	P13796, P13797	YAFVNWINK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45395 (Experiment 1)	45395	77.426	617.786926	2+	2+	1233.5583601709602	0	0.7598866935907259	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 100.0)	Y1	1		0	100.0	Confident
2304	P62805	TVTAMDVVYALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46528 (Experiment 1)	46528	79.61	655.854797	2+	2+	1309.6951743894106	0	-0.10164065418671504								100.0	Confident
2305	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30148 (Experiment 1)	30148	55.902	528.261597	2+	2+	1054.5100129962104	0	-1.298530936920847	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82608695652175)	Y7	1		0	100.0	Confident
2306	P62805	VFLENVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40121 (Experiment 1)	40121	67.887	495.292847	2+	2+	988.5705659296402	0	0.5806030444986635								100.0	Confident
2307	P09651, Q32P51	GFAFVTFDDHDSVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41764 (Experiment 1)	41764	70.318	567.258484	3+	3+	1698.7525655943803	0	0.6211194542627458								100.0	Confident
2308	P39687	KLELSDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11058 (Experiment 1)	11058	30.595	487.764404	2+	2+	973.5192586327703	0	-5.129054815789264								99.72826086956522	Doubtful
2309	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18040 (Experiment 1)	18040	41.033	506.239471	3+	3+	1515.6953850714303	0	0.7891713626427492								100.0	Confident
2310	P14625	SGYLLPDTK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30041 (Experiment 1)	30041	55.777	537.249756	2+	2+	1072.4841921711902	0	0.7137236681083517	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 94.02261712439419)	Y3	1		0	98.95287958115183	Confident
2311	Q5R372	GHTNAGDAIYEVVSLQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42024 (Experiment 1)	42024	70.746	637.299622	3+	3+	1908.8731053407505	0	2.0562106954519774	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.65095986038395)	Y10	1		0	100.0	Confident
2312	Q9H8W4	SFAVYAATATEK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31739 (Experiment 1)	31739	57.757	669.804321	2+	2+	1337.5904481448804	0	2.7179067653957087	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2313	P54577	NLQEVLGEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31238 (Experiment 1)	31238	57.164	579.804443	2+	2+	1157.5928174958503	0	1.3069686897014319								99.7289972899729	Confident
2314	P36578	PLISVYSEK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30542 (Experiment 1)	30542	56.354	558.273621	2+	2+	1114.5311423636103	0	1.3852570227292818	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.38219895287958)	Y6	1		0	97.289972899729	Confident
2315	P15311, P26038, P35241	KAPDFVFYAPR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38872 (Experiment 1)	38872	66.201	695.831177	2+	2+	1389.6482378045202	0	-0.31382469032801363	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2316	O15228	KEDVYSCFR	Phosphorylation of Y(5)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19233 (Experiment 1)	19233	42.586	642.260498	2+	2+	1282.5053386219302	0	0.8598110881221485	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.46949602122017	Confident
2317	P11142	DAGTIAGLNVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42285 (Experiment 1)	42285	71.173	600.341064	2+	2+	1198.66698549562	0	0.49103008316091								100.0	Confident
2318	P08238, Q58FF8	SIYYITGESK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30540 (Experiment 1)	30540	56.351	620.778992	2+	2+	1239.5424353233002	0	0.8020115750701439	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.16155088852988692)		0	Y3-{Y3 Y4}	1	100.0	Confident
2319	P13010	LFQCLLHR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32325 (Experiment 1)	32325	58.425	543.797668	2+	2+	1085.58041942069	0	0.3343576378241191								99.46091644204851	Confident
2320	P15880	GCTATLGNFAK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25097 (Experiment 1)	25097	50.021	570.278809	2+	2+	1138.5440934816202	0	-0.9016767769864009								99.73045822102425	Confident
2321	O94903	DLPAIQPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25573 (Experiment 1)	25573	50.582	455.762634	2+	2+	908.5079656730802	1	-0.6649418237823697								99.19571045576407	Confident
2322	Q9Y2L1	ASLTYAEAQLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32348 (Experiment 1)	32348	58.452	651.808716	2+	2+	1301.6016815349203	0	0.91862269269291	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.45945945945947	Confident
2323	P25705	ILGADTSVDLEETGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34067 (Experiment 1)	34067	60.435	788.3974	2+	2+	1574.7787803422202	0	0.9301942902607419								100.0	Confident
2324	O75368	IGFEEKDIAANEENRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20328 (Experiment 1)	20328	43.929	466.48703	4+	4+	1861.9170051505305	0	1.0766560779039949								100.0	Doubtful
2325	Q96AE4	GTPQQIDYAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16945 (Experiment 1)	16945	39.519	574.787659	2+	2+	1147.5621860739102	0	-1.2361136809752218								100.0	Confident
2326	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14111 (Experiment 1)	14111	35.461	600.788452	2+	2+	1199.5587540937802	0	2.993552348949975	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2327	O75367	SIAFPSIGSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36841 (Experiment 1)	36841	63.739	546.299988	2+	2+	1090.57710786206	0	7.610532474405071								99.73333333333333	Doubtful
2328	P26641	EYFSWEGAFQHVGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45998 (Experiment 1)	45998	78.744	882.875305	2+	2+	1763.7344866096205	0	0.8893997506139998	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2329	P22102	IYSHSLLPVLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40982 (Experiment 1)	40982	69.149	689.369812	2+	2+	1376.7217370979502	0	2.4181335109946906	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 97.38219895287958)	Y2	1		0	99.1869918699187	Confident
2330	P01889, P01893, P03989, P04222, P04439, P05534, P10319, P13746, P13747, P16188, P17693, P18463, P18464, P18465, P30443, P30447, P30455, P30460, P30461, P30462, P30464, P30466, P30475, P30479, P30480, P30481, P30483, P30484, P30485, P30487, P30488, P30490, P30491, P30492, P30493, P30495, P30498, P30501, P30504, P30505, P30508, P30510, P30685, Q04826, Q07000, Q29718, Q29836, Q29865, Q29940, Q29960, Q29963, Q95365, Q9TNN7	WAAVVVPSGEEQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31996 (Experiment 1)	31996	58.052	714.367798	2+	2+	1426.7204776204603	0	0.3957668171034933								92.9539295392954	Confident
2331	P27695	ICSWNVDGLR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36345 (Experiment 1)	36345	63.152	610.297852	2+	2+	1218.5815416195	0	-0.31996917397754876								100.0	Confident
2332	P55884	FSHQGVQLIDFSPCER		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38544 (Experiment 1)	38544	65.804	640.641479	3+	3+	1918.89958126458	0	1.5746403402599678								97.84172661870504	Confident
2333	Q06830	IGHPAPNFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12311 (Experiment 1)	12311	32.654	490.76947	2+	2+	979.5239500903901	0	0.44519495120827324								100.0	Confident
2334	P02786	HPVTGQFLYQDSNWASK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36511 (Experiment 1)	36511	63.346	686.642883	3+	3+	2056.9044054690303	0	1.17194999150316	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2335	P62249	VKGGGHVAQIYAIR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18042 (Experiment 1)	18042	41.035	516.940002	3+	3+	1547.7973616497004	0	0.5254963753707144	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.83844911147011)	Y11	1		0	100.0	Confident
2336	P10809	GANPVEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15858 (Experiment 1)	15858	38.146	428.237885	2+	2+	854.4610154806601	0	0.2353665690503774								99.45799457994579	Confident
2337	P61011	DMYEQFQNIMK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45737 (Experiment 1)	45737	78.18	763.806519	2+	2+	1525.5982530306003	0	0.15189436395092187	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.03315881326353)	Y3	1		0	99.19571045576407	Confident
2338	P50395	VTEGSFVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23616 (Experiment 1)	23616	48.21	555.24884	2+	2+	1108.4841921711904	0	-0.959122934031147	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2339	P37802, Q9UI15	GASQAGMTGYGMPR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22183 (Experiment 1)	22183	46.462	732.29364	2+	2+	1462.57343526509	0	-0.48354808305892083	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 98.86914378029078)	Y10	1		0	99.46091644204851	Confident
2340	P26641	QAFPNTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12369 (Experiment 1)	12369	32.748	474.237061	2+	2+	946.4620781098201	0	-2.645340287754244								96.24664879356568	Confident
2341	Q14566	TSILAAANPISGHYDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33450 (Experiment 1)	33450	59.712	562.626221	3+	3+	1684.8532826951603	0	2.1037720020062434								100.0	Confident
2342	O60361, P15531, P22392	VMLGETNPADSKPGTIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21844 (Experiment 1)	21844	46.018	595.97699	3+	3+	1784.9090833191203	0	0.03203728023087967								100.0	Confident
2343	Q16629	AFSYYGPLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39890 (Experiment 1)	39890	67.585	577.256226	2+	2+	1152.50051094167	0	-2.262313741850417	Phosphorylation of Y (5: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.5235602094240838)		0	Y5-{Y4 Y5}	1	100.0	Confident
2344	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27525 (Experiment 1)	27525	52.842	523.252075	2+	2+	1044.4892775516303	0	0.3053163650836789	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
2345	P61247	TSYAQHQQVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5318 (Experiment 1)	5318	18.808	649.28894	2+	2+	1296.5612137052703	0	1.6274453596400487	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2346	P55884	DQYSVIFESGDR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37932 (Experiment 1)	37932	65.05	748.308105	2+	2+	1494.6028037337303	0	-0.7661726956623166	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2347	P0DMV8, P17066, P34931, P48741	ATAGDTHLGGEDFDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18977 (Experiment 1)	18977	42.264	559.249329	3+	3+	1674.7233907244204	0	1.6491628827376532								100.0	Confident
2348	P11279	TVESITDIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26938 (Experiment 1)	26938	52.153	517.279663	2+	2+	1032.5451390274402	0	-0.3537360551870891								100.0	Confident
2349	P50402	DSAYQSITHYRPVSASR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24759 (Experiment 1)	24759	49.628	673.309265	3+	3+	2016.9054680981903	0	0.2462966733235756	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 8.249468548842493)	Phosphorylation of Y (4: 65.70680628272252)		0	Y10-{Y4 Y10}	1	100.0	Confident
2350	Q99733	KYAALYQPLFDK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39908 (Experiment 1)	39908	67.61	768.875366	2+	2+	1535.7425321121802	0	-4.1313715060709635	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 6: 0.0)	Phosphorylation of Y (2: 0.6462035541195477)		0	Y2-{Y2 Y6}	1	99.74358974358975	Confident
2351	P14868	TSTSQAVFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15585 (Experiment 1)	15585	37.737	498.759491	2+	2+	995.5036085686304	0	0.8225391550763096								100.0	Confident
2352	P22626	SGNFGGSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6506 (Experiment 1)	6506	21.085	391.182922	2+	2+	780.3514650316802	0	-0.22235795017727505								100.0	Confident
2353	P52565	TDYMVGSYGPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28961 (Experiment 1)	28961	54.531	663.264771	2+	2+	1324.51590330563	0	-0.6891958264835907	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 4.788508429081698)	Phosphorylation of Y (3: 99.03069466882067)		0	Y3-{Y3 Y8}	1	99.72826086956522	Confident
2354	P54819	AVLLGPPGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25242 (Experiment 1)	25242	50.19	490.300049	2+	2+	978.5862159937801	0	-0.6842003650112152								98.75311720698254	Confident
2355	P31942	DGMDNQGGYGSVGR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15087 (Experiment 1)	15087	36.984	746.780151	2+	2+	1491.54497158778	0	0.5205541413648428	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2356	Q10472	HYFSLGEIR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35754 (Experiment 1)	35754	62.412	601.274231	2+	2+	1200.53287369911	0	0.860978322231185	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 86.03839441535777)	Y2	1		0	95.32467532467533	Confident
2357	O75821	VTNLSEDTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11554 (Experiment 1)	11554	31.392	517.758606	2+	2+	1033.5040024914504	0	-1.2973452455288883								99.73474801061008	Confident
2358	Q02790	VGEVCHITCKPEYAYGSAGSPPK		Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20223 (Experiment 1)	20223	43.812	627.549133	4+	4+	2506.16208017949	0	2.129699638480118								100.0	Doubtful
2359	Q9BSJ8	LLAETVAPAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28138 (Experiment 1)	28138	53.565	570.343384	2+	2+	1138.6710082469003	0	1.057977339790913								100.0	Confident
2360	P31949	DGYNYTLSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21311 (Experiment 1)	21311	45.166	570.733521	2+	2+	1139.4536203189004	0	-0.9910504305852058	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 16.86685734877816)	Phosphorylation of Y (3: 32.55250403877221)		0	Y5-{Y3 Y5}	1	100.0	Confident
2361	P39023	VIAHTQMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6868 (Experiment 1)	6868	21.95	478.262543	2+	2+	954.5069201272602	0	3.7771646718343797								92.76485788113695	Confident
2362	P08865	SDGIYIINLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45735 (Experiment 1)	45735	78.178	608.304688	2+	2+	1214.5948052493304	0	0.014644836837527462	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.50959860383944)	Y5	1		0	99.7289972899729	Confident
2363	P15311, P26038, P35241	KAPDFVFYAPR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38870 (Experiment 1)	38870	66.199	464.223602	3+	3+	1389.6482378045202	0	0.5304882047692133	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.65095986038395)	Y8	1		0	100.0	Confident
2364	P61158	KDYEEIGPSICR	Phosphorylation of Y(3)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23394 (Experiment 1)	23394	47.931	773.833313	2+	2+	1545.6534594076	0	-0.8957613732911134	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 93.36823734729494)	Y3	1		0	98.94459102902374	Confident
2365	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	RNLDIERPTYTNLNR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21699 (Experiment 1)	21699	45.812	652.322144	3+	3+	1953.94218796008	0	1.2338701491964594	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
2366	Q8NDV3	YFYKKMLTR	Phosphorylation of Y(1, 3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25077 (Experiment 1)	25077	49.998	705.305542	2+	2+	1408.6015611134203	0	-3.5658511160241764	Phosphorylation of Y (1: Very Confident, 3: Very Confident)		Phosphorylation of Y (1: 96.33507853403141, 3: 96.33507853403141)	Y1, Y3	2		0	96.19565217391303	Confident
2367	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17706 (Experiment 1)	17706	40.563	532.895386	3+	3+	1595.6617155921804	0	1.634474434935863	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2368	P49327	LSIPTYGLQCTR	Phosphorylation of Y(6)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38542 (Experiment 1)	38542	65.802	744.848083	2+	2+	1487.68436561306	0	-1.847720133181902	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	99.45799457994579	Confident
2369	P07900	KFYEQFSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19735 (Experiment 1)	19735	43.207	578.757446	2+	2+	1155.5001765885004	0	0.14036786854472275	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 91.97207678883072)	Y3	1		0	96.4769647696477	Confident
2370	P33992	VLGIQVDTDGSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31407 (Experiment 1)	31407	57.362	658.844238	2+	2+	1315.6731930748701	0	0.5539943040082301								100.0	Confident
2371	P23396	IMLPWDPTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46752 (Experiment 1)	46752	79.95	579.304443	2+	2+	1156.5950664253203	0	-0.6329646605644685								95.6639566395664	Confident
2372	P06493, P24941, Q00526	IGEGTYGVVYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26660 (Experiment 1)	26660	51.83	633.294006	2+	2+	1264.5740698047505	0	-0.4821915843274898	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 7.218395230764212)	Phosphorylation of Y (6: 94.02261712439419)		0	Y10-{Y6 Y10}	1	98.91598915989161	Confident
2373	Q92945	SVSLTGAPESVQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21090 (Experiment 1)	21090	44.842	651.848755	2+	2+	1301.6826951294104	0	0.2009185536236557								100.0	Confident
2374	P30101	FVMQEEFSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33435 (Experiment 1)	33435	59.694	586.77478	2+	2+	1171.5331944447503	0	1.5445657235109354								100.0	Confident
2375	P07900	RAPFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39906 (Experiment 1)	39906	67.607	632.825195	2+	2+	1263.6360197205104	0	-0.14431640015957997								98.66666666666667	Confident
2376	A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65	EDAANNYAR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.36 min, Period: 1, Cycle(s): 6624 (Experiment 1)	6624	21.34	552.211304	2+	2+	1102.4080671088102	0	-0.010903827978044161	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2377	O43175	GTIQVITQGTSLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31737 (Experiment 1)	31737	57.755	673.388367	4+	2+	1344.76127980328	0	0.6692005260835061								96.46739130434783	Confident
2378	Q8TEM1	VYVSDNIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18976 (Experiment 1)	18976	42.263	483.257385	2+	2+	964.4977949122001	0	2.5060768042673085								92.80000000000001	Confident
2379	P55072	ELQELVQYPVEHPDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32825 (Experiment 1)	32825	59.0	608.644409	3+	3+	1822.9101288649406	0	0.6948422243587367								99.28057553956835	Confident
2380	P62906	DTLYEAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25847 (Experiment 1)	25847	50.897	483.747406	2+	2+	965.4818104948902	0	-1.6035497110963222								99.73333333333333	Confident
2381	P18124	KAGNFYVPAEPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21091 (Experiment 1)	21091	44.843	440.90329	3+	3+	1319.6873865870305	0	0.49444921512749695								100.0	Confident
2382	P38159, Q96E39	DSYESYGNSR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11556 (Experiment 1)	11556	31.394	629.224426	2+	2+	1256.4346757794704	0	-0.29934707409367395	Phosphorylation of Y (6: Random)	Phosphorylation of Y (3: 0.0, 6: 0.0)	Phosphorylation of Y (6: 67.4266832643796)		0	Y6-{Y3 Y6}	1	96.22641509433963	Confident
2383	Q02790	LQAFSAAIESCNK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31131 (Experiment 1)	31131	57.041	719.853394	2+	2+	1437.6922142672904	0	0.014446751157199442								100.0	Confident
2384	P37837	ALAGCDFLTISPK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42283 (Experiment 1)	42283	71.17	696.863159	2+	2+	1391.7118870827103	0	-0.08754683196134752								99.46091644204851	Confident
2385	P35579	ELEDATETADAMNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23613 (Experiment 1)	23613	48.206	783.342651	2+	2+	1564.6675156410802	0	2.0638681967662573								96.22641509433963	Confident
2386	P14625	EEASDYLELDTIK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42021 (Experiment 1)	42021	70.738	803.352234	2+	2+	1604.6858646513504	0	2.520952245404823	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 95.15347334410339)	Y6	1		0	99.49622166246851	Confident
2387	Q8TAQ2, Q92922	SKTPEIYLAYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32827 (Experiment 1)	32827	59.002	474.234344	3+	3+	1419.6799318556202	0	0.8931906732044633	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 4.505364436250828)	Phosphorylation of Y (7: 99.83844911147011)		0	Y7-{Y7 Y10}	1	100.0	Confident
2388	Q99623	LLLGAGAVAYGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40676 (Experiment 1)	40676	68.713	630.376221	2+	2+	1258.7397565130602	0	-1.4812138022514465								98.91598915989161	Confident
2389	Q9UKK9	VYSYALALK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37855 (Experiment 1)	37855	64.956	554.278625	3+	2+	1106.5413131244902	0	1.2484187112979086	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.33452891645359)	Phosphorylation of Y (2: 98.86914378029078)		0	Y2-{Y2 Y4}	1	98.93048128342245	Confident
2390	O00231	TTANAIYCPPK	Phosphorylation of Y(7)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16389 (Experiment 1)	16389	38.828	658.292114	2+	2+	1314.5679388784902	0	1.3187080159608537	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73333333333333	Confident
2391	Q12934	EPETPTELYTKER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32416 (Experiment 1)	32416	58.532	796.886536	2+	2+	1591.7729666857902	0	-9.064959561103102								96.53333333333333	Doubtful
2392	P50990	DIDEVSSLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43983 (Experiment 1)	43983	74.108	573.803711	2+	2+	1145.59281749585	0	0.04493742991967124								100.0	Confident
2393	P31040	IDEYDYSKPIQGQQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20325 (Experiment 1)	20325	43.924	631.28772	3+	3+	1890.8400738769703	0	0.6635766798618976	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 7.880043408382123)	Phosphorylation of Y (4: 0.0)		0	Y4-{Y4 Y6}	1	100.0	Confident
2394	Q96IV0	EVEDHYCDACQFSNR	Phosphorylation of Y(6)	Carbamidomethylation of C(7, 10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18997 (Experiment 1)	18997	42.288	670.911865	3+	3+	2008.7080908145904	1	1.15321005590644	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.03315881326353)	Y6	1		0	92.46575342465754	Doubtful
2395	P04406	RVIISAPSADAPMFVMGVNHEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38547 (Experiment 1)	38547	65.807	790.736755	3+	3+	2368.20315714583	1	-7.623226040895723								100.0	Doubtful
2396	P30086	LYEQLSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18152 (Experiment 1)	18152	41.202	469.252869	2+	2+	936.4916469026002	0	-0.49209714786170966								99.45945945945947	Confident
2397	O60361, P15531, P22392	VMLGETNPADSKPGTIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22034 (Experiment 1)	22034	46.274	595.977051	3+	3+	1784.9090833191203	0	0.13439022831021866								100.0	Confident
2398	P61313	GATYGKPVHHGVNQLK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7352 (Experiment 1)	7352	23.156	595.964844	3+	3+	1784.8723174951103	0	0.2153955558575198	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2399	P41091, Q2VIR3	IVLTNPVCTEVGEK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33714 (Experiment 1)	33714	60.016	779.911255	2+	2+	1557.8072440195303	0	0.4571335308103424								99.1869918699187	Confident
2400	P62873, P62879, Q9HAV0	AGVLAGHDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7257 (Experiment 1)	7257	22.964	505.261444	2+	2+	1008.5100909314001	0	-1.737577638221561								99.75247524752476	Confident
2401	Q15393	HIANYISGIQTIGHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29325 (Experiment 1)	29325	54.949	560.637695	3+	3+	1678.8903369102202	0	0.5462171938203505								100.0	Confident
2402	A8MTJ3, P04899, P08754, P09471, P11488, P19087, P38405, P63092, P63096, Q03113, Q14344, Q5JWF2	LLLLGAGESGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35991 (Experiment 1)	35991	62.7	529.316895	2+	2+	1056.6179100448803	0	1.253524279704063								96.49595687331536	Confident
2403	Q04912	SMEYLAEQKFVHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.31 min, Period: 1, Cycle(s): 5239 (Experiment 1)	5239	18.618	819.414917	2+	2+	1636.8031616986007	0	7.39518963389106								96.19565217391303	Doubtful
2404	O15144	DYLHYHIK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19835 (Experiment 1)	19835	43.333	584.763855	2+	2+	1167.5114099785403	0	1.4938427115037378	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 5.633223415363209)	Phosphorylation of Y (2: 87.7221324717286)		0	Y2-{Y2 Y5}	1	97.5609756097561	Confident
2405	P07900, Q58FG0	TKFENLCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12490 (Experiment 1)	12490	32.933	520.265686	2+	2+	1038.5168161046201	0	0.002846387638718541								92.40837696335078	Confident
2406	P27797	IKDPDASKPEDWDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17725 (Experiment 1)	17725	40.586	600.951843	3+	3+	1799.8326068202302	0	0.6061384168694762								100.0	Confident
2407	P10809	GYISPYFINTSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41050 (Experiment 1)	41050	69.255	735.340515	2+	2+	1468.6639474383103	0	1.720041507978392	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 17.845058675886186)	Phosphorylation of Y (6: 64.71613029204653)		0	Y6-{Y2 Y6}	1	99.72826086956522	Confident
2408	P36578	KLDELYGTWR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34140 (Experiment 1)	34140	60.522	680.817993	2+	2+	1359.6224169795003	0	-0.7225957770987158	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2409	P60900	YGYEIPVDMLCK	Phosphorylation of Y(1)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45573 (Experiment 1)	45573	77.826	784.333069	2+	2+	1566.6499542502902	0	1.039620695336303	Phosphorylation of Y (1: Doubtfull)	Phosphorylation of Y (1: 8.913534624122764)	Phosphorylation of Y (1: 0.0)		0	Y1-{Y1 Y3}	1	99.72972972972973	Confident
2410	Q15233	HEHQVMLMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12340 (Experiment 1)	12340	32.704	394.195618	3+	3+	1179.5641177335501	0	0.7668499834291823								99.28057553956835	Confident
2411	P18124	IALTDNALIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36510 (Experiment 1)	36510	63.345	585.846741	2+	2+	1169.6768219033302	0	1.7983942622149731								100.0	Confident
2412	P12268	TSSAQVEGGVHSLHSYEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16773 (Experiment 1)	16773	39.295	479.733704	4+	4+	1914.9071687428207	0	-0.7601138652001183								77.77777777777779	Doubtful
2413	Q07955	DGTGVVEFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34747 (Experiment 1)	34747	61.225	539.780518	2+	2+	1077.5454733806102	0	0.9352752427426345								100.0	Confident
2414	Q9Y6E2	LLELFPVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45212 (Experiment 1)	45212	77.033	550.824524	2+	2+	1099.6389798426303	0	-4.070949823176951								99.73474801061008	Confident
2415	P26641	EYFSWEGAFQHVGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45849 (Experiment 1)	45849	78.449	588.919434	3+	3+	1763.7344866096205	0	1.1240882093329638	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 97.03315881326353)	Y2	1		0	92.46575342465754	Doubtful
2416	P33991	DMFEEALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39849 (Experiment 1)	39849	67.523	505.734253	2+	2+	1009.4538814948901	0	0.07075997985704233								99.45652173913044	Confident
2417	P0DMV8, P11142, P17066, P34931, P48741, P54652	TTPSYVAFTDTER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32666 (Experiment 1)	32666	58.818	744.354736	2+	2+	1486.6939880891005	0	0.6253589938851872								100.0	Confident
2418	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38796 (Experiment 1)	38796	66.112	912.997498	2+	2+	1823.9781488551102	0	1.2564186391653864								100.0	Confident
2419	Q9BVC6	EAPVDVLTQIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43495 (Experiment 1)	43495	73.255	649.358582	2+	2+	1296.7037649271601	0	-0.8884611609013251								93.65079365079364	Confident
2420	P15531, P22392	TFIAIKPDGVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26199 (Experiment 1)	26199	51.302	448.92627	3+	3+	1343.7561348531901	0	0.6279775852359188								100.0	Confident
2421	P46782	YLPHSAGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7478 (Experiment 1)	7478	23.444	450.738251	2+	2+	899.4613498338301	0	0.6647238646067174								97.289972899729	Confident
2422	P09874	ASLCISTK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17726 (Experiment 1)	17726	40.589	440.235596	2+	2+	878.4531532189001	0	3.9590861216458255								96.19565217391303	Confident
2423	P21796	YQIDPDACFSAK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32665 (Experiment 1)	32665	58.816	707.818298	2+	2+	1413.6234660011303	0	-1.0051543793970785								99.72972972972973	Confident
2424	P62491, Q15907	AQIWDTAGQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26682 (Experiment 1)	26682	51.856	637.809998	2+	2+	1273.60511351505	0	0.2583460684377866								99.73474801061008	Confident
2425	P13995	LVGDVDFEGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36261 (Experiment 1)	36261	63.053	603.315979	2+	2+	1204.6088019131603	0	7.1299409057186205								99.45945945945947	Doubtful
2426	P43487	ICANHYITPMMELKPNAGSDR	Phosphorylation of Y(6)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37375 (Experiment 1)	37375	64.376	833.373901	3+	3+	2497.09533675015	0	1.8146547190524578	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2427	P62701	FDTGNLCMVTGGANLGR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41007 (Experiment 1)	41007	69.184	891.917969	2+	2+	1781.8188884157298	0	1.3995985208641042								100.0	Confident
2428	P13798	AESFFQTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27384 (Experiment 1)	27384	52.676	479.237946	2+	2+	956.4603467743202	0	1.0352822553979903								97.55434782608695	Confident
2429	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19574 (Experiment 1)	19574	42.997	636.766907	2+	2+	1271.5183458337801	0	0.718656421441768	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2430	P11142, P17066, P54652	LLQDFFNGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42606 (Experiment 1)	42606	71.703	541.287109	2+	2+	1080.5603951687601	0	-0.6744127836833671								99.7340425531915	Confident
2431	Q08170, Q13247	QAGEVTYADAHK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 9020 (Experiment 1)	9020	26.666	685.29248	2+	2+	1368.5711096826305	0	-0.5126394314116206	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.50959860383944)	Y7	1		0	99.45799457994579	Confident
2432	ALDOA_RABIT, P04075	ELSDIAHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13124 (Experiment 1)	13124	33.905	470.746185	2+	2+	939.4773938207902	0	0.4495477495904673								99.74093264248705	Confident
2433	P14618	LDIDSPPITAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31812 (Experiment 1)	31812	57.842	599.327637	2+	2+	1196.64010204144	0	0.5164330970471174								100.0	Confident
2434	P04080	VHVGDEDFVHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27385 (Experiment 1)	27385	52.677	474.909424	3+	3+	1421.7051619094902	0	0.8989020924884251								100.0	Confident
2435	P27348	YLIANATNPESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23537 (Experiment 1)	23537	48.111	660.843689	2+	2+	1319.6721304457103	0	0.5255562262688566								100.0	Confident
2436	P28062	ASAGSYISALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31908 (Experiment 1)	31908	57.953	548.293091	2+	2+	1094.5720224816203	0	-0.3587635059639382								100.0	Confident
2437	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(22)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25166 (Experiment 1)	25166	50.1	1135.440308	2+	2+	2268.8644082151895	0	0.7287271644781662	Phosphorylation of Y (22: Doubtfull)	Phosphorylation of Y (22: 7.097466240474155)	Phosphorylation of Y (11: 0.0)		0	Y22-{Y6 Y11 Y22}	1	100.0	Confident
2438	P49327	TGTVSLEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21526 (Experiment 1)	21526	45.518	481.26944	2+	2+	960.5240096600403	0	0.3297596045231612								99.1869918699187	Confident
2439	P38646	VLENAEGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9687 (Experiment 1)	9687	28.011	479.75116	2+	2+	957.4879585044903	0	-0.19951809595194162								98.91598915989161	Confident
2440	P06748	ADKDYHFKVDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21250 (Experiment 1)	21250	45.076	515.446533	5+	5+	2572.1942426127903	0	0.7915679452666027								100.0	Doubtful
2441	P62753	DIPGLTDTTVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36537 (Experiment 1)	36537	63.375	642.843689	2+	2+	1283.6721304457103	0	0.5402721165322206								100.0	Confident
2442	P0CG47, P0CG48, P62979, P62987	TLSDYNIQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20063 (Experiment 1)	20063	43.625	581.263489	2+	2+	1160.5114695481905	0	0.8219327283979636	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82578397212544)	Y5	1		0	100.0	Confident
2443	P52948	LYQTPLELK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35486 (Experiment 1)	35486	62.083	592.801453	2+	2+	1183.5889915929004	0	-0.5385666459703403	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.76898222940227)	Y2	1		0	99.45799457994579	Confident
2444	P62851	DKLNNLVLFDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38878 (Experiment 1)	38878	66.21	659.872742	2+	2+	1317.7292513990103	0	1.2727222966039067								99.1869918699187	Confident
2445	P18621	EQIVPKPEEEVAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18586 (Experiment 1)	18586	41.776	541.95752	3+	3+	1622.8515513596608	0	-0.5048118176709612								100.0	Confident
2446	P36542	THSDQFLVAFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35006 (Experiment 1)	35006	61.531	431.559174	3+	3+	1291.6560864587505	0	-0.3042140301617105								100.0	Confident
2447	P26196	GVTQYYAYVTER	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37774 (Experiment 1)	37774	64.86	765.33783	2+	2+	1528.6599246870305	0	0.7724564319350236	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0, 8: 0.0)	Phosphorylation of Y (5: 0.17452006980802792)		0	Y5-{Y5 Y6 Y8}	1	100.0	Confident
2448	P61978	VVLIGGKPDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15854 (Experiment 1)	15854	38.141	527.324463	2+	2+	1052.63422881536	0	0.13677635469772673								99.74358974358975	Confident
2449	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1	NMMAACDPR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15936 (Experiment 1)	15936	38.259	533.217529	2+	2+	1064.4201559218	0	0.3273942352229637								100.0	Confident
2450	P60174	IIYGGSVTGATCK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21608 (Experiment 1)	21608	45.651	663.840454	2+	2+	1325.66493689029	0	1.0681614778510509								100.0	Confident
2451	P13667	QLEPVYNSLAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29530 (Experiment 1)	29530	55.185	671.325012	2+	2+	1340.6377326904706	0	-1.6844451231992166	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.47643979057592)	Y6	1		0	99.7289972899729	Confident
2452	P35232	NVPVITGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17512 (Experiment 1)	17512	40.306	457.768982	2+	2+	913.52328138405	0	0.14164605891542836								99.73684210526315	Confident
2453	P23246	GIVEFASKPAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21445 (Experiment 1)	21445	45.361	415.903076	3+	3+	1244.6877209402003	0	-0.25834589162643173								100.0	Confident
2454	P68363, P68366, Q13748, Q71U36, Q9BQE3	LSVDYGKK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10368 (Experiment 1)	10368	29.317	495.2388	2+	2+	988.4630628037903	0	-0.01588871260041895	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
2455	P07900, P08238, Q12931, Q58FF7	GVVDSEDLPLNISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40259 (Experiment 1)	40259	68.115	757.396484	2+	2+	1512.7783864194002	0	0.0189114794735476								100.0	Confident
2456	TRYP_PIG	VATVSLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22379 (Experiment 1)	22379	46.702	421.758514	2+	2+	841.5021520166501	0	0.382979642282311								100.0	Confident
2457	P14618, P30613	GDLGIEIPAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35415 (Experiment 1)	35415	62.002	571.308777	2+	2+	1140.6026539035604	0	0.30383125101752484								100.0	Confident
2458	P19338	EAMEDGEIDGNKVTLDWAKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34566 (Experiment 1)	34566	61.02	587.538086	4+	4+	2345.1209265601606	1	-0.4441032690389153								100.0	Doubtful
2459	P12268	GMGSLDAMDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24657 (Experiment 1)	24657	49.51	512.725159	2+	2+	1023.4365171785903	0	-0.7334452480811608								99.1869918699187	Confident
2460	O94921, P06239, P06241, P06493, P07947, P07948, P08631, P09769, P11362, P11802, P20794, P21802, P22455, P22607, P24941, P50750, P51451, Q00526, Q00534, Q00535, Q00536, Q00537, Q07002, Q14004, Q8IZL9, Q96Q40, Q9NYV4, Q9UPZ9	LADFGLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32801 (Experiment 1)	32801	58.973	431.742798	2+	2+	861.4708518883701	0	0.22140270682849605								99.74424552429667	Confident
2461	P09874	VVSEDFLQDVSASTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42091 (Experiment 1)	42091	70.859	812.907898	2+	2+	1623.7991814336303	0	1.2680620799470503								93.65079365079364	Confident
2462	Q969H8	SYLYFTQFK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45971 (Experiment 1)	45971	78.7	638.785217	2+	2+	1275.5576914646203	0	-1.4170613462005655	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 4: 0.0)	Phosphorylation of Y (2: 18.32460732984293)		0	Y2-{Y2 Y4}	1	100.0	Confident
2463	P31948	AAALEFLNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38444 (Experiment 1)	38444	65.685	502.780731	2+	2+	1003.5450794577903	0	1.819492874288432								100.0	Confident
2464	P78371	HGINCFINR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20804 (Experiment 1)	20804	44.479	565.779907	2+	2+	1129.54509654113	0	0.1453968828005508								98.92761394101876	Confident
2465	P23246	FAQHGTFEYEYSQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25344 (Experiment 1)	25344	50.308	614.919006	3+	3+	1841.7410285420403	0	-3.165687367983593	Phosphorylation of Y (9: Random)	Phosphorylation of Y (9: 0.0, 11: 0.0)	Phosphorylation of Y (9: 0.16155088852988692)		0	Y9-{Y9 Y11}	1	100.0	Confident
2466	P68104, Q05639, Q5VTE0	QTVAVGVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21595 (Experiment 1)	21595	45.633	457.787262	2+	2+	913.5596668927701	0	0.3322216805386323								100.0	Confident
2467	P41252	SDTPLIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24987 (Experiment 1)	24987	49.893	508.738556	2+	2+	1015.4627284506203	0	-0.1664747186443658	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.70759289176091)	Y7	1		0	99.7289972899729	Confident
2468	P63241, Q6IS14, Q9GZV4	KYEDICPSTHNMDVPNIKR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22559 (Experiment 1)	22559	46.924	580.031616	4+	4+	2316.09908600011	0	-0.744729263074561								100.0	Doubtful
2469	P38646	VINEPTAAALAYGLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41939 (Experiment 1)	41939	70.596	823.44696	2+	2+	1644.8722868042403	0	4.299179497169731								100.0	Confident
2470	P10412, P16402, P16403	KASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23457 (Experiment 1)	23457	48.006	442.926147	3+	3+	1325.7554661468505	0	0.8620351336073564								100.0	Confident
2471	P04080	VFQSLPHENKPLTLSNYQTNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27945 (Experiment 1)	27945	53.338	615.324768	4+	4+	2457.26522272508	0	1.9272005043482283								100.0	Doubtful
2472	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30295 (Experiment 1)	30295	56.072	609.260498	2+	2+	1216.5053215385904	0	0.9204017176637955	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 9.280802714116714)	Phosphorylation of Y (6: 1.3961605584642234)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
2473	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24179 (Experiment 1)	24179	48.937	420.235199	3+	3+	1257.68296991293	0	0.6327307030223298								99.28057553956835	Confident
2474	Q96C19	VFNPYTEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38280 (Experiment 1)	38280	65.474	572.786316	2+	2+	1143.5600608155903	0	-1.7299171878919688								93.65079365079364	Confident
2475	O60678	DFIYQNPHIFK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37704 (Experiment 1)	37704	64.78	501.23465	3+	3+	1500.6802662087905	0	1.2332168578016593	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2476	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36262 (Experiment 1)	36262	63.054	630.798828	2+	2+	1259.5798834611805	0	2.5520128357789917	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.86914378029078)	Y6	1		0	99.75247524752476	Confident
2477	P35268	ITVTSEVPFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33174 (Experiment 1)	33174	59.396	604.332764	2+	2+	1206.6496040959805	0	1.134285638698398								100.0	Confident
2478	Q8IYB8	NDIYSVSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15401 (Experiment 1)	15401	37.486	517.222412	2+	2+	1032.4277399242303	0	2.446866454463002	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	100.0	Confident
2479	P16150	TGALVLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21170 (Experiment 1)	21170	44.956	408.750671	2+	2+	815.4865019525103	0	0.351209168643822								92.74611398963731	Confident
2480	Q9NSD9	TYTIANQFPLNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39490 (Experiment 1)	39490	67.028	745.359375	2+	2+	1488.7013955761902	0	1.8792917513732155	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 83.03715670436188)	Y2	1		0	90.78590785907859	Confident
2481	P13639	ARPFPDGLAEDIDKGEVSAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34950 (Experiment 1)	34950	61.467	536.52533	4+	4+	2142.0705456698106	0	0.7774396403866254								100.0	Doubtful
2482	P36578	PLISVYSEKGESSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22370 (Experiment 1)	22370	46.692	527.610901	3+	3+	1579.8093521945104	0	0.9611922429249274								100.0	Confident
2483	P01903	ANLEIMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24382 (Experiment 1)	24382	49.19	460.249695	2+	2+	918.4844533471801	0	0.41685997848309464								99.47229551451187	Confident
2484	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	KESYSIYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24562 (Experiment 1)	24562	49.401	680.315979	2+	2+	1358.6159346167303	0	1.0807119632563162	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 9.94210316877388)	Phosphorylation of Y (4: 4.846526655896607)		0	Y4-{Y4 Y7 Y9}	1	99.45799457994579	Confident
2485	Q06830	ATAVMPDGQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24569 (Experiment 1)	24569	49.408	582.788086	2+	2+	1163.5644945730303	0	-2.4670198563898174								93.12169312169311	Confident
2486	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44320 (Experiment 1)	44320	74.942	935.933594	2+	2+	1869.85097291384	0	0.887965782182974	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2487	P36578	SNYNLPMHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17459 (Experiment 1)	17459	40.235	552.268799	2+	2+	1102.5229641142203	0	0.07329054399348288								99.2084432717678	Confident
2488	Q13151	AVPKEDIYSGGGGGGSR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12670 (Experiment 1)	12670	33.211	562.920898	3+	3+	1685.7410285420399	0	-0.09707844722406446	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2489	P62805	DAVTYTEHAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10421 (Experiment 1)	10421	29.447	567.775024	2+	2+	1133.5353026197304	0	0.16947441329935936								100.0	Confident
2490	P07900	YYTSASGDEMVSLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30881 (Experiment 1)	30881	56.746	775.855286	2+	2+	1549.6970248642103	0	-0.6481860733103827								96.22641509433963	Confident
2491	P04350, P07437, P68371, Q13509, Q13885, Q9BVA1	EIVHIQAGQCGNQIGAK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20583 (Experiment 1)	20583	44.225	911.960205	2+	2+	1821.91556568189	0	-5.32290980621415								95.68733153638814	Doubtful
2492	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	QIFHPEQLITGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36581 (Experiment 1)	36581	63.425	470.929749	3+	3+	1409.7666995368902	0	0.5082591337251731								92.14285714285715	Doubtful
2493	Q15084	GSFSEQGINEFLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43728 (Experiment 1)	43728	73.635	742.363464	2+	2+	1482.71030685958	0	1.3929899417185816								99.45799457994579	Confident
2494	Q13151	AVPKEDIYSGGGGGGSR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12509 (Experiment 1)	12509	32.96	562.920227	3+	3+	1685.7410285420399	0	-1.289075293060746	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2495	P11021	NQLTSNPENTVFDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31159 (Experiment 1)	31159	57.073	839.408203	2+	2+	1676.8005784159607	0	0.7592559724390509								99.73333333333333	Confident
2496	P00505	FVTVQTISGTGALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36580 (Experiment 1)	36580	63.424	725.406372	2+	2+	1448.79872794116	0	-0.3700509163736845								100.0	Confident
2497	Q9BXY0	NEYSLTGLCNR	Phosphorylation of Y(3)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29654 (Experiment 1)	29654	55.329	704.294556	2+	2+	1405.56972978364	1	1.0475002838140501	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2498	P49321	EAQLYAAQAHLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21783 (Experiment 1)	21783	45.931	711.842957	2+	2+	1421.6704298010804	0	0.6541231428405239	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2499	O43390	TLIEAGLPQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28055 (Experiment 1)	28055	53.465	535.315002	2+	2+	1068.61791004488	0	-2.2967531708278606								99.73890339425587	Confident
2500	Q92841	GTAYTFFTPGNLK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44322 (Experiment 1)	44322	74.947	748.845398	2+	2+	1495.6748464751802	0	0.9324972162602393	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.72972972972973	Confident
2501	P62829	GSAITGPVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12672 (Experiment 1)	12672	33.216	450.760834	2+	2+	899.5076313199104	0	-0.5726465120281943								100.0	Confident
2502	P46776	LWTLVSEQTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39383 (Experiment 1)	39383	66.874	616.834839	2+	2+	1231.6560864587505	0	-0.7792942005117647								100.0	Confident
2503	P07437	ISVYYNEATGGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24233 (Experiment 1)	24233	49.008	691.303589	2+	2+	1380.5962618013102	0	-2.630338845632644	Phosphorylation of Y (5: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.16155088852988692)		0	Y5-{Y4 Y5}	1	100.0	Confident
2504	Q06830, Q13162	GLFIIDDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41662 (Experiment 1)	41662	70.167	460.757935	2+	2+	919.5014833103103	0	-0.18040264922894053								99.45799457994579	Confident
2505	Q9P258	AGGAAVVITEPEHTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17181 (Experiment 1)	17181	39.839	493.931793	3+	3+	1478.7729071161405	0	0.4335846307565607								100.0	Confident
2506	P49327	VLEALLPLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44288 (Experiment 1)	44288	74.824	498.329376	2+	2+	994.6426682407402	0	1.5359600104822015								99.72972972972973	Confident
2507	Q86V81	SLGTADVHFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22851 (Experiment 1)	22851	47.266	616.3078	2+	2+	1230.5992998586205	0	1.4174818427401723								100.0	Confident
2508	Q02543	SSGEIVYCGQVFEK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33553 (Experiment 1)	33553	59.833	801.878052	2+	2+	1601.7395583825305	0	1.242512072979723								100.0	Confident
2509	P61981	YLAEVATGEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19833 (Experiment 1)	19833	43.33	540.782898	2+	2+	1079.5498900547102	0	1.2509764670182313								99.75247524752476	Confident
2510	Q99961, Q99962	TIEYLQPNPASR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27002 (Experiment 1)	27002	52.228	734.84845	2+	2+	1467.6759091043402	0	4.380488410196695	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2511	P26641	VLSAPPHFHFGQTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26082 (Experiment 1)	26082	51.169	427.723022	4+	4+	1706.8641221623802	0	-0.666335928832167								100.0	Doubtful
2512	TRYP_PIG	LSSPATLNSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16605 (Experiment 1)	16605	39.088	523.286133	2+	2+	1044.5563724174804	0	1.2809919164757542								99.45652173913044	Confident
2513	P10768	SGYHQSASEHGLVVIAPDTSPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23530 (Experiment 1)	23530	48.101	577.789673	4+	4+	2307.124372147821	0	2.256009815198977								100.0	Doubtful
2514	P48735	ATDFVADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17032 (Experiment 1)	17032	39.632	447.719391	2+	2+	893.4242956187702	0	-0.07432377351173133								99.1869918699187	Confident
2515	P14868	IHDPQLLTER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20580 (Experiment 1)	20580	44.222	407.891541	3+	3+	1220.65133543148	0	1.1916319863653426								100.0	Confident
2516	Q02543	KSSGEIVYCGQVFEK	Phosphorylation of Y(8)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29212 (Experiment 1)	29212	54.819	604.609436	3+	3+	1809.8008519172806	1	1.2532083290339318	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2517	Q16540	NYLEGIYNVPVAAVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45470 (Experiment 1)	45470	77.593	879.434998	2+	2+	1756.8549360954703	0	0.28823679563753074	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 18.402886808757653)	Phosphorylation of Y (7: 82.16783216783216)		0	Y7-{Y2 Y7}	1	100.0	Confident
2518	O43933, P55072, Q8IYT4	GILLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38442 (Experiment 1)	38442	65.681	626.820374	2+	2+	1251.6264397307802	0	-0.19516305369290757	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2519	O00231	TTANAIYCPPK	Phosphorylation of Y(7)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16604 (Experiment 1)	16604	39.085	658.291016	2+	2+	1314.5679388784902	0	-0.34924671803388185	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2520	O43615	DQDELNPYAAWR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39973 (Experiment 1)	39973	67.704	779.323059	2+	2+	1556.6296871879103	0	1.2048153241478612	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 96.76898222940227)	Y8	1		0	99.4949494949495	Confident
2521	O00483	FYSVNVDYSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30306 (Experiment 1)	30306	56.085	651.275635	2+	2+	1300.5376842960302	0	-0.7425649634320436	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 17.26598817399075)	Phosphorylation of Y (2: 100.0)		0	Y2-{Y2 Y8}	1	100.0	Confident
2522	P28066	GVNTFSPEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18728 (Experiment 1)	18728	41.958	532.263245	2+	2+	1062.50942222506	0	2.3624092782316555								99.72972972972973	Confident
2523	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33716 (Experiment 1)	33716	60.018	630.797546	2+	2+	1259.5798834611805	0	0.5196639874280117	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2524	P49773	MVVNEGSDGGQSVYHVHLHVLGGR	Phosphorylation of Y(14)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29211 (Experiment 1)	29211	54.817	657.560059	4+	4+	2626.2111692377603	0	-0.014867466225281411	Phosphorylation of Y (14: Very Confident)	Phosphorylation of Y (14: 100.0)	Phosphorylation of Y (14: 100.0)	Y14	1		0	100.0	Doubtful
2525	P62273	GHQQLYWSHPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15187 (Experiment 1)	15187	37.15	470.233734	3+	3+	1407.6796158679902	0	-0.1724450109085301								100.0	Confident
2526	P35637, Q92804	AAIDWFDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42441 (Experiment 1)	42441	71.4	511.75058	2+	2+	1021.4868958753302	0	-0.2821773769312151								100.0	Confident
2527	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	KESYSIYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24640 (Experiment 1)	24640	49.49	453.879333	3+	3+	1358.6159346167303	0	0.17257367551797848	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 9.952880760141328)	Phosphorylation of Y (4: 60.20942408376963)		0	Y4-{Y4 Y7 Y9}	1	100.0	Confident
2528	P11142	SQIHDIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27602 (Experiment 1)	27602	52.941	494.607544	3+	3+	1480.79979057032	0	0.6820423900320418								100.0	Confident
2529	P45880	VNNSSLIGVGYTQTLRPGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33631 (Experiment 1)	33631	59.922	701.727783	3+	3+	2102.1484020676903	0	6.231102681162295								100.0	Doubtful
2530	O43423, P39687	VSGGLEVLAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31595 (Experiment 1)	31595	57.589	551.311584	2+	2+	1100.6077392840004	0	0.7942723284927337								99.7289972899729	Confident
2531	P26038	ALTSELANARDESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19380 (Experiment 1)	19380	42.76	502.258881	3+	3+	1503.7528999475503	0	1.270031927408329								100.0	Confident
2532	P23528	NIILEEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23146 (Experiment 1)	23146	47.62	458.260559	2+	2+	914.5072969667403	0	-0.7985629195173242								99.46091644204851	Confident
2533	Q13263	VLVNDAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9827 (Experiment 1)	9827	28.248	443.753601	2+	2+	885.4919812557703	0	0.7524571145031986								99.73614775725594	Confident
2534	P07900, P08238, Q58FF6, Q58FF7	EDQTEYLEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21920 (Experiment 1)	21920	46.127	656.288147	2+	2+	1310.5626395663803	0	-0.6845311724368313								100.0	Confident
2535	P78347, Q6EKJ0, Q86UP8	EQVNDLFSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32414 (Experiment 1)	32414	58.53	554.278259	2+	2+	1106.5356369729002	0	5.708441109276413								99.45652173913044	Doubtful
2536	P22234	EVTPEGLQMVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30709 (Experiment 1)	30709	56.546	615.823547	2+	2+	1229.6325741328503	0	-0.026847360592747452								95.32467532467533	Confident
2537	P49327	RVYATILNAGTNTDGFK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35594 (Experiment 1)	35594	62.208	640.978516	3+	3+	1919.91424187674	0	-0.2721240627742903	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2538	P04406	VVDLMAHMASKE			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28881 (Experiment 1)	28881	54.441	444.221252	3+	3+	1329.6420932707306	0	-0.12506616541559545								100.0	Confident
2539	P08238, Q58FF8	SIYYITGESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28548 (Experiment 1)	28548	54.052	580.795898	2+	2+	1159.5761048025502	0	0.9799181992751365								100.0	Confident
2540	P26358	GAQYQPILR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22773 (Experiment 1)	22773	47.177	563.27655	2+	2+	1124.53795907955	0	0.5219346808771338	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.03069466882067)	Y4	1		0	99.74489795918367	Confident
2541	Q1KMD3	NYYGYQGYR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24046 (Experiment 1)	24046	48.77	632.244934	2+	2+	1262.47575274581	0	-0.34613111095673443	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0, 8: 0.0)	Phosphorylation of Y (3: 73.47294938917976)		0	Y3-{Y2 Y3 Y5 Y8}	1	96.19565217391303	Confident
2542	Q9UN86	QYYTLLNK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33297 (Experiment 1)	33297	59.536	561.765442	2+	2+	1121.51582665264	0	0.4489542472462435	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 0.0)		0	Y2-{Y2 Y3}	1	93.76693766937669	Confident
2543	P31942, P31943, P55795	GLPFGCSK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26012 (Experiment 1)	26012	51.085	433.215912	2+	2+	864.41637378736	0	1.0356036336790926								99.7289972899729	Confident
2544	Q9UKM9	SSELQAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16782 (Experiment 1)	16782	39.306	438.2453	2+	2+	874.4759968384603	0	0.057305712805226866								93.65079365079364	Confident
2545	P22626	DYFEEYGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31008 (Experiment 1)	31008	56.895	525.724854	2+	2+	1049.4341915961302	0	0.9163264027764916								99.73045822102425	Confident
2546	P31146	RCEPIAMTVPR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22512 (Experiment 1)	22512	46.867	443.897003	3+	3+	1328.66931107808	0	-0.0987304879482008								100.0	Confident
2547	P37802, Q9UI15	GASQAGMTGYGMPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23930 (Experiment 1)	23930	48.627	692.310181	2+	2+	1382.60710474434	0	-0.9357631790774013								100.0	Confident
2548	Q13347	SGEVLVNVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21252 (Experiment 1)	21252	45.079	472.774078	2+	2+	943.5338460677501	0	-0.2569951726895924								99.7289972899729	Confident
2549	P07900, P08238, Q58FF6, Q58FF7, Q58FF8	IRYESLTDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20188 (Experiment 1)	20188	43.771	436.898254	3+	3+	1307.6721304457103	0	0.6120069813073664								100.0	Confident
2550	P62277	GLSQSALPYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25685 (Experiment 1)	25685	50.711	546.295654	2+	2+	1090.57710786206	0	-0.3228980202325791								100.0	Confident
2551	P04406	GALQNIIPASTGAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34484 (Experiment 1)	34484	60.924	706.39978	2+	2+	1410.7830778770206	0	1.3655100441502206								100.0	Confident
2552	P62993	FNSLNELVDYHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37042 (Experiment 1)	37042	63.979	502.916382	3+	3+	1505.7262912768904	0	0.679585054336052								99.24812030075188	Confident
2553	P13073	DHPLPEVAHVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15416 (Experiment 1)	15416	37.503	414.559235	3+	3+	1240.6564208119205	0	-0.438386983489363								100.0	Confident
2554	Q99497	VTVAGLAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20749 (Experiment 1)	20749	44.416	408.253143	2+	2+	814.4912529797803	0	0.5879769530044405								100.0	Confident
2555	P19338	GFGFVDFNSEEDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44178 (Experiment 1)	44178	74.533	781.344116	2+	2+	1560.6732526445203	0	0.272877188913979								100.0	Confident
2556	P62854, Q5JNZ5	LHYCVSCAIHSK	Phosphorylation of Y(3)	Carbamidomethylation of C(4, 7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15266 (Experiment 1)	15266	37.273	518.891357	3+	3+	1553.6520199389604	0	0.1423937350375415	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2557	ALDOA_RABIT, P04075, P09972	YASICQQNGIVPIVEPEILPDGDHDLKR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43578 (Experiment 1)	43578	73.385	795.154114	4+	4+	3175.5971981821403	1	-4.152339277012637								100.0	Doubtful
2558	Q63HK5	EKAVTDEKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34223 (Experiment 1)	34223	60.62	572.81427	2+	2+	1143.6135529404303	0	0.37894142372839895								99.1869918699187	Confident
2559	P08865	AIVAIENPADVSVISSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41320 (Experiment 1)	41320	69.635	870.978821	2+	2+	1739.9417633463904	0	0.7610523714780747								100.0	Confident
2560	O95185, Q8IZJ1	LSDTANYTCVAK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30309 (Experiment 1)	30309	56.088	671.818237	2+	2+	1341.6234660011303	0	-1.1498147066014364								98.73417721518987	Confident
2561	P49327	AGLYGLPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32141 (Experiment 1)	32141	58.216	463.728455	2+	2+	925.4422677895602	0	0.09625980839393838	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65034965034964)	Y4	1		0	100.0	Confident
2562	Q02790	VLQLYPNNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27000 (Experiment 1)	27000	52.226	544.809631	2+	2+	1087.6025943339102	0	1.9408032177597743								99.47089947089947	Confident
2563	Q15029	VVYSAFLMATPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44910 (Experiment 1)	44910	76.367	717.846497	2+	2+	1433.6778236806401	0	0.4300264776626594	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2564	Q06830	DISLSDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27590 (Experiment 1)	27590	52.927	510.718048	2+	2+	1019.4212575614604	0	0.27951332114050303	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
2565	P04350, P07437, P68371, Q13509	IMNTFSVVPSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37170 (Experiment 1)	37170	64.129	660.355347	2+	2+	1318.6955087425804	0	0.4787756328354797								100.0	Confident
2566	P07900, P08238, Q14568	HNDDEQYAWESSAGGSFTVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37046 (Experiment 1)	37046	63.982	779.306091	3+	3+	2334.9178832566904	0	-9.170320778776741	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.68411867364746)	Y7	1		0	97.74436090225565	Doubtful
2567	P29401	TSRPENAIIYNNNEDFQVGQAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31814 (Experiment 1)	31814	57.844	863.397888	3+	3+	2587.17040954125	0	0.5501747292083244	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
2568	P62899	EYTINIHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19177 (Experiment 1)	19177	42.52	509.271606	2+	2+	1016.5290950404803	0	-0.4280367415652359								99.19354838709677	Confident
2569	Q96JB5	QYGITGENVR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19656 (Experiment 1)	19656	43.102	608.772278	2+	2+	1215.5285165946602	0	1.2208781380157945	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	99.1869918699187	Confident
2570	P07900, P08238, Q14568, Q58FF7, Q58FF8	YESLTDPSKLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22517 (Experiment 1)	22517	46.874	513.92395	3+	3+	1538.7464175847801	0	2.3369366899119215								100.0	Confident
2571	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38798 (Experiment 1)	38798	66.115	931.481506	2+	2+	1860.9498991094704	0	-0.7729847410724888	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 94.24083769633508)	Y5	1		0	97.57412398921834	Confident
2572	O00299	NSNPALNDNLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18159 (Experiment 1)	18159	41.213	664.82605	2+	2+	1327.6368075661505	0	0.5561609962615554								99.74358974358975	Confident
2573	P23528, Q9Y281	YALYDATYETK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32748 (Experiment 1)	32748	58.912	709.299316	2+	2+	1416.5850284112705	0	-0.6692127272495472	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 23.886254776734564)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y1 Y4 Y8}	1	100.0	Confident
2574	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29478 (Experiment 1)	29478	55.123	528.262329	2+	2+	1054.5100129962104	0	0.08714436789640084	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
2575	P84090	ADTQTYQPYNK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11371 (Experiment 1)	11371	31.131	704.792542	2+	2+	1407.5707753294603	0	-0.1732871926737864	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 9.677620972789686)	Phosphorylation of Y (6: 5.5846422338568935)		0	Y9-{Y6 Y9}	1	100.0	Confident
2576	P53701	TYSVPAHQER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.43 min, Period: 1, Cycle(s): 8635 (Experiment 1)	8635	25.852	423.186371	3+	3+	1266.5394156315303	0	-1.6793455019636805	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
2577	P10696	VQHASPAGAYAHTVNR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8773 (Experiment 1)	8773	26.156	586.940674	3+	3+	1757.7998808308407	0	0.177058654602688	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
2578	Q14807	STQQDIYAGSVQPILR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37250 (Experiment 1)	37250	64.222	928.452087	2+	2+	1854.8876927757303	0	1.0384448885195459	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2579	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24917 (Experiment 1)	24917	49.809	757.292175	3+	3+	2268.8644082151895	0	-4.275132911457174	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 12.82958457065266)	Phosphorylation of Y (6: 4.091776693253489)		0	Y6-{Y6 Y11 Y22}	1	100.0	Doubtful
2580	P55769	LLDLVQQSCNYK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35598 (Experiment 1)	35598	62.213	740.876709	2+	2+	1479.7391644597103	0	-0.20205337157571723								100.0	Confident
2581	O60711	TYCQPCFNK	Phosphorylation of Y(2)	Carbamidomethylation of C(3, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18158 (Experiment 1)	18158	41.212	649.240417	2+	2+	1296.4668449382302	0	-0.4342548575086971	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2582	GSTP1_HUMAN, P09211	PPYTVVYFPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43986 (Experiment 1)	43986	74.111	669.36676	2+	2+	1336.7179584393202	0	0.7534194075793103								100.0	Confident
2583	P50995	NTPAFFAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32060 (Experiment 1)	32060	58.126	526.760864	2+	2+	1051.5086939490702	0	-1.4417173032688804								100.0	Confident
2584	P09651, Q32P51	DYFEQYGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27342 (Experiment 1)	27342	52.624	565.215576	2+	2+	1128.4165065341901	0	0.08185566474189057	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 9.906311311625508)	Phosphorylation of Y (2: 64.28181330013791)		0	Y6-{Y2 Y6}	1	98.92761394101876	Confident
2585	P10809	VTDALNATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13549 (Experiment 1)	13549	34.566	480.759338	2+	2+	959.5036085686302	0	0.5350889525951751								100.0	Confident
2586	C9J202, Q9BT22	AVTVYDKPASFFK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35817 (Experiment 1)	35817	62.483	518.253479	3+	3+	1551.7374467317406	0	0.7466543798648579	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.28057553956835	Confident
2587	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38729 (Experiment 1)	38729	66.03	621.323975	3+	3+	1860.9498991094704	0	0.10541473916500246	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
2588	P25398	TALIHDGLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18803 (Experiment 1)	18803	42.053	533.804138	2+	2+	1065.59309227937	0	0.5908415967267642								99.73614775725594	Confident
2589	Q01081	AVIDLNNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22298 (Experiment 1)	22298	46.606	457.75351	2+	2+	913.4981292653702	0	-6.184730265515627								90.2439024390244	Doubtful
2590	P11142	NSLESYAFNMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40813 (Experiment 1)	40813	68.907	692.286194	2+	2+	1382.5577681176103	0	0.04835339013280003	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2591	Q9BQA1	YEHDDIVSTVSVLSSGTQAVSGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41585 (Experiment 1)	41585	70.039	822.738464	3+	3+	2465.1921769241203	0	0.561408143745543								92.85714285714286	Doubtful
2592	P63244	VWNLANCK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27341 (Experiment 1)	27341	52.623	502.752258	2+	2+	1003.49093570995	0	-0.9673180156097667								99.73474801061008	Confident
2593	P61201	ALYEQSLHIK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24835 (Experiment 1)	24835	49.715	641.31665	2+	2+	1280.6166033230704	0	1.6713638172119207	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.38219895287958)	Y3	1		0	97.289972899729	Confident
2594	Q9UMS4	FIASTGMDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20146 (Experiment 1)	20146	43.725	499.241577	2+	2+	996.4698659122	0	-1.2667657101625767								95.2127659574468	Confident
2595	P48047	LVRPPVQVYGIEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31679 (Experiment 1)	31679	57.685	528.640625	3+	3+	1581.8991106887702	1	-1.5268439863769767								100.0	Confident
2596	O15042	LYSILQGDSPTK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35332 (Experiment 1)	35332	61.906	701.34198	2+	2+	1400.6588620578702	0	7.5177930892425415	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Doubtful
2597	P06733	TIAPALVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22033 (Experiment 1)	22033	46.272	450.281403	2+	2+	898.5487678559002	0	-0.5716305697046051								100.0	Confident
2598	P07339	YYTVFDRDNNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26013 (Experiment 1)	26013	51.087	514.883423	3+	3+	1541.6300215410802	0	-1.024141145527841	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 3.4904013961605584)		0	Y2-{Y1 Y2}	1	100.0	Confident
2599	Q9H299	VYSTSVTGSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11301 (Experiment 1)	11301	31.018	568.753479	2+	2+	1135.4910684567803	0	1.1750355957111267	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2600	O43390	DYAFVHFEDR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37771 (Experiment 1)	37771	64.857	460.186432	3+	3+	1377.5390812783603	0	-1.1695817140163538	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
2601	P22626	NYYEQWGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27949 (Experiment 1)	27949	53.342	584.229065	2+	2+	1166.4433899883702	0	0.1601067516132033	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 10.471204188481677)		0	Y2-{Y2 Y3}	1	93.76693766937669	Confident
2602	P06493, P24941, Q00526	IGEGTYGVVYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27864 (Experiment 1)	27864	53.246	633.299988	2+	2+	1264.5740698047505	0	8.963653566379959	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 16.033061460567254)	Phosphorylation of Y (10: 96.33507853403141)		0	Y10-{Y6 Y10}	1	96.19565217391303	Doubtful
2603	P13639	TGTITTFEHAHNMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17893 (Experiment 1)	17893	40.802	404.695374	4+	4+	1614.7572741353406	0	-3.017076650094343								72.72727272727273	Doubtful
2604	P11142	VCNPIITK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18793 (Experiment 1)	18793	42.04	472.765991	2+	2+	943.5160878286301	0	1.4185026778589946								100.0	Confident
2605	P08865	KSDGIYIINLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39099 (Experiment 1)	39099	66.484	448.570221	3+	3+	1342.6897682633303	0	-0.6945498335784753	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 96.4458804523425)	Y6	1		0	98.49624060150376	Confident
2606	P36578	RGPCIIYNEDNGIIK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30299 (Experiment 1)	30299	56.076	587.97113	3+	3+	1760.88795395172	0	2.044689517711012								100.0	Confident
2607	P07954	YYGAQTVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13945 (Experiment 1)	13945	35.19	479.242371	2+	2+	956.4715801643601	0	-1.4513490973382506								97.289972899729	Confident
2608	P49327	GLVQALQTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27208 (Experiment 1)	27208	52.467	479.290161	2+	2+	956.5654805492002	0	0.3009839198125458								99.49367088607595	Confident
2609	Q8N6M0	HAYGLGEHYNSVTR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15417 (Experiment 1)	15417	37.505	561.914551	3+	3+	1682.7202335278103	0	0.9432473619311031	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 7.698043197994125)	Phosphorylation of Y (9: 96.33507853403141)		0	Y9-{Y3 Y9}	1	96.32352941176471	Confident
2610	P22087	ANCIDSTASAEAVFASEVKK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37773 (Experiment 1)	37773	64.859	700.009094	3+	3+	2097.004834178761	0	0.2944823574756417								100.0	Confident
2611	Q9H0D6	YYYQGCASWK	Phosphorylation of Y(2)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30960 (Experiment 1)	30960	56.839	703.267883	2+	2+	1404.5209886860703	0	0.15952693615911798	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 4.712041884816754)		0	Y2-{Y1 Y2 Y3}	1	94.90616621983914	Confident
2612	O15372	EFTAQNLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20661 (Experiment 1)	20661	44.312	504.261078	2+	2+	1006.5083595959002	0	-0.7501361790572136								99.72826086956522	Confident
2613	P15531, P22392	TFIAIKPDGVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26015 (Experiment 1)	26015	51.089	672.884949	2+	2+	1343.7561348531901	0	-0.5868658170621762								100.0	Confident
2614	O75347	LEAAYLDLQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37293 (Experiment 1)	37293	64.274	636.306152	2+	2+	1270.59586787849	0	1.4797834867813606	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	99.74293059125964	Confident
2615	P48735	LVPGWTKPITIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35597 (Experiment 1)	35597	62.212	479.956696	3+	3+	1436.8503695912	0	-1.4660965309543026								100.0	Confident
2616	P62995	AAQDRDQIYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9246 (Experiment 1)	9246	27.154	658.292969	2+	2+	1314.5717783889702	0	-0.298744248693474	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 90.22687609075044)	Y9	1		0	94.03794037940379	Confident
2617	P40926	IFGVTTLDIVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46695 (Experiment 1)	46695	79.867	617.363831	2+	2+	1232.7128730588802	0	0.1911413731635177								93.1758530183727	Confident
2618	Q02790	EGTGTEMPMIGDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30706 (Experiment 1)	30706	56.543	697.310852	2+	2+	1392.60135065756	0	4.159144321238667								100.0	Confident
2619	Q8IWS0	EKPSQGIYMVYCR	Phosphorylation of Y(8)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30360 (Experiment 1)	30360	56.146	570.917053	3+	3+	1709.7306641824803	0	-0.7792036042075771	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 13.739487640234529)	Phosphorylation of Y (8: 99.82547993019197)		0	Y8-{Y8 Y11}	1	100.0	Confident
2620	Q14141, Q16181, Q6ZU15, Q92599, Q9NVA2	VNIIPIIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41582 (Experiment 1)	41582	70.035	490.828644	2+	2+	979.6430025939103	0	-0.2725263333567613								99.45799457994579	Confident
2621	P19338	NDLAVVDVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28284 (Experiment 1)	28284	53.743	500.774445	2+	2+	999.5349086969102	0	-0.5707461847543397								100.0	Confident
2622	P02787, P02788, TRFE_HUMAN	YYGYTGAFR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33257 (Experiment 1)	33257	59.49	589.238098	2+	2+	1176.4641254329501	0	-2.106416195542864	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.9693053311793215)		0	Y2-{Y1 Y2 Y4}	1	100.0	Confident
2623	P36578	LDELYGTWR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39571 (Experiment 1)	39571	67.141	616.769897	2+	2+	1231.5274539655002	0	-1.7939390080851778	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.09208400646203)	Y5	1		0	99.72972972972973	Confident
2624	P04350, P07437, P68371, Q13509, Q13885, Q9BVA1	ISEQFTAMFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42791 (Experiment 1)	42791	72.07	615.30304	2+	2+	1228.5910436740403	0	0.3928084976326694								100.0	Confident
2625	Q13263	MNEAFGDTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15934 (Experiment 1)	15934	38.256	506.723419	2+	2+	1011.4331460503101	0	-0.8495593161507948								100.0	Confident
2626	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38363 (Experiment 1)	38363	65.585	952.978271	2+	2+	1903.9444793758603	0	-1.3065912972489235	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 95.79967689822294)	Y5	1		0	98.92183288409704	Confident
2627	P11388, Q02880	ELILFSNSDNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40816 (Experiment 1)	40816	68.911	718.85321	2+	2+	1435.6943224422703	0	-1.7078394218023771								92.43243243243244	Confident
2628	P62750	LYDIDVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29133 (Experiment 1)	29133	54.73	468.755249	2+	2+	935.4963979298705	0	-0.48304875155965027								99.45799457994579	Confident
2629	P31948	TYEEGLKHEANNPQLK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14882 (Experiment 1)	14882	36.619	650.970459	3+	3+	1949.8884210517203	0	0.5768559222943156	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2630	Q9UK99	NKNEVFYQCPDQMAR	Phosphorylation of Y(7)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25903 (Experiment 1)	25903	50.96	660.609619	3+	3+	1978.8066826570503	0	0.17405265471855302	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	99.37888198757764	Confident
2631	P38159	SDLYSSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11890 (Experiment 1)	11890	31.926	442.708923	2+	2+	883.40356017419	0	-0.3016742146372353								96.21621621621621	Confident
2632	Q07955	VKVDGPRSPSYGR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11372 (Experiment 1)	11372	31.134	499.911713	3+	3+	1496.7136915953902	0	-0.25470879419227094	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 94.76439790575917)	Y11	1		0	92.99363057324841	Doubtful
2633	P37235, P84074	IYANFFPYGDASK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45572 (Experiment 1)	45572	77.823	786.841431	2+	2+	1571.6697610947404	0	-0.9226935489327737	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 8: 0.0)	Phosphorylation of Y (2: 91.59935379644588)		0	Y2-{Y2 Y8}	1	98.9247311827957	Confident
2634	P08134, P61586	HFCPNVPIILVGNKK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33377 (Experiment 1)	33377	59.629	579.326599	3+	3+	1734.9603310463403	0	-1.359879767625159								98.49624060150376	Confident
2635	Q00839	SSGPTSLFAVTVAPPGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43982 (Experiment 1)	43982	74.105	857.959473	2+	2+	1713.9049839148504	0	-0.34433343862712745								100.0	Confident
2636	P11586	KITIGQAPTEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13809 (Experiment 1)	13809	34.952	593.345581	2+	2+	1184.6764875501601	0	0.10239920220827253								92.14092140921409	Confident
2637	Q08211	AAECNIVVTQPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20405 (Experiment 1)	20405	44.014	679.851929	2+	2+	1356.6819839367602	1	2.919188875554476								100.0	Confident
2638	P61247	APAMFNIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33840 (Experiment 1)	33840	60.161	460.244446	2+	2+	918.4745573698201	0	-0.23716026796421896								100.0	Confident
2639	P53621	KDMSGHYQNALYLGDVSER	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29739 (Experiment 1)	29739	55.426	755.000793	3+	3+	2261.9776470622805	0	1.2814737104966953	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 9.750654092385615)	Phosphorylation of Y (7: 18.93542757417103)		0	Y7-{Y7 Y12}	1	99.25373134328358	Confident
2640	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20404 (Experiment 1)	20404	44.013	514.767517	2+	2+	1027.5120650773501	0	8.174620139464173								99.7289972899729	Doubtful
2641	P52565	AEEYEFLTPVEEAPK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42794 (Experiment 1)	42794	72.073	611.274109	3+	3+	1830.7964777294908	0	2.1920765309466352	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	99.37888198757764	Confident
2642	P10412, P16402, P16403	KASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23450 (Experiment 1)	23450	47.997	663.885071	2+	2+	1325.7554661468505	0	0.09257591576236822								100.0	Confident
2643	P11142	SQIHDIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27382 (Experiment 1)	27382	52.674	494.607147	3+	3+	1480.79979057032	0	-0.12061473804379222								100.0	Confident
2644	Q9C0C9	VQSCPDPAVYGVVQSGDHIGR	Phosphorylation of Y(10)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32934 (Experiment 1)	32934	59.121	774.35321	3+	3+	2320.0307452643005	0	3.0370966804777426	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
2645	P52565	AEEYEFLTPVEEAPK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42942 (Experiment 1)	42942	72.341	916.40686	2+	2+	1830.7964777294908	0	1.4673290591206263	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2646	P26599	NNQFQALLQYADPVSAQHAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46093 (Experiment 1)	46093	78.909	775.035522	3+	3+	2322.07940970888	0	2.291036017794652	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 97.03315881326353)	Y10	1		0	92.46575342465754	Doubtful
2647	Q13813	EQADYCVSHMKPYVDGK	Phosphorylation of Y(5)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23104 (Experiment 1)	23104	47.572	702.959717	3+	3+	2105.8587777995604	0	-0.6905085056141339	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 4.735688234533786)	Phosphorylation of Y (5: 3.392568659127625)		0	Y5-{Y5 Y13}	1	100.0	Confident
2648	P07900, P08238, Q58FF7, Q58FF8	IRYESLTDPSKLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24319 (Experiment 1)	24319	49.117	603.651672	3+	3+	1807.9315925855103	0	0.8802070965020535								100.0	Confident
2649	P62805	KTVTAMDVVYALK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45570 (Experiment 1)	45570	77.818	759.886292	2+	2+	1517.7564679241605	0	1.0285379797302354	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
2650	DHE3_BOVIN, P00367	HGGTIPIVPTAEFQDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34703 (Experiment 1)	34703	61.174	579.970581	3+	3+	1736.8845828234403	0	3.0638292304215344								100.0	Confident
2651	P52209	TIFQGIAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30964 (Experiment 1)	30964	56.845	474.779999	2+	2+	947.5440168286304	0	1.5041070567592714								99.74811083123426	Confident
2652	P04264	AQYEDIAQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13278 (Experiment 1)	13278	34.12	573.24646	2+	2+	1144.4801694199105	0	-1.5720556750455166	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	96.19565217391303	Confident
2653	Q53QZ3	VSGNLATIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17114 (Experiment 1)	17114	39.747	515.798462	2+	2+	1029.5818588893303	0	0.49648975085941477								96.19565217391303	Confident
2654	Q96G03	IVLANDPDADRLAVAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29392 (Experiment 1)	29392	55.026	603.995911	3+	3+	1808.9632270669604	0	1.4771273052279075								92.99363057324841	Doubtful
2655	Q08211	LFTAHNNMTNYATVWASK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40066 (Experiment 1)	40066	67.82	716.992981	3+	3+	2147.9499757624603	0	3.318424298394629	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.82547993019197)	Y11	1		0	99.28057553956835	Confident
2656	Q15366	GVTIPYRPKPSSSPVIFAGGQDR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33255 (Experiment 1)	33255	59.487	628.069885	4+	4+	2508.25262304358	0	-0.8712839818954262	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.67689822294022)	Y6	1		0	100.0	Doubtful
2657	P49411	TVVTGIEMFHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32936 (Experiment 1)	32936	59.123	421.225281	3+	3+	1260.6536439306005	0	0.29253473009207404								100.0	Confident
2658	P46063	YKGQSGIIYCFSQK	Phosphorylation of Y(9)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34225 (Experiment 1)	34225	60.624	586.93512	3+	3+	1757.7848079303203	0	-0.7254236377565587	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 5.091376872673607)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y1 Y9}	1	100.0	Confident
2659	P11021	ITPSYVAFTPEGER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36400 (Experiment 1)	36400	63.219	783.894165	2+	2+	1565.7725727629706	0	0.7681549271347062								99.45652173913044	Confident
2660	P04406	IISNASCTTNCLAPLAK		Carbamidomethylation of C(7, 11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30487 (Experiment 1)	30487	56.29	611.97821	3+	3+	1832.9124544474003	0	0.18854278536046573								100.0	Confident
2661	P62249	ALVAYYQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22896 (Experiment 1)	22896	47.318	478.264893	2+	2+	954.5174677276202	0	-2.3362116436448335								100.0	Confident
2662	P20039	AVTELGRPDEEYWNSQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29610 (Experiment 1)	29610	55.277	674.658386	3+	3+	2020.9490335548005	0	2.1220882384482564								92.7536231884058	Doubtful
2663	P13473	IPLNDLFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 43980 (Experiment 1)	43980	74.103	494.284698	2+	2+	986.5549158655001	0	-0.0736408783992141								99.45652173913044	Confident
2664	P13798	VVFDSAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16784 (Experiment 1)	16784	39.308	461.243683	2+	2+	920.4715801643601	0	1.3364992400974425								96.53333333333333	Confident
2665	P05198	INLIAPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30223 (Experiment 1)	30223	55.99	447.282593	2+	2+	892.5494365622401	0	1.3375277230944296								99.7289972899729	Confident
2666	P42167	YVPLADVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25422 (Experiment 1)	25422	50.402	452.760406	2+	2+	903.5065686907503	0	-0.34192948885840757								93.6	Confident
2667	Q5SSJ5	SGASVVAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18151 (Experiment 1)	18151	41.201	430.253082	2+	2+	858.4923156089401	0	-0.8187529812373456								95.4054054054054	Confident
2668	P09874	AEPVEVVAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21257 (Experiment 1)	21257	45.086	533.798157	2+	2+	1065.5818588893303	0	-0.09162915262241572								100.0	Confident
2669	Q9NWQ8	ENDYESISDLQQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29998 (Experiment 1)	29998	55.728	867.350159	2+	2+	1732.6941379192701	0	-4.8266622162578905	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Doubtful
2670	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30224 (Experiment 1)	30224	55.991	677.841553	2+	2+	1353.6693671719202	0	-0.6005127982095267	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.08027923211169)	Y4	1		0	99.72972972972973	Confident
2671	Q08211	ELDALDANDELTPLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43056 (Experiment 1)	43056	72.53	871.433655	2+	2+	1740.8530079116401	0	-0.14392675027404045								99.46091644204851	Confident
2672	Q01469	LVVECVMNNVTCTR		Carbamidomethylation of C(5, 12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38982 (Experiment 1)	38982	66.336	847.90387	2+	2+	1693.79498216701	0	-1.0585508554885146								100.0	Confident
2673	P62277	KGLTPSQIGVILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35810 (Experiment 1)	35810	62.476	461.289398	3+	3+	1380.8452842107602	0	0.7807027085509503								100.0	Confident
2674	Q06830	LVQAFQFTDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36663 (Experiment 1)	36663	63.524	598.819702	2+	2+	1195.6237237013104	0	0.9413235093431838								100.0	Confident
2675	P00338	DYNVTANSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9380 (Experiment 1)	9380	27.442	546.223694	2+	2+	1090.4332192274903	0	-0.3516516983373374	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2676	P62263	ADRDESSPYAAMLAAQDVAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39096 (Experiment 1)	39096	66.481	755.690674	3+	3+	2264.0491586022304	0	0.45609393743629717								100.0	Confident
2677	P33991	VNVTGIYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23725 (Experiment 1)	23725	48.352	501.244507	2+	2+	1000.4742961938302	0	0.16446322169227243	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 97.09208400646203)	Y7	1		0	99.73333333333333	Confident
2678	P04075	FSHEEIAMATVTALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38983 (Experiment 1)	38983	66.338	559.287109	3+	3+	1674.8399411301402	0	-0.2643427390378727								100.0	Confident
2679	P26038	ALTSELANAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22291 (Experiment 1)	22291	46.597	523.285828	2+	2+	1044.5563724174801	0	0.698136053752334								100.0	Confident
2680	P29218	SLLVTELGSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36664 (Experiment 1)	36664	63.525	581.330322	2+	2+	1160.64010204144	0	5.151164114138122								100.0	Doubtful
2681	P31946	YLSEVASGDNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15419 (Experiment 1)	15419	37.507	591.785034	2+	2+	1181.5564319871303	0	-0.7747070231668494								100.0	Confident
2682	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9NY65	VGINYQPPTVVPGGDLAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38157 (Experiment 1)	38157	65.326	952.980896	2+	2+	1903.9444793758603	0	1.4479275099043198	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2683	Q9UBR2	VGDYGSLSGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16900 (Experiment 1)	16900	39.455	545.731689	2+	2+	1089.4492036448	0	-0.3468538666347559	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 84.00646203554119)	Y4	1		0	90.3485254691689	Doubtful
2684	Q9NUL3	AGPEYGQGMNPISR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25634 (Experiment 1)	25634	50.651	778.833618	2+	2+	1555.6490427335	0	2.3370468989589974	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	99.73262032085562	Confident
2685	P0CG47, P0CG48, P62979, P62987	TLSDYNIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20540 (Experiment 1)	20540	44.176	541.279602	2+	2+	1080.5451390274404	0	-0.4507474906811214								100.0	Confident
2686	P17987	SSLGPVGLDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25223 (Experiment 1)	25223	50.168	486.7724	2+	2+	971.5287606873101	0	1.5267724047064217								98.69791666666666	Confident
2687	O14548	LTSDSTVYDYAGK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24021 (Experiment 1)	24021	48.741	750.319336	2+	2+	1498.6228704719704	0	0.8320426946908152	Phosphorylation of Y (8: Random)	Phosphorylation of Y (8: 0.0, 10: 0.0)	Phosphorylation of Y (8: 0.16155088852988692)		0	Y8-{Y8 Y10}	1	100.0	Confident
2688	P09651	SESPKEPEQLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10832 (Experiment 1)	10832	30.188	433.889435	3+	3+	1298.6466439738601	0	-0.1293526727727213								100.0	Confident
2689	P61353	VYNYNHLMPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25867 (Experiment 1)	25867	50.919	704.344543	2+	2+	1406.6765046335	0	-1.3995738195276948								96.53333333333333	Confident
2690	Q13263	MIVDPVEPHGEMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24628 (Experiment 1)	24628	49.476	494.575378	3+	3+	1480.7054218032804	0	-0.7529710837821854								100.0	Confident
2691	Q9UQ80	TIIQNPTDQQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17215 (Experiment 1)	17215	39.891	643.340942	2+	2+	1284.6673794184403	0	-0.0375788787831856								98.91304347826086	Confident
2692	Q9Y2W2	DDVYEAFMK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39611 (Experiment 1)	39611	67.204	599.231079	2+	2+	1196.4460924103105	0	1.2621658218749292	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	99.74424552429667	Confident
2693	P37108	FQMAYSNLLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43073 (Experiment 1)	43073	72.552	661.80072	2+	2+	1321.5890086762402	0	-1.6029043181242053	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.68411867364746)	Y5	1		0	98.70466321243524	Confident
2694	P62244	MNVLADALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38117 (Experiment 1)	38117	65.28	487.770752	2+	2+	973.5266525123302	0	0.3060394007403202								97.5609756097561	Confident
2695	Q9BZK7	HQEPVYSVAFSPDGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29399 (Experiment 1)	29399	55.034	884.888916	2+	2+	1767.7617639866203	0	0.8560854505048151	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2696	P16520, P62873, P62879, Q9HAV0	LLVSASQDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16071 (Experiment 1)	16071	38.434	509.284821	2+	2+	1016.5502244078803	0	4.775993244703579								99.73958333333334	Doubtful
2697	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21236 (Experiment 1)	21236	45.054	506.908203	3+	3+	1517.7014551458406	0	0.8709367028838056	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.8272884283247)	Y11	1		0	100.0	Confident
2698	P13796, P13797	MINLSVPDTIDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41617 (Experiment 1)	41617	70.091	751.881104	2+	2+	1501.7446437629703	0	2.002517033474257								99.46380697050938	Confident
2699	Q8WUA2	NTNQDIYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10462 (Experiment 1)	10462	29.52	552.227966	2+	2+	1102.4444526175303	0	-2.7828567098296695	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.50959860383944)	Y7	1		0	98.93048128342245	Confident
2700	P46777	GAVDGGLSIPHSTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21192 (Experiment 1)	21192	44.987	669.854492	2+	2+	1337.69392851945	0	0.3751166263630138								99.45799457994579	Confident
2701	Q13247	TNEGVIEFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29372 (Experiment 1)	29372	55.003	532.772522	2+	2+	1063.5298233164704	0	0.6266748906416645								100.0	Confident
2702	P84103	AFGYYGPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36479 (Experiment 1)	36479	63.308	522.269836	2+	2+	1042.52361573722	0	1.4392285518676202								100.0	Confident
2703	P13639	GVQYLNEIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29678 (Experiment 1)	29678	55.355	532.292542	2+	2+	1062.5709598524602	0	-0.4027727966755195								100.0	Confident
2704	Q9UNM6	YYQTIGNHASYYK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20516 (Experiment 1)	20516	44.148	563.243286	3+	3+	1686.7079375086103	0	0.053908592706233056	Phosphorylation of Y (1: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (1: 0.0)		0	Y1-{Y1 Y2 Y11 Y12}	1	100.0	Confident
2705	Q12906	EDITQSAQHALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20870 (Experiment 1)	20870	44.555	456.900574	3+	3+	1367.6793410844703	0	0.4023598328002244								100.0	Confident
2706	P61158	KDYEEIGPSICR	Phosphorylation of Y(3)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23195 (Experiment 1)	23195	47.676	773.83313	2+	2+	1545.6534594076	0	-1.1322461988912558	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.03069466882067)	Y3	1		0	99.72826086956522	Confident
2707	P50990	HEKEDGAISTIVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24547 (Experiment 1)	24547	49.383	523.286865	3+	3+	1566.83657000186	0	1.3985960166003553								98.55072463768117	Confident
2708	P09651, Q32P51	DYFEQYGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29732 (Experiment 1)	29732	55.418	525.233093	2+	2+	1048.4501760134401	0	1.3870555533153877								99.72826086956522	Confident
2709	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	HQGVMVGMGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13113 (Experiment 1)	13113	33.891	586.288086	2+	2+	1170.56378338038	0	-1.8457734866393338								100.0	Confident
2710	O76021	LLPSLIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37485 (Experiment 1)	37485	64.513	434.784424	2+	2+	867.5541875895101	0	0.1235978951212371								93.76693766937669	Confident
2711	P62241	QWYESHYALPLGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39557 (Experiment 1)	39557	67.121	850.38739	2+	2+	1698.7555564073702	0	2.746202429074286	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 18.449845694020865)	Phosphorylation of Y (7: 2.6178010471204187)		0	Y7-{Y3 Y7}	1	100.0	Confident
2712	Q02790	AKESWEMNSEEKLEQSTIVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30560 (Experiment 1)	30560	56.376	592.294373	4+	4+	2365.1471413080003	0	0.5254251357176664								77.77777777777779	Doubtful
2713	O15270	DAIVYGQPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18440 (Experiment 1)	18440	41.59	549.75415	2+	2+	1097.4906745339601	0	2.794468219808935	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
2714	O43390	STAYEDYYYHPPPR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26061 (Experiment 1)	26061	51.144	613.586548	3+	3+	1837.7348805324402	0	1.5939461787871037	Phosphorylation of Y (4: Random)	Phosphorylation of Y (7: 0.0, 8: 0.0, 9: 0.0)	Phosphorylation of Y (8: 0.0)		0	Y4-{Y4 Y7 Y8 Y9}	1	100.0	Confident
2715	Q02790	DKFSFDLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33045 (Experiment 1)	33045	59.248	528.77002	2+	2+	1055.52876068731	0	-3.095495845853508								99.7289972899729	Confident
2716	O75525, Q07666, Q5VWX1	YLPELMAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36165 (Experiment 1)	36165	62.937	547.284241	2+	2+	1092.5525329070003	0	1.275535682991268								100.0	Confident
2717	Q96I99	EAQVYQAFK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24885 (Experiment 1)	24885	49.774	582.259766	2+	2+	1162.5059902449304	0	-0.8683217831462396	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	99.73614775725594	Confident
2718	P62805	KTVTAMDVVYALKR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42424 (Experiment 1)	42424	71.375	558.959534	3+	3+	1673.8575789477604	0	-0.4808623640551354	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.83844911147011)	Y10	1		0	100.0	Confident
2719	P05141, P12235, P12236, Q9H0C2	GNLANVIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23272 (Experiment 1)	23272	47.775	428.753876	2+	2+	855.4926499621101	0	0.6403494502138393								98.91598915989161	Confident
2720	Q07955	EAGDVCYADVYR	Phosphorylation of Y(11)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27174 (Experiment 1)	27174	52.429	749.290405	2+	2+	1496.5643100500301	0	1.299241830865342	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 7.759123926083362)	Phosphorylation of Y (11: 0.9693053311793215)		0	Y11-{Y7 Y11}	1	100.0	Confident
2721	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21523 (Experiment 1)	21523	45.514	713.288513	2+	2+	1424.5666150733405	0	-2.9034499105798344	Phosphorylation of Y (4: Confident, 7: Doubtfull)		Phosphorylation of Y (4: 99.82547993019197, 7: 87.51113633312586)	Y4	1	Y9-{Y7}	1	100.0	Confident
2722	P08238, Q58FF7	DNSTMGYMMAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31636 (Experiment 1)	31636	57.635	664.739075	2+	2+	1327.4647963329003	0	-0.9020572791675887	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2723	Q99497	VTVAGLAGKDPVQCSR		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23879 (Experiment 1)	23879	48.563	553.294922	3+	3+	1656.8617392038802	0	0.7213732977644877								100.0	Confident
2724	P62937, PPIA_HUMAN	VKEGMNIVEAMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33818 (Experiment 1)	33818	60.134	502.586395	3+	3+	1504.7377845607205	0	-0.28450235208997143								100.0	Confident
2725	Q9Y2R9	FYQVPVPLPDRR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35551 (Experiment 1)	35551	62.158	522.933105	3+	3+	1565.77556357596	0	1.2251573164535323	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2726	P78371	NIGVDNPAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14942 (Experiment 1)	14942	36.728	499.767212	2+	2+	997.5192586327705	0	0.6127192481374162								99.45652173913044	Confident
2727	P05204	PAPPKPEPKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4889 (Experiment 1)	4889	17.843	395.904144	3+	3+	1184.6917436914803	0	-0.9607467172136516								99.28057553956835	Confident
2728	P62158	EAFSLFDKDGDGTITTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38340 (Experiment 1)	38340	65.559	615.635986	3+	3+	1843.8839736867506	0	1.1667692037952664								100.0	Confident
2729	Q15366	IANPVEGSTDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16270 (Experiment 1)	16270	38.682	579.791748	2+	2+	1157.5676653771702	0	1.1018530514113685								99.73474801061008	Confident
2730	Q9BXY0	NEYSLTGLCNR	Phosphorylation of Y(3)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29479 (Experiment 1)	29479	55.126	703.792603	2+	2+	1405.56972978364	0	0.6559342464591424	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2731	P48735	GKLDGNQDLIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18110 (Experiment 1)	18110	41.149	410.225952	3+	3+	1227.65714908791	0	-0.91208866458904								98.50746268656717	Confident
2732	Q12906, Q96SI9	YELISETGGSHDKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15182 (Experiment 1)	15182	37.142	531.261597	3+	3+	1590.7637989844202	0	-0.5254062033897295								100.0	Confident
2733	P30048	HLSVNDLPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26087 (Experiment 1)	26087	51.174	402.891296	3+	3+	1205.65166978465	0	0.3216872995610768								100.0	Confident
2734	P35579	EQEVNILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23498 (Experiment 1)	23498	48.058	486.771851	2+	2+	971.5287606873103	0	0.39893352499613516								90.81081081081082	Confident
2735	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36246 (Experiment 1)	36246	63.034	964.385864	2+	2+	1926.7560694694905	0	0.5732132543081041	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 11.377380872906286)	Phosphorylation of Y (10: 0.16155088852988692)		0	Y10-{Y10 Y14}	1	100.0	Confident
2736	P09874	SDAYYCTGDVTAWTK	Phosphorylation of Y(4)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38892 (Experiment 1)	38892	66.226	909.358704	2+	2+	1816.7015317988305	0	0.7275833520357442	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.0)		0	Y4-{Y4 Y5}	1	100.0	Confident
2737	P59998	IVAEEFLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35777 (Experiment 1)	35777	62.438	474.773743	2+	2+	947.5327834385903	0	0.1575780165070027								96.7479674796748	Confident
2738	P37173	FPQLCKFCDVR		Carbamidomethylation of C(5, 8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37334 (Experiment 1)	37334	64.324	735.355896	2+	2+	1468.6955258259202	0	1.164906993208174								99.45652173913044	Confident
2739	P35579	RGDLPFVVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33312 (Experiment 1)	33312	59.554	385.892853	3+	3+	1154.6560268891003	0	0.6070000043209509								100.0	Confident
2740	P14678, P63162	MLQHIDYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18625 (Experiment 1)	18625	41.831	578.255188	2+	2+	1154.4943800154101	0	1.2477646515109202	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 94.76439790575917)	Y7	1		0	94.08602150537635	Confident
2741	Q969Q0	GKDSLYAQGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9040 (Experiment 1)	9040	26.7	587.766357	2+	2+	1173.5179519109602	0	0.17792397468406834	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
2742	Q92499	ALIVEPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21317 (Experiment 1)	21317	45.173	442.763336	2+	2+	883.5127167003502	0	-0.6748905365878607								94.03794037940379	Confident
2743	A5A3E0, P0CG38, P0CG39, P60709, P63261, P68032, P68133, Q6S8J3, Q9BYX7	IWHHTFYNELR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26874 (Experiment 1)	26874	52.079	532.578674	3+	3+	1594.7082122921302	0	3.743002433356179	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2744	Q9UQR1	NDYLPLYSSSTKVK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26118 (Experiment 1)	26118	51.21	848.401245	2+	2+	1693.7964181598406	1	-6.979510963541525	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 7.165696228856888)	Phosphorylation of Y (3: 90.40139616055846)		0	Y7-{Y3 Y7}	1	91.30434782608697	Doubtful
2745	P25705	HALIIYDDLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33150 (Experiment 1)	33150	59.369	644.34729	2+	2+	1286.6870522338602	0	-5.451353095296913								100.0	Doubtful
2746	P52272	FEPYANPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19659 (Experiment 1)	19659	43.105	533.764709	2+	2+	1065.5131106231702	0	1.6434639266483582								92.40837696335078	Confident
2747	Q96RU3	ADYSSILQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26142 (Experiment 1)	26142	51.237	552.752686	2+	2+	1103.4900058276203	0	0.735626777121184	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2748	Q08211	YQILPLHSQIPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33761 (Experiment 1)	33761	60.07	488.948975	3+	3+	1463.82488311935	0	0.14485509100438027								100.0	Confident
2749	P14625	DISTNYYASQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19359 (Experiment 1)	19359	42.736	685.286377	2+	2+	1368.5598762925904	0	-1.2222803656476162	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (7: 0.0)		0	Y6-{Y6 Y7}	1	100.0	Confident
2750	Q15366	GVTIPYRPKPSSSPVIFAGGQDR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33231 (Experiment 1)	33231	59.461	837.090454	3+	3+	2508.25262304358	0	-1.2306277448665282	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2751	P60842	DQIYDIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45036 (Experiment 1)	45036	76.65	625.27887	2+	2+	1248.5427696764702	0	0.3337631134792359	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
2752	P16401	KALAAGGYDVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14587 (Experiment 1)	14587	36.174	407.886688	3+	3+	1220.6401020414403	0	-1.5261093185731602								92.61744966442953	Doubtful
2753	P38919	EQIYDVYR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30417 (Experiment 1)	30417	56.212	583.250671	2+	2+	1164.4852548003503	0	1.3152732777397285	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 21.903613622409644)	Phosphorylation of Y (4: 52.62298712804211)		0	Y4-{Y4 Y7}	1	100.0	Confident
2754	P11388	TPPLITDYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30918 (Experiment 1)	30918	56.789	538.29303	2+	2+	1074.5709598524602	0	0.5082865311235008								92.22520107238606	Confident
2755	Q07666	ILGPQGNTIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18876 (Experiment 1)	18876	42.142	520.808167	2+	2+	1039.6025943339102	0	-0.7807739498853774								95.4177897574124	Confident
2756	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	DLTDYLMK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46492 (Experiment 1)	46492	79.565	539.730103	2+	2+	1077.4453641343202	0	0.2676635334150622	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
2757	Q06830	DISLSDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26537 (Experiment 1)	26537	51.692	510.717926	2+	2+	1019.4212575614604	0	0.04063389518047642	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.77835951134381)	Y7	1		0	99.73045822102425	Confident
2758	P18669	HGESAWNLENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20767 (Experiment 1)	20767	44.435	438.205994	3+	3+	1311.59561146051	0	0.41163234029953044								100.0	Confident
2759	P31146	LQATVQELQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20453 (Experiment 1)	20453	44.076	579.330261	2+	2+	1156.6451874218803	0	0.6746109044739094								100.0	Confident
2760	P67809	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20451 (Experiment 1)	20451	44.074	826.629883	4+	4+	3302.4888006228407	0	0.49160777494014585	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Doubtful
2761	P52209	GILFVGSGVSGGEEGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39009 (Experiment 1)	39009	66.369	796.407043	2+	2+	1590.8001844931403	0	-0.40897836327114806								100.0	Confident
2762	P23284	DFMIQGGDFTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41180 (Experiment 1)	41180	69.441	643.794373	2+	2+	1285.5761218858902	0	-1.4980067440322662								99.73474801061008	Confident
2763	P08865	LLVVTDPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26417 (Experiment 1)	26417	51.554	456.77948	2+	2+	911.54401682863	0	0.42716226300394944								100.0	Confident
2764	P11142	NQVAMNPTNTVFDAKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27095 (Experiment 1)	27095	52.336	602.636597	3+	3+	1804.8890165808805	0	-0.583536139945142								100.0	Confident
2765	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27961 (Experiment 1)	27961	53.356	523.251038	2+	2+	1044.4892775516303	0	-1.6765206235411527	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
2766	P52566	APNVVVTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13529 (Experiment 1)	13529	34.538	428.255737	2+	2+	854.4974009893801	0	-0.5603225989293683								99.73474801061008	Confident
2767	P55884	GTYLATFHQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21942 (Experiment 1)	21942	46.154	637.2901	2+	2+	1272.5652364565503	0	0.3221530962906877	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2768	Q9NV06	SIYSQIQEQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26338 (Experiment 1)	26338	51.464	666.302429	2+	2+	1330.5918451272103	0	-1.1556757019381407	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2769	Q5T1J5, Q9Y6H1	AAPRPAPVAQPPAAAPPSAVGSSAAAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20568 (Experiment 1)	20568	44.208	845.125549	3+	3+	2532.356103418151	0	-0.507150658173822								100.0	Confident
2770	Q14566	LGFSEYCR	Phosphorylation of Y(6)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28050 (Experiment 1)	28050	53.458	556.217834	2+	2+	1110.4205463688102	0	0.5112186464853276	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.73118279569893	Confident
2771	P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0	FDSDVGEYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19819 (Experiment 1)	19819	43.312	584.220581	2+	2+	1166.4281338470503	0	-1.3049683066147655	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
2772	P62917	GVAMNPVEHPFGGGNHQHIGKPSTIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19939 (Experiment 1)	19939	43.474	548.281311	5+	5+	2736.3666851851904	0	1.2721517644500548								100.0	Doubtful
2773	P05141	AAYFGIYDTAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40022 (Experiment 1)	40022	67.764	650.285889	2+	2+	1298.5584197406101	0	-0.9185753197898886	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 18.111436865187635)	Phosphorylation of Y (7: 96.68411867364746)		0	Y7-{Y3 Y7}	1	98.7468671679198	Confident
2774	P62244	WQNNLLPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32306 (Experiment 1)	32306	58.405	564.302246	2+	2+	1126.5883412521	0	1.4157453290387856								100.0	Confident
2775	Q13813	TATDEAYKDPSNLQGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13082 (Experiment 1)	13082	33.848	606.60083	3+	3+	1816.7880383041104	0	-4.0541073424755085	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2776	P27695	NAGFTPQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13398 (Experiment 1)	13398	34.316	510.248535	2+	2+	1018.4832074772203	0	-0.6765432232873384								98.91304347826086	Confident
2777	P62906	ILGPGLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20121 (Experiment 1)	20121	43.694	406.255493	2+	2+	810.4963383602201	0	0.11655986032959631								99.73333333333333	Confident
2778	P62241	LTPEEEEILNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29927 (Experiment 1)	29927	55.645	657.843384	2+	2+	1313.6714617393702	0	0.5725735451064742								96.19565217391303	Confident
2779	Q16881	VVYENAYGQFIGPHR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30916 (Experiment 1)	30916	56.787	610.618835	3+	3+	1828.8297839767902	0	2.6703160550651175	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 5.927251481515231)	Phosphorylation of Y (7: 0.0)		0	Y7-{Y3 Y7}	1	100.0	Confident
2780	Q5EBM0	TTVTQSVADSLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29320 (Experiment 1)	29320	54.944	625.334351	2+	2+	1248.6561460284004	0	-1.596712888720261								99.73544973544973	Confident
2781	P00338	DYNVTANSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9503 (Experiment 1)	9503	27.693	546.224365	2+	2+	1090.4332192274903	0	0.8767823139977277	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.74811083123426	Confident
2782	P43307	FLVGFTNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36285 (Experiment 1)	36285	63.08	463.260376	2+	2+	924.5069030439201	0	-0.7598070605997941								99.72826086956522	Confident
2783	P18754	SGQVYSFGCNDEGALGR	Phosphorylation of Y(5)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32537 (Experiment 1)	32537	58.674	948.883545	2+	2+	1895.75094160274	0	0.8407064204655275	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
2784	P12235, P12236	AAYFGVYDTAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35198 (Experiment 1)	35198	61.749	643.279358	2+	2+	1284.5427696764702	0	1.0830375616600738	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 21.224711603109583)	Phosphorylation of Y (7: 100.0)		0	Y7-{Y3 Y7}	1	100.0	Confident
2785	P42166, P42167	SELVANNVTLPAGEQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29821 (Experiment 1)	29821	55.52	849.44281	2+	2+	1696.8744120625604	0	-1.9689316096835465								100.0	Confident
2786	Q14974	TVSPDRLELEAAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23459 (Experiment 1)	23459	48.009	519.614441	3+	3+	1555.8205855845506	0	0.5824931403264895								100.0	Confident
2787	P27348	KQTIDNSQGAYQEAFDISKK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23143 (Experiment 1)	23143	47.616	588.528503	4+	4+	2350.0842203058005	0	0.2913313235973781	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.65095986038395)	Y11	1		0	100.0	Doubtful
2788	P42704	GFTLNDAANSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25502 (Experiment 1)	25502	50.5	583.283386	2+	2+	1164.5523496662004	0	-0.11195228008288054								99.73753280839895	Confident
2789	P09651, P22626, Q32P51	EDTEEHHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4783 (Experiment 1)	4783	17.617	583.264648	2+	2+	1164.5159641574803	0	-1.0467716760387797								100.0	Confident
2790	P11388	TLAVSGLGVVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35910 (Experiment 1)	35910	62.596	564.840149	2+	2+	1127.66625721963	0	-0.4533610287488511								99.72972972972973	Confident
2791	P07900, P08238, Q14568, Q58FF8, Q58FG1	TLTLVDTGIGMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40753 (Experiment 1)	40753	68.821	675.371643	2+	2+	1348.7272027936804	0	1.132912852439769								100.0	Confident
2792	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38588 (Experiment 1)	38588	65.854	931.480774	2+	2+	1860.9498991094704	0	-1.5588290433275211	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.68411867364746)	Y5	1		0	96.53333333333333	Confident
2793	Q14204	IFTIESTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28864 (Experiment 1)	28864	54.422	483.766724	2+	2+	965.5181960036102	0	0.7225210378078053								97.6063829787234	Confident
2794	Q96GX9	HGDEIYIAPSGVQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25472 (Experiment 1)	25472	50.463	797.369568	2+	2+	1592.7235875727504	0	0.624236418575965	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2795	P61247	KTSYAQHQQVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4350 (Experiment 1)	4350	16.952	449.236847	3+	3+	1344.6898461985204	0	-0.8418706885884213								100.0	Confident
2796	P04406	IISNASCTTNCLAPLAK		Carbamidomethylation of C(7, 11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30442 (Experiment 1)	30442	56.24	917.463989	2+	2+	1832.9124544474003	0	0.5289687119101041								99.72826086956522	Confident
2797	Q96RP9	EYGCPCITGKPK	Phosphorylation of Y(2)	Carbamidomethylation of C(4, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14469 (Experiment 1)	14469	36.007	745.314331	2+	2+	1488.61423744791	0	-0.08612575773181393	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2798	P62913	YDGIILPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33496 (Experiment 1)	33496	59.769	488.280426	2+	2+	974.5436824754602	0	2.679400798629716								99.45799457994579	Confident
2799	Q12906	LAAFGQLHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21157 (Experiment 1)	21157	44.931	492.788147	2+	2+	983.5552502186704	0	6.5858832980705015								99.7289972899729	Doubtful
2800	Q92835	EKLYDFVK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31638 (Experiment 1)	31638	57.639	561.267395	2+	2+	1120.5205776799105	0	-0.3034324053016834	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 94.76439790575917)	Y4	1		0	94.08602150537635	Confident
2801	O94921, P06239, P06241, P06493, P07947, P07948, P08631, P09769, P11362, P11802, P20794, P21802, P22455, P22607, P24941, P50750, P51451, Q00526, Q00534, Q00535, Q00536, Q00537, Q07002, Q14004, Q8IZL9, Q96Q40, Q9NYV4, Q9UPZ9	LADFGLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31837 (Experiment 1)	31837	57.872	431.742371	2+	2+	861.4708518883701	0	-0.7676122727355855								99.73262032085562	Confident
2802	P27824	APVPTGEVYFADSFDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43898 (Experiment 1)	43898	73.956	885.920898	2+	2+	1769.8260648878104	0	0.6649461320314585								92.8388746803069	Confident
2803	Q02878	HLTDAYFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21352 (Experiment 1)	21352	45.227	497.75351	2+	2+	993.4919812557703	0	0.488003432563326								97.8319783197832	Confident
2804	P18124	QIFNGTFVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33992 (Experiment 1)	33992	60.346	527.291199	2+	2+	1052.5654805492002	0	2.2421410425186443								96.19565217391303	Confident
2805	P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1	AGLQFPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33920 (Experiment 1)	33920	60.255	472.769684	2+	2+	943.5239500903901	0	0.9147972114716041								100.0	Confident
2806	P10809	GYISPYFINTSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41899 (Experiment 1)	41899	70.509	735.339172	2+	2+	1468.6639474383103	0	-0.1063263891251716	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.586359469818625)	Phosphorylation of Y (2: 100.0)		0	Y2-{Y2 Y6}	1	100.0	Confident
2807	P00338	SADTLWGIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35657 (Experiment 1)	35657	62.283	559.796143	2+	2+	1117.5767735088903	0	0.8570604853706306								100.0	Confident
2808	P49189	VTIEYYSQLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36745 (Experiment 1)	36745	63.621	662.316162	2+	2+	1322.6159346167303	0	1.3863863641312764	Phosphorylation of Y (6: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (6: 5.846422338568935)		0	Y6-{Y5 Y6}	1	91.30434782608697	Confident
2809	P04179	HHAAYVNNLNVTEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 15982 (Experiment 1)	15982	38.318	580.289124	3+	3+	1737.8434462874504	0	1.2041782570910948								100.0	Confident
2810	P19338	EVFEDAAEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30747 (Experiment 1)	30747	56.59	589.78717	2+	2+	1177.5615173675703	0	-1.4668839408910308								100.0	Confident
2811	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29599 (Experiment 1)	29599	55.264	452.230652	3+	3+	1353.6693671719202	0	0.5597645550358735	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2812	O00567	VVSLSEYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24416 (Experiment 1)	24416	49.23	476.757629	2+	2+	951.5025459394701	0	-1.9306136158298062								99.72972972972973	Confident
2813	P07900	APFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44211 (Experiment 1)	44211	74.618	554.774719	2+	2+	1107.5349086969104	0	-0.021297414274561843								100.0	Confident
2814	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGRPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29652 (Experiment 1)	29652	55.325	400.240173	3+	3+	1197.69822605425	0	0.3860561103065634								100.0	Confident
2815	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	QLFHPEQLITGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36800 (Experiment 1)	36800	63.687	470.92926	3+	3+	1409.7666995368902	0	-0.5301128306560053								100.0	Confident
2816	Q9P258	DGQILPVPNVVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43455 (Experiment 1)	43455	73.196	703.411133	2+	2+	1404.8088987020403	0	-0.8427750214079247								99.45799457994579	Confident
2817	P26641	STFVLDEFKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35659 (Experiment 1)	35659	62.285	414.555634	3+	3+	1240.6451874218803	0	-0.09232561034247692								100.0	Confident
2818	P62253	DYPLRPPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24085 (Experiment 1)	24085	48.818	533.763062	2+	2+	1064.5055963221103	1	2.4564997363863847	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	96.19565217391303	Confident
2819	P23284	HYGPGWVSMANAGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29952 (Experiment 1)	29952	55.673	777.832092	2+	2+	1553.6486488106805	0	0.6314063958451226	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2820	P78527	MYAALGDPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21780 (Experiment 1)	21780	45.926	523.224792	2+	2+	1044.4351338037902	0	-0.09817711803135486	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2821	P62899	EYTINIHK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17213 (Experiment 1)	17213	39.888	549.254944	2+	2+	1096.4954255612304	0	-0.08237963809828817	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	99.45799457994579	Confident
2822	P26038, Q8TAM6	QRIDEFESM			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32563 (Experiment 1)	32563	58.703	577.76062	2+	2+	1153.5073736197303	0	-0.5941500015032477								99.7340425531915	Confident
2823	P33992	VAIHEAMEQQTISIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27461 (Experiment 1)	27461	52.766	590.312683	3+	3+	1767.9189197268304	0	-1.524685265571102								92.99363057324841	Doubtful
2824	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43597 (Experiment 1)	43597	73.42	597.636597	3+	3+	1789.88464239309	0	1.851299287669163								97.76119402985076	Confident
2825	P62888	KSEIEYYAMLAK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35238 (Experiment 1)	35238	61.796	763.35498	2+	2+	1524.6935333144304	0	1.2273151378747227	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (7: 0.0)		0	Y6-{Y6 Y7}	1	100.0	Confident
2826	P08621	EFEVYGPIKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29639 (Experiment 1)	29639	55.311	659.315918	2+	2+	1316.6166033230702	0	0.5154916160265853	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2827	P78527	SIGEYDVLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33124 (Experiment 1)	33124	59.338	566.255066	2+	2+	1130.5009048644902	0	-4.702627304137897	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 76.73667205169629)	Y5	1		0	93.65079365079364	Doubtful
2828	P10809	ISSIQSIVPALEIANAHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45119 (Experiment 1)	45119	76.835	640.362488	3+	3+	1918.0636098145703	0	1.0539796681702194								100.0	Confident
2829	P33991	THIDVIHYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18907 (Experiment 1)	18907	42.179	411.864197	3+	3+	1232.5703218369902	0	0.35591240478155206	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
2830	P10606	LVPQQLAH			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19971 (Experiment 1)	19971	43.512	453.263824	2+	2+	904.5130510535203	0	0.048551037641119725								99.45652173913044	Confident
2831	Q15717	NVALLSQLYHSPAR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39754 (Experiment 1)	39754	67.404	824.91333	2+	2+	1647.8134056366603	0	-0.7870943620006273	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
2832	Q15181	VIAINVDDPDAANYNDINDVKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35275 (Experiment 1)	35275	61.84	815.407959	3+	3+	2443.1979310109	0	1.6828368123039261								99.28057553956835	Confident
2833	P61247	LFCVGFTK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37703 (Experiment 1)	37703	64.779	486.255341	2+	2+	970.4946241080602	0	1.547500374706018								100.0	Confident
2834	P22314	AENYDIPSADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21072 (Experiment 1)	21072	44.819	625.785156	2+	2+	1249.5574946162901	0	-1.3866959697596737								99.7289972899729	Confident
2835	P46781	SPYGGGRPGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5413 (Experiment 1)	5413	18.969	542.240051	2+	2+	1082.46585676845	0	-0.28373225691412607	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.30191972076788)	Y3	1		0	99.72826086956522	Confident
2836	P62805	RISGLIYEETR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28920 (Experiment 1)	28920	54.485	708.848206	2+	2+	1415.6809944847805	0	0.6098499758469271	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
2837	Q9Y3A6	ECFYQPMPLK	Phosphorylation of Y(4)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36586 (Experiment 1)	36586	63.43	696.789734	2+	2+	1391.5654963503403	0	-0.41711559001713977	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2838	Q53H96	IAAQTLLGTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29455 (Experiment 1)	29455	55.098	543.829773	2+	2+	1085.64445914589	0	0.49088958940292465								100.0	Confident
2839	P31146	DAGPLLISLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44028 (Experiment 1)	44028	74.196	513.813782	2+	2+	1025.6120963884503	0	0.8900877824614536								94.03794037940379	Confident
2840	P27348, P31946, P31947, P61981, Q04917	VISSIEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12603 (Experiment 1)	12603	33.107	452.261627	2+	2+	902.5072969667403	0	1.5523114625116152								93.47258485639686	Confident
2841	P10412, P16402, P16403, P22492, Q02539	ALAAAGYDVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21319 (Experiment 1)	21319	45.176	554.287903	2+	2+	1106.5607890915803	0	0.4185324876032731								100.0	Confident
2842	P62993	ATADDELSFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27008 (Experiment 1)	27008	52.236	548.762451	2+	2+	1095.5084191655503	0	1.7584149714449318								92.3076923076923	Confident
2843	Q96BZ4	TSTDLQVLAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30144 (Experiment 1)	30144	55.897	587.825073	2+	2+	1173.6353510141703	0	0.20588799838196337								100.0	Confident
2844	Q06830	HGEVCPAGWKPGSDTIKPDVQK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20293 (Experiment 1)	20293	43.89	802.73468	3+	3+	2405.17977884896	0	1.0097786645446751								100.0	Confident
2845	P62917	AVVGVVAGGGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17051 (Experiment 1)	17051	39.656	471.279907	2+	2+	940.5454138109601	0	-0.16205290851054596								99.74489795918367	Confident
2846	P46776	TGAAPIIDVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34957 (Experiment 1)	34957	61.476	556.327026	2+	2+	1110.6397081186203	0	-0.18788607718500575								100.0	Confident
2847	Q12906	AYAALAALEK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36743 (Experiment 1)	36743	63.617	550.773376	2+	2+	1099.5314767167804	0	0.6557597921388589	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2848	P25685	DYYQTLGLAR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38318 (Experiment 1)	38318	65.528	640.288635	2+	2+	1278.5645677502102	0	-1.445192885389813	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 0.17452006980802792)		0	Y2-{Y2 Y3}	1	100.0	Confident
2849	P60842	KGVAINMVTEEDKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18311 (Experiment 1)	18311	41.421	530.61554	3+	3+	1588.8242910660003	0	0.3138076961555334								99.26470588235294	Confident
2850	P11940, Q4VXU2, Q5JQF8, Q9H361	FSPAGPILSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41365 (Experiment 1)	41365	69.711	579.338013	2+	2+	1156.6604435632	0	0.8885176421575061								100.0	Confident
2851	P48556	ILFTEATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29036 (Experiment 1)	29036	54.619	475.769135	2+	2+	949.5232813840503	0	0.45787178407608053								99.73118279569893	Confident
2852	P02786	GFVEPDHYVVVGAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31172 (Experiment 1)	31172	57.089	558.286804	3+	3+	1671.8369043550306	0	1.0020215434288324								100.0	Confident
2853	P38919	EQIYDVYR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30643 (Experiment 1)	30643	56.47	583.249939	2+	2+	1164.4852548003503	0	0.06023663715452408	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 33.71425499502057)	Phosphorylation of Y (4: 87.25103652405754)		0	Y4-{Y4 Y7}	1	100.0	Confident
2854	Q15029	LGEFFQTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34166 (Experiment 1)	34166	60.552	485.255432	2+	2+	968.4967322830403	0	-0.43401521511196667								91.30434782608697	Confident
2855	O14920	VIYTQLSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20518 (Experiment 1)	20518	44.15	516.266541	2+	2+	1030.5100129962102	0	8.24781360809604	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	99.72826086956522	Doubtful
2856	P0DMV8	LLQDFFNGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43233 (Experiment 1)	43233	72.852	555.290283	2+	2+	1108.5665431783602	0	-0.47732847798834427								99.1869918699187	Confident
2857	P30101	LSKDPNIVIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18048 (Experiment 1)	18048	41.048	399.911163	3+	3+	1196.7128730588804	0	-1.0114397074156964								92.66666666666666	Doubtful
2858	P35232	EFTEAVEAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18338 (Experiment 1)	18338	41.456	512.254028	2+	2+	1022.4920408254204	0	1.4272635866560983								99.74811083123426	Confident
2859	Q01469	KMGAMAKPDCIITCDGK		Carbamidomethylation of C(10, 14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20200 (Experiment 1)	20200	43.786	632.633179	3+	3+	1894.8773318919798	0	0.1979597188312857								98.49624060150376	Confident
2860	P49327	RPTPQDSPIFLPVDDTSFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43406 (Experiment 1)	43406	73.132	730.036804	3+	3+	2187.0960321416605	0	-3.4014343372522506								91.72932330827068	Doubtful
2861	P07195	MVVESAYEVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 35993 (Experiment 1)	35993	62.703	634.334229	2+	2+	1266.6529752242604	0	0.7329281272462104								99.72826086956522	Confident
2862	P68104, Q5VTE0	MDSTEPPYSQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14525 (Experiment 1)	14525	36.09	641.785156	2+	2+	1281.5547177349702	0	0.8112779181884491								99.73118279569893	Confident
2863	P52292	EKQPPIDNIIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25579 (Experiment 1)	25579	50.589	441.585388	3+	3+	1321.7353994086102	0	-0.8037767395416188								98.50746268656717	Confident
2864	P17844, Q92841	GDGPICLVLAPTR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43115 (Experiment 1)	43115	72.627	684.868652	2+	2+	1367.72312047275	0	-0.26969132945658114								100.0	Confident
2865	P46777	GAVDGGLSIPHSTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21194 (Experiment 1)	21194	44.989	446.905273	3+	3+	1337.69392851945	0	0.04555783996461426								100.0	Confident
2866	HBA_HUMAN, P69905	VGAHAGEYGAEALER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20489 (Experiment 1)	20489	44.118	510.582947	3+	3+	1528.7270195528804	0	-0.0051923110468442175								100.0	Confident
2867	P40926	TIIPLISQCTPK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40278 (Experiment 1)	40278	68.144	685.890686	2+	2+	1369.7639226555702	0	2.1114275060259544								99.46236559139786	Confident
2868	P62241	LDVGNFSWGSECCTR		Carbamidomethylation of C(12, 13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42540 (Experiment 1)	42540	71.587	894.379822	2+	2+	1786.7403037418603	0	2.6763446638050366								91.05691056910568	Doubtful
2869	P00558	ALESPERPFLAILGGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45923 (Experiment 1)	45923	78.612	590.337585	3+	3+	1767.9883196159903	0	1.4714673290785454								100.0	Confident
2870	P49327	VYATILNAGTNTDGFK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41224 (Experiment 1)	41224	69.496	882.913391	2+	2+	1763.8131308531401	0	-0.5106878618274198	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.03069466882067)	Y2	1		0	99.45799457994579	Confident
2871	O75832	GAQVNAVNQNGCTPLHYAASK	Phosphorylation of Y(17)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23802 (Experiment 1)	23802	48.46	761.006714	3+	3+	2279.0154295533303	1	-8.970840193846927	Phosphorylation of Y (17: Very Confident)	Phosphorylation of Y (17: 100.0)	Phosphorylation of Y (17: 100.0)	Y17	1		0	100.0	Doubtful
2872	Q9Y230	GLGLDDALEPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37487 (Experiment 1)	37487	64.516	578.303223	2+	2+	1154.5931518490202	0	-1.088340185781599								100.0	Confident
2873	Q6IA86	AVHLQGHEGPVYAVHAVYQR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26666 (Experiment 1)	26666	51.839	578.534424	4+	4+	2310.1058992402404	0	1.1628070553859973	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 3.6328551300071457)	Phosphorylation of Y (12: 100.0)		0	Y12-{Y12 Y18}	1	100.0	Doubtful
2874	P62805	TVTAMDVVYALKR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46377 (Experiment 1)	46377	79.381	516.261414	3+	3+	1545.7626159337606	0	-0.13128631130851606	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	100.0	Confident
2875	P07900, P08238, Q14568, Q58FF7, Q58FF8	YESLTDPSKLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22477 (Experiment 1)	22477	46.827	770.379028	2+	2+	1538.7464175847801	0	-1.8916097046609868								91.44385026737967	Confident
2876	O14745	EALAEAALESPRPALVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35157 (Experiment 1)	35157	61.703	598.337036	3+	3+	1791.9842968647104	0	2.7753302793263375								100.0	Confident
2877	P26641	EYFSWEGAFQHVGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45974 (Experiment 1)	45974	78.705	588.919434	3+	3+	1763.7344866096205	0	1.1240882093329638	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2878	P11388, Q02880	LCNIFSTK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32227 (Experiment 1)	32227	58.314	491.754608	2+	2+	981.4953523840502	0	-0.7008751720203152								99.72972972972973	Confident
2879	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29532 (Experiment 1)	29532	55.187	677.842957	2+	2+	1353.6693671719202	0	1.4707664714748505	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
2880	P51153, P59190, P61006, P61026, P62820, Q15286, Q92928, Q92930, Q9H0U4	LLLIGDSGVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38549 (Experiment 1)	38549	65.809	536.323608	2+	2+	1070.6335601090202	0	-0.8362879059549106								100.0	Confident
2881	P61353	VYNYNHLMPTR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27230 (Experiment 1)	27230	52.494	496.555145	3+	3+	1486.64283515425	0	0.5171937901722866	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 4.835273877102008)	Phosphorylation of Y (4: 0.8726003490401396)		0	Y2-{Y2 Y4}	1	99.24812030075188	Confident
2882	Q96RP9	KGDTIYNTR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7685 (Experiment 1)	7685	23.834	574.262817	2+	2+	1146.5070528740903	0	3.5072847261122537	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
2883	Q6PJG2	AGTFIAPPVYSNITPYQSHLRSPVR	Phosphorylation of Y(16, 10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41143 (Experiment 1)	41143	69.388	977.805237	3+	3+	2930.38814414775	0	1.955898379480807	Phosphorylation of Y (10: Very Confident, 16: Very Confident)		Phosphorylation of Y (10: 97.38219895287958, 16: 97.38219895287958)	Y10, Y16	2		0	92.14285714285715	Doubtful
2884	O60234	TTDDLTEAWLQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42260 (Experiment 1)	42260	71.13	775.373962	2+	2+	1548.7307675206405	0	1.6788996239692862								96.4769647696477	Confident
2885	P53675, Q00610	AHIAQLCEK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 10986 (Experiment 1)	10986	30.463	535.275757	2+	2+	1068.5386141783601	0	-1.544166170425898								99.7289972899729	Confident
2886	P18754	SGQVYSFGCNDEGALGR	Phosphorylation of Y(5)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32308 (Experiment 1)	32308	58.407	948.887695	2+	2+	1895.75094160274	0	5.214271027820049	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Doubtful
2887	Q16666	LTCFELAPK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32721 (Experiment 1)	32721	58.881	539.784546	2+	2+	1077.5528672601702	0	1.5485889758970914								99.72972972972973	Confident
2888	Q02878	VLATVTKPVGGDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13438 (Experiment 1)	13438	34.379	642.880554	2+	2+	1283.7449014631502	0	1.2860906602106024								100.0	Confident
2889	Q9UII2	EQLAALKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10806 (Experiment 1)	10806	30.14	450.779236	2+	2+	899.5440168286302	0	-0.10843694171932183								99.73474801061008	Confident
2890	P07900	RAPFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39636 (Experiment 1)	39636	67.238	422.218872	3+	3+	1263.6360197205104	0	-0.9735233136165509								98.49624060150376	Confident
2891	Q92598	QDLPSLDEKPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20791 (Experiment 1)	20791	44.463	433.229614	3+	3+	1296.6673794184403	0	-0.28223584043816846								100.0	Confident
2892	P60174	RHVFGESDELIGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20821 (Experiment 1)	20821	44.499	538.94635	3+	3+	1613.8161689104502	0	0.6504604140697441								100.0	Confident
2893	P08559	EILAELTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38521 (Experiment 1)	38521	65.778	501.285492	2+	2+	1000.5553097883203	0	1.1184039112148572								99.45799457994579	Confident
2894	Q8NBX0	SAIYGFGDQSNLRK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26311 (Experiment 1)	26311	51.432	545.922729	3+	3+	1634.7453856464901	0	0.5934622850113438	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.65095986038395)	Y4	1		0	100.0	Confident
2895	B2RPK0, P09429	IKGEHPGLSIGDVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19995 (Experiment 1)	19995	43.539	507.619598	3+	3+	1519.8358417258703	0	0.7373464474386182								100.0	Confident
2896	Q9Y490	AVTQALNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11349 (Experiment 1)	11349	31.086	436.751129	2+	2+	871.4875645816703	0	0.16082926753802299								92.81914893617021	Confident
2897	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32618 (Experiment 1)	32618	58.765	565.801208	2+	2+	1129.58800689893	0	-0.12710518627652317								100.0	Confident
2898	P62266	VANVSLLALYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43661 (Experiment 1)	43661	73.532	595.86084	2+	2+	1189.7070594024503	0	0.05677829865585453								100.0	Confident
2899	Q13630	ILVTGGSGLVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28156 (Experiment 1)	28156	53.589	550.837402	2+	2+	1099.6601092100302	0	0.12876428088074054								99.45652173913044	Confident
2900	P22626	TLETVPLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26953 (Experiment 1)	26953	52.174	529.298889	2+	2+	1056.5815245361603	0	1.6064013950648468								99.45799457994579	Confident
2901	P62851	LITPAVVSER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28702 (Experiment 1)	28702	54.23	542.821716	2+	2+	1083.6288090817504	0	0.06446373454311549								100.0	Confident
2902	P46782	VNQAIWLLCTGAR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44939 (Experiment 1)	44939	76.427	751.402039	2+	2+	1500.78711771164	0	1.6019111389578975								99.73190348525469	Confident
2903	Q9HBI0	VLYGLFCK	Phosphorylation of Y(3)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43508 (Experiment 1)	43508	73.271	540.253845	2+	2+	1078.4922547570902	0	0.8165698533907092	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 94.06631762652705)	Y3	1		0	93.65079365079364	Confident
2904	Q99623	LGLDYEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26664 (Experiment 1)	26664	51.836	497.745422	2+	2+	993.4767251144503	0	-0.43601393984769377								100.0	Confident
2905	P23284	VIKDFMIQGGDFTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37937 (Experiment 1)	37937	65.056	542.949341	3+	3+	1625.8235627900103	0	1.615137671326468								99.28057553956835	Confident
2906	Q99497	DVVICPDASLEDAKK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28131 (Experiment 1)	28131	53.556	553.946106	3+	3+	1658.8185369792204	0	-1.2325971242555427								100.0	Confident
2907	Q12905	VLQSALAAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33310 (Experiment 1)	33310	59.552	521.324585	2+	2+	1040.6342288153603	0	0.3723698931619986								100.0	Confident
2908	P39656	SSLNPILFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40601 (Experiment 1)	40601	68.615	523.803589	2+	2+	1045.5920296502102	0	0.5683585570675744								97.289972899729	Confident
2909	P31948	IGNSYFKEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16707 (Experiment 1)	16707	39.215	405.540222	3+	3+	1213.5979028762906	0	0.7674733925877941								94.8905109489051	Confident
2910	P07900, P08238	SLTNDWEDHLAVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35632 (Experiment 1)	35632	62.253	510.249542	3+	3+	1526.7365216074204	1	-8.55026916358812								96.71052631578947	Doubtful
2911	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20014 (Experiment 1)	20014	43.566	713.290344	2+	2+	1424.5666150733405	0	-0.3364736443834046	Phosphorylation of Y (4: Doubtfull, 9: Confident)		Phosphorylation of Y (4: 49.188157445860725, 9: 96.68411867364746)	Y9	1	Y4-{Y4}	1	99.48320413436691	Confident
2912	P04899, P08754, P63096	EIYTHFTCATDTK	Phosphorylation of Y(3)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23060 (Experiment 1)	23060	47.521	556.2323	3+	3+	1665.6745887750005	0	0.28874309200052956	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2913	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21604 (Experiment 1)	21604	45.646	759.858459	2+	2+	1517.7014551458406	0	0.5987437985388199	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
2914	P25705	STVAQLVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20202 (Experiment 1)	20202	43.788	423.258942	2+	2+	844.5018176634803	0	1.7878010967130942								97.56756756756756	Confident
2915	P26038	ISQLEMAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20487 (Experiment 1)	20487	44.115	474.253204	2+	2+	946.4906013567802	0	1.3217741518713462								100.0	Confident
2916	P0DMV8, P11021, P11142, P17066, P34931, P48741, P54652	VEIIANDQGNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17553 (Experiment 1)	17553	40.36	614.817078	2+	2+	1227.6207635791902	0	-0.9437861768526555								100.0	Confident
2917	O43390	DYAFVHFEDR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37695 (Experiment 1)	37695	64.769	689.776245	2+	2+	1377.5390812783603	0	-0.8294073938372751	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
2918	GSTP1_HUMAN, P09211	PPYTVVYFPVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46547 (Experiment 1)	46547	79.646	709.34967	2+	2+	1416.6842889600703	0	0.35110080503114904	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 46.35930292195819)	Phosphorylation of Y (7: 68.12217015096597)		0	Y7-{Y3 Y7}	1	100.0	Confident
2919	O43809	TVEGVLIVHEHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19999 (Experiment 1)	19999	43.545	463.593262	3+	3+	1387.7571974823504	0	0.5458215855410086								92.14285714285715	Doubtful
2920	Q9Y4B4	IQRDLYTQFMDRFR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42594 (Experiment 1)	42594	71.675	985.463806	2+	2+	1967.9077170276605	1	1.008771231998203	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 94.24083769633508)	Y6	1		0	93.65079365079364	Doubtful
2921	P13639	GEGQLGPAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11575 (Experiment 1)	11575	31.416	507.25412	2+	2+	1012.4937721609201	0	-0.08387762025062885								93.08510638297872	Confident
2922	P33316	IAQLICER		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23301 (Experiment 1)	23301	47.814	501.774841	2+	2+	1001.5328005219301	0	2.3203134739391222								100.0	Confident
2923	P63104	FLIPNASQAESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31756 (Experiment 1)	31756	57.776	652.845886	2+	2+	1303.6772158261506	0	0.0024816156818873777								100.0	Confident
2924	P26373	TIGISVDPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26729 (Experiment 1)	26729	51.91	479.271851	2+	2+	956.5290950404801	0	0.056362478781407654								90.2439024390244	Doubtful
2925	P41091	VGQEIEVRPGIVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22748 (Experiment 1)	22748	47.147	504.291504	3+	3+	1509.8514917900102	0	0.7871178221391457								100.0	Confident
2926	P09874	TTNFAGILSQGLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45374 (Experiment 1)	45374	77.382	689.378479	2+	2+	1376.74121306504	0	0.8645485771755207								99.72826086956522	Confident
2927	Q99798	DGYAQILR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28484 (Experiment 1)	28484	53.976	508.234283	2+	2+	1014.4535607492501	0	0.4449889966346893	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.12277867528272)	Y3	1		0	99.45945945945947	Confident
2928	P15880	TYSYLTPDLWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45403 (Experiment 1)	45403	77.444	693.852661	2+	2+	1385.6867178806901	0	2.9193499861551526								99.7289972899729	Confident
2929	P00338	QVVESAYEVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31255 (Experiment 1)	31255	57.183	632.843323	2+	2+	1263.6710678165505	0	0.8100351372253913								100.0	Confident
2930	Q08211	LAQFEPSQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18990 (Experiment 1)	18990	42.278	538.28125	2+	2+	1074.54580773378	0	1.9871924268719503								99.45799457994579	Confident
2931	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29059 (Experiment 1)	29059	54.645	600.288269	3+	3+	1797.84107693648	0	1.0554179762053955	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.83844911147011)	Y9	1		0	100.0	Confident
2932	Q99832	ATISNDGATILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25090 (Experiment 1)	25090	50.014	602.333008	2+	2+	1202.6506667251404	0	0.6610477520267004								99.73045822102425	Confident
2933	Q01469	KTQTVCNFTDGALVQHQEWDGK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31257 (Experiment 1)	31257	57.185	641.305176	4+	4+	2561.1968854650804	0	-2.0611565400973153								100.0	Doubtful
2934	P10696	VQHASPAGAYAHTVNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10670 (Experiment 1)	10670	29.897	420.465942	4+	4+	1677.8335503100907	0	0.6610662631121536								100.0	Doubtful
2935	O75347	RLEAAYLDLQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32700 (Experiment 1)	32700	58.857	476.572144	3+	3+	1426.6969789020902	0	-1.6620768450921781	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.30191972076788)	Y6	1		0	100.0	Confident
2936	P42224	TELISVSEVHPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26181 (Experiment 1)	26181	51.281	485.260193	3+	3+	1452.7572570520003	0	1.0252569072194908								98.57142857142858	Confident
2937	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28342 (Experiment 1)	28342	53.808	528.262634	2+	2+	1054.5100129962104	0	0.6645090783086571	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
2938	P16949	ASGQAFELILSPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44666 (Experiment 1)	44666	75.811	694.881958	2+	2+	1387.74596409231	0	2.4457264573932256								100.0	Confident
2939	P40926	ANTFVAELK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30521 (Experiment 1)	30521	56.331	496.772797	2+	2+	991.5338460677503	0	-2.8232156350233866								100.0	Confident
2940	P11021	ELEEIVQPIISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41249 (Experiment 1)	41249	69.528	699.39801	2+	2+	1396.7813465415202	0	0.0861632892401234								99.74226804123711	Confident
2941	Q969Q0	GKDSLYAQGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8957 (Experiment 1)	8957	26.557	392.179993	3+	3+	1173.5179519109602	0	0.168025431063988	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	100.0	Confident
2942	P15104	QVYMSLPQGEK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30664 (Experiment 1)	30664	56.496	680.30426	2+	2+	1358.5941536263304	0	-0.13711506739625434	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2943	P28906	LGEDPYYTENGGGQGYSSGPGTSPEAQGK	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31424 (Experiment 1)	31424	57.381	995.408936	3+	3+	2982.2192697781206	1	-5.911085828733489	Phosphorylation of Y (16: Random)	Phosphorylation of Y (7: 0.0, 16: 0.0)	Phosphorylation of Y (16: 10.400437568898775)		0	Y16-{Y6 Y7 Y16}	1	100.0	Doubtful
2944	P14625	DISTNYYASQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21572 (Experiment 1)	21572	45.598	645.304504	2+	2+	1288.5935457718404	0	0.7045473651654414								99.72972972972973	Confident
2945	P47914	LAYIAHPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12389 (Experiment 1)	12389	32.775	456.768921	2+	2+	911.5228874612303	0	0.4396154201978206								99.73190348525469	Confident
2946	P49321	EAQLYAAQAHLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21602 (Experiment 1)	21602	45.643	474.898682	3+	3+	1421.6704298010804	0	2.657976457072866	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.28057553956835	Confident
2947	P40937	GPILSFASTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35960 (Experiment 1)	35960	62.662	524.792969	2+	2+	1047.5712942056302	0	0.08656818859189014								95.07772020725389	Confident
2948	P63173	YLYTLVITDKEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36221 (Experiment 1)	36221	63.004	495.944366	3+	3+	1484.8126466698006	0	-0.9262255033968401								100.0	Confident
2949	A3KN83, Q9Y2G9	VVYASATGASEPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14564 (Experiment 1)	14564	36.142	694.316589	2+	2+	1386.6180598750502	0	0.407012856002164	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
2950	Q9Y4H4	EQLYSTILSHQCQR	Phosphorylation of Y(4)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29848 (Experiment 1)	29848	55.551	614.945557	3+	3+	1841.8131479364804	0	0.9180566849257051	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
2951	P12268	REDLVVAPAGITLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35465 (Experiment 1)	35465	62.059	494.627502	3+	3+	1480.8613281977202	0	-0.4391168893025382								100.0	Confident
2952	P14174	LLCGLLAER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39921 (Experiment 1)	39921	67.634	522.79718	2+	2+	1043.5797507143502	0	0.053894732878750164								100.0	Confident
2953	Q9BUQ8	IDRIEESDQGPYAIILAPTR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40101 (Experiment 1)	40101	67.864	779.723511	3+	3+	2336.1413412591005	0	3.1474249235086194	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 99.83844911147011)	Y12	1		0	100.0	Confident
2954	Q16630	GDYGPPGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10176 (Experiment 1)	10176	28.99	449.676361	2+	2+	897.3381966438401	0	-0.030663679019764706	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
2955	P26599	DYGNSPLHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12740 (Experiment 1)	12740	33.332	569.738342	2+	2+	1137.4604370348402	0	1.486677242193758	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.45799457994579	Confident
2956	P08238	NPDDITQEEYGEFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37452 (Experiment 1)	37452	64.469	924.403748	2+	2+	1846.7897389487405	0	1.7330756150589879								100.0	Confident
2957	P23528, Q9Y281	YALYDATYETK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32511 (Experiment 1)	32511	58.642	709.299011	2+	2+	1416.5850284112705	0	-1.0992142640279572	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 7.859742557072435)	Phosphorylation of Y (4: 0.5235602094240838)		0	Y4-{Y1 Y4 Y8}	1	100.0	Confident
2958	P50502, Q8NFI4	LDYDEDASAMLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36034 (Experiment 1)	36034	62.757	685.811401	2+	2+	1369.6071472306503	0	0.8033087589070385								99.72826086956522	Confident
2959	P31948	TYEEGLKHEANNPQLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16207 (Experiment 1)	16207	38.607	624.31543	3+	3+	1869.9220905309703	0	1.265424217106565								100.0	Confident
2960	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	LLLPGELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38180 (Experiment 1)	38180	65.354	477.305237	2+	2+	952.5957180483204	0	0.21267114115266889								100.0	Confident
2961	P62805	KTVTAMDVVYALKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37699 (Experiment 1)	37699	64.773	532.30542	3+	3+	1593.8912484270104	0	1.9927024192878886								100.0	Confident
2962	P07900, Q58FG0	HIYYITGETK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21863 (Experiment 1)	21863	46.042	652.80011	2+	2+	1303.5849688416204	0	0.5347924412341175	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y4}	1	100.0	Confident
2963	P62805	DNIQGITKPAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21028 (Experiment 1)	21028	44.757	442.589569	3+	3+	1324.74629844548	0	0.43618616212724304								100.0	Confident
2964	P07900	LGIHEDSQNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9224 (Experiment 1)	9224	27.11	584.790466	2+	2+	1167.5632487030703	0	2.676490013141233								99.73958333333334	Confident
2965	P40121	YQEGGVESAFHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18852 (Experiment 1)	18852	42.112	451.214783	3+	3+	1350.6204292260206	0	1.5442584849473453								98.7012987012987	Confident
2966	P02786	VEYHFLSPYVSPK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36475 (Experiment 1)	36475	63.304	549.259583	3+	3+	1644.7589104523104	0	-1.2082024616741713	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 5.977069681091233)	Phosphorylation of Y (3: 67.2904560922729)		0	Y3-{Y3 Y9}	1	100.0	Confident
2967	P25788	LYEEGSNKR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5452 (Experiment 1)	5452	19.034	588.26062	2+	2+	1174.5019674936502	0	4.011480199145987	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 85.68935427574172)	Y2	1		0	92.78350515463917	Confident
2968	P16401	KATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24462 (Experiment 1)	24462	49.283	447.597687	3+	3+	1339.7711162109902	0	0.08593176948956684								100.0	Confident
2969	P04844	YIANTVELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25925 (Experiment 1)	25925	50.985	539.799255	2+	2+	1077.5818588893303	0	1.9434827891276754								99.45652173913044	Confident
2970	O60506	GYAFVTFCTK	Phosphorylation of Y(2)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41532 (Experiment 1)	41532	69.96	637.270569	2+	2+	1272.52501143735	0	1.2346647133286448	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.73474801061008	Confident
2971	Q07864	GSTLEEVYGSVAK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31713 (Experiment 1)	31713	57.724	710.330017	2+	2+	1418.6330412328505	0	8.75645274483147	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 95.98603839441536)	Y8	1		0	99.1869918699187	Doubtful
2972	P19338	GFGFVDFNSEEDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44072 (Experiment 1)	44072	74.274	781.34491	2+	2+	1560.6732526445203	0	1.289075046486626								100.0	Confident
2973	P61247	TTDGYLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25807 (Experiment 1)	25807	50.85	469.75116	2+	2+	937.48689587533	0	0.9272907958244769								100.0	Confident
2974	P00558	ALMDEVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29180 (Experiment 1)	29180	54.782	452.743927	2+	2+	903.4735543103104	0	-0.27967670954571905								99.45945945945947	Confident
2975	P52272	AFITNIPFDVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45822 (Experiment 1)	45822	78.385	632.850525	2+	2+	1263.6863239578704	0	0.13676889106360576								100.0	Confident
2976	P21281	DHADVSNQLYACYAIGK	Phosphorylation of Y(10)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33598 (Experiment 1)	33598	59.884	668.955505	3+	3+	2003.8448419875804	0	-0.07792646045559694	Phosphorylation of Y (10: Random)	Phosphorylation of Y (10: 0.0, 13: 0.0)	Phosphorylation of Y (10: 0.0)		0	Y10-{Y10 Y13}	1	100.0	Confident
2977	Q9HB71	SKIETEIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9767 (Experiment 1)	9767	28.154	474.274231	2+	2+	946.5335117145803	0	0.41890528331012855								99.1869918699187	Confident
2978	O00505	IEVLQQHENEDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24889 (Experiment 1)	24889	49.778	613.283875	3+	3+	1836.8295091932705	0	0.15566817133778368	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 96.12277867528272)	Y13	1		0	98.49624060150376	Confident
2979	P22234	EVYELLDSPGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35354 (Experiment 1)	35354	61.932	625.318237	2+	2+	1248.62378327096	0	-1.4890032796887251								99.7289972899729	Confident
2980	P61313	RNPDTQWITKPVHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15721 (Experiment 1)	15721	37.93	430.737396	4+	4+	1718.9216370385004	0	-0.6726284853453187								100.0	Doubtful
2981	P08134, P61586	LVIVGDGACGK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22997 (Experiment 1)	22997	47.443	544.793457	2+	2+	1087.56957995347	0	2.552453566255154								100.0	Confident
2982	P61158	KDYEEIGPSICR	Phosphorylation of Y(3)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23167 (Experiment 1)	23167	47.644	516.227173	3+	3+	1545.6534594076	0	4.022916882052952	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
2983	Q96BF3	GQSIYSTSFPQPAPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31133 (Experiment 1)	31133	57.043	858.394348	2+	2+	1714.77160039433	0	1.481065094153404	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
2984	P23246	YGEPGEVFINK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31366 (Experiment 1)	31366	57.313	626.814026	2+	2+	1251.6135529404303	0	-0.04297451066163006								100.0	Confident
2985	Q14974	LQQVLQMESHIQSTSDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29718 (Experiment 1)	29718	55.4	667.334534	3+	3+	1998.9792881372605	0	1.240989468755219								100.0	Confident
2986	P11021	IINEPTAAAIAYGLDKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38859 (Experiment 1)	38859	66.187	606.006531	3+	3+	1814.9890478919804	0	4.794089899355902								100.0	Doubtful
2987	P49257	DIDNLVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27696 (Experiment 1)	27696	53.051	486.759308	2+	2+	971.5036085686302	0	0.4668610857369597								99.45799457994579	Confident
2988	P35579, P35580	ADFCIIHYAGK	Phosphorylation of Y(8)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34801 (Experiment 1)	34801	61.289	687.799561	2+	2+	1373.5839232958003	0	0.46944699835091835	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
2989	P33993	TAIHEVMEQQTISIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29755 (Experiment 1)	29755	55.445	600.317627	3+	3+	1797.9294844105304	0	0.8702006664975682								99.40828402366864	Confident
2990	P26373	LATQLTGPVMPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35317 (Experiment 1)	35317	61.888	691.893921	2+	2+	1381.7751560456102	0	-1.3491784353141365								92.40837696335078	Confident
2991	P53618	LVTEMGTYATQSALSSSRPTK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31501 (Experiment 1)	31501	57.473	770.030945	3+	3+	2307.08177777765	0	-4.663071410766373	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Doubtful
2992	P62829	ECADLWPR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32515 (Experiment 1)	32515	58.647	523.739746	2+	2+	1045.46511488493	0	-0.16784913314062166								99.45945945945947	Confident
2993	Q99497	GAEEMETVIPVDVMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44873 (Experiment 1)	44873	76.281	838.406067	2+	2+	1674.7956933596602	0	1.1257724121612986								100.0	Confident
2994	Q15393	IVILEYQPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35467 (Experiment 1)	35467	62.061	595.344238	2+	2+	1188.6754249210003	0	-1.2613313728395548								93.76693766937669	Confident
2995	P14649, P60660	ALGQNPTNAEVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22729 (Experiment 1)	22729	47.124	677.869324	2+	2+	1353.7252286477305	0	-0.8361349058866667								99.73190348525469	Confident
2996	P41250	LPFAAAQIGNSFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43008 (Experiment 1)	43008	72.453	696.375305	2+	2+	1390.7357337617802	0	0.2321339286418381								99.45652173913044	Confident
2997	P00403	VVLPIEAPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40838 (Experiment 1)	40838	68.941	553.850769	2+	2+	1105.6859300350502	0	0.9524518061504065								100.0	Confident
2998	P46777	YLMEEDEDAYKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21358 (Experiment 1)	21358	45.234	511.897156	3+	3+	1532.6704757632006	0	-0.5451376123258603								100.0	Confident
2999	Q06830	KQGGLGPMNIPLVSDPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38529 (Experiment 1)	38529	65.786	584.322876	3+	3+	1749.9447405518504	0	1.1740370574549208								97.74436090225565	Confident
3000	P19338	VTLDWAKPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26033 (Experiment 1)	26033	51.112	529.306091	2+	2+	1056.5967806774804	0	0.8014167887526269								93.08510638297872	Confident
3001	P38159, Q96E39	DSYESYGNSR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11957 (Experiment 1)	11957	32.038	629.224915	2+	2+	1256.4346757794704	0	0.4777998919639178	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 12.466168617199592)	Phosphorylation of Y (3: 99.65095986038395)		0	Y6-{Y3 Y6}	1	99.7289972899729	Confident
3002	Q15052	GDIIYVTR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31052 (Experiment 1)	31052	56.947	508.744965	2+	2+	1015.4739618406604	0	1.3909009242549637	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
3003	P61313	GATYGKPVHHGVNQLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7623 (Experiment 1)	7623	23.73	427.23349	4+	4+	1704.9059869743603	0	-0.6628932912907726								100.0	Doubtful
3004	P06748	GPSSVEDIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14157 (Experiment 1)	14157	35.532	466.24057	2+	2+	930.4658260775802	0	0.8160909472855239								100.0	Confident
3005	P05141, P12235, P12236	LLLQVQHASK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19274 (Experiment 1)	19274	42.636	568.843689	2+	2+	1135.6713426000704	0	1.303054130652784								98.91598915989161	Confident
3006	TRYP_PIG	LSSPATLNSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16818 (Experiment 1)	16818	39.354	523.28418	2+	2+	1044.5563724174804	0	-2.451196610168991								100.0	Confident
3007	P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8	YESLTDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16489 (Experiment 1)	16489	38.945	520.251221	2+	2+	1038.4869554449801	0	0.8972801943779778								99.45799457994579	Confident
3008	P28072	LAAIAESGVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20904 (Experiment 1)	20904	44.595	558.306885	2+	2+	1114.5982372294602	0	0.8775082322251635								99.72826086956522	Confident
3009	P15954	NLPFSVENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32285 (Experiment 1)	32285	58.381	524.276489	2+	2+	1046.5396597241802	0	-1.1774859034321072								97.289972899729	Confident
3010	P62937, PPIA_HUMAN	SIYGEKFEDENFILK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40695 (Experiment 1)	40695	68.741	611.307556	3+	3+	1830.9039808553407	0	-1.7134039770349059								100.0	Confident
3011	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10002 (Experiment 1)	10002	28.584	607.758179	2+	2+	1213.5016331404804	0	0.1414427035186971	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3012	P78527	LACDVDQVTR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17994 (Experiment 1)	17994	40.947	588.787109	2+	2+	1175.5604718217503	0	-0.685098917274588								100.0	Confident
3013	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26379 (Experiment 1)	26379	51.511	523.252625	2+	2+	1044.4892775516303	0	1.3564353078984328	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Confident
3014	P31146	DGGLICTSCR		Carbamidomethylation of C(6, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20643 (Experiment 1)	20643	44.293	569.753235	2+	2+	1137.4906780097701	0	1.0873636839112424								99.73045822102425	Confident
3015	P62805	DNIQGITKPAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20823 (Experiment 1)	20823	44.501	442.590149	3+	3+	1324.74629844548	0	1.7466559373458808								100.0	Confident
3016	Q07020	ILTFDQLALDSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45990 (Experiment 1)	45990	78.732	730.905273	2+	2+	1459.7922455783903	0	2.563600052556347								100.0	Confident
3017	P08865	FAAATGATPIAGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21097 (Experiment 1)	21097	44.849	602.328613	2+	2+	1202.6407707477802	0	1.5791393258662285								100.0	Confident
3018	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23041 (Experiment 1)	23041	47.499	449.208374	3+	3+	1344.6002845525904	0	2.232114583418055	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 19.937248578474765)	Phosphorylation of Y (7: 58.63874345549738)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
3019	P00558	AHSSMVGVNLPQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20425 (Experiment 1)	20425	44.037	456.575256	3+	3+	1366.7027193813403	0	0.890119276093805								100.0	Confident
3020	P30101	GFPTIYFSPANK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45508 (Experiment 1)	45508	77.677	711.332214	2+	2+	1420.6428180709106	0	4.960432222909802	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 94.4153577661431)	Y6	1		0	93.6	Doubtful
3021	Q1KMD3	FYGRDYEYNRYRDYYR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35717 (Experiment 1)	35717	62.364	1190.494019	2+	2+	2377.99059470448	1	-8.598500690008997	Phosphorylation of Y (2: Random)	Phosphorylation of Y (11: 0.0, 14: 0.0, 15: 0.0)	Phosphorylation of Y (11: 0.0)		0	Y2-{Y2 Y6 Y8 Y11 Y14 Y15}	1	93.21148825065274	Doubtful
3022	P14317	RSPEAPQPVIAMEEPAVPAPLPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38381 (Experiment 1)	38381	65.608	808.772095	3+	3+	2423.2882666687806	0	2.5507583689416427								100.0	Confident
3023	P62263	DESSPYAAMLAAQDVAQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42623 (Experiment 1)	42623	71.743	668.291443	3+	3+	2001.8503212908406	0	1.0865075473309553	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3024	P78527	GYGLFAGPCK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34271 (Experiment 1)	34271	60.677	535.260254	2+	2+	1068.50625142092	0	-0.2768321203625199								100.0	Confident
3025	P04350, P07437, P68371, Q13509	IMNTFSVVPSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36948 (Experiment 1)	36948	63.867	660.355042	2+	2+	1318.6955087425804	0	0.016902873815744054								100.0	Confident
3026	P62805	KTVTAMDVVYALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41682 (Experiment 1)	41682	70.195	480.271545	3+	3+	1437.7901374034104	0	1.8518697894041187								100.0	Confident
3027	O75608	TLVNPANVTFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34728 (Experiment 1)	34728	61.204	602.340332	2+	2+	1202.6659228664603	0	0.15622392770228138								96.19565217391303	Confident
3028	Q16658	YLAPSGPSGTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21578 (Experiment 1)	21578	45.607	595.824402	2+	2+	1189.6342883850102	0	-0.03131680504061717								96.49595687331536	Confident
3029	P11021	DAGTIAGLNVMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38908 (Experiment 1)	38908	66.243	609.316528	2+	2+	1216.6234064314801	0	-4.023643828506231								100.0	Confident
3030	Q86UX7	ETTLSYYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21151 (Experiment 1)	21151	44.922	502.75061	2+	2+	1003.4862271689904	0	0.4374908447837511								91.08108108108108	Confident
3031	P13693	DLISHDEMFSDIYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43297 (Experiment 1)	43297	72.967	571.59967	3+	3+	1711.7763378140703	0	0.49147795336690386								100.0	Confident
3032	Q969H8	GAEIEYAMAYSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37475 (Experiment 1)	37475	64.498	706.793823	2+	2+	1411.5730838285804	0	0.006535000164531849	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 12.035847649825694)	Phosphorylation of Y (6: 0.32310177705977383)		0	Y6-{Y6 Y10}	1	100.0	Confident
3033	P40429	CEGINISGNFYR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36822 (Experiment 1)	36822	63.714	715.331604	2+	2+	1428.64559842804	0	2.136523011970012								99.72826086956522	Confident
3034	Q9UGN4	EELHYASVVFDSNTNR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35914 (Experiment 1)	35914	62.602	981.429993	2+	2+	1959.8363854788604	1	2.901723879141828	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.55671902268762)	Y5	1		0	98.91598915989161	Confident
3035	P60900	HITIFSPEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26298 (Experiment 1)	26298	51.417	578.808716	2+	2+	1155.60365696307	0	-0.6719803537699409								99.45799457994579	Confident
3036	P23246	FGQGGAGPVGGQGPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16462 (Experiment 1)	16462	38.912	671.336731	2+	2+	1340.65854607024	0	0.27035332439473847								100.0	Confident
3037	Q9Y2W1	ASESSKPWPDATYGTGSASR	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21428 (Experiment 1)	21428	45.336	712.307922	3+	3+	2133.9004422874	0	0.6992824135898638	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 100.0)	Y13	1		0	100.0	Confident
3038	P31948	LDPHNHVLYSNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13562 (Experiment 1)	13562	34.584	515.572693	3+	3+	1543.6932905039803	0	1.9131484172654216	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3039	P01911, P04229, P13760, P20039, Q29974, Q30154, Q30167, Q5Y7A7, Q95IE3	AAVDTYCR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11594 (Experiment 1)	11594	31.448	478.217499	2+	2+	954.4229157197801	0	-2.583183412468472								99.73474801061008	Confident
3040	P10809	VGLQVVAVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28263 (Experiment 1)	28263	53.719	456.797943	2+	2+	911.5804023373505	0	1.0187545587425364								100.0	Confident
3041	P0CG47, P0CG48, P62979, P62987	TITLEVEPSDTIENVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39217 (Experiment 1)	39217	66.642	894.468445	2+	2+	1786.9200248423003	0	1.2925146085230428								100.0	Confident
3042	P04083	GDRSEDFGVNEDLADSDAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28441 (Experiment 1)	28441	53.926	689.965881	3+	3+	2066.87771908934	0	-0.9205711349107631								100.0	Confident
3043	P25205	GGYTSGTFR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15366 (Experiment 1)	15366	37.436	513.208191	2+	2+	1024.4015251763901	0	0.2960690039105962	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	99.20424403183023	Confident
3044	Q5VWZ2	ASAVYQALQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21766 (Experiment 1)	21766	45.905	579.781372	2+	2+	1157.5481894100803	0	0.0014283794401154042	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.50959860383944)	Y5	1		0	98.92183288409704	Confident
3045	P62750	LAPDYDALDVANK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34160 (Experiment 1)	34160	60.546	702.853394	2+	2+	1403.6932598131104	0	-0.7289898550301093								100.0	Confident
3046	Q9Y3U8	YPMAVGLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26858 (Experiment 1)	26858	52.061	496.766022	2+	2+	991.5160878286301	0	1.4123749066392544								100.0	Confident
3047	P25786	LVSLIGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28034 (Experiment 1)	28034	53.441	408.762512	2+	2+	815.5116540711902	0	-1.4470543010142878								95.4054054054054	Confident
3048	Q99873, Q9NR22	EVDIYTVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26581 (Experiment 1)	26581	51.742	483.760193	2+	2+	965.5069626135703	0	-1.1674646775615045								99.73333333333333	Confident
3049	Q07955	DAEDAVYGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13853 (Experiment 1)	13853	35.021	538.209412	2+	2+	1074.40191909921	0	2.1849973750483147	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3050	P52272	FGSGMNMGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20245 (Experiment 1)	20245	43.836	478.707214	2+	2+	955.4004064533901	0	-0.5550226772593403								99.7340425531915	Confident
3051	GSTP1_HUMAN, P09211	FQDGDLTLYQSNTILR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44341 (Experiment 1)	44341	74.998	982.462036	2+	2+	1962.9088221431302	0	0.35468214917748514	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 97.20767888307155)	Y9	1		0	99.1869918699187	Confident
3052	O95168	GLIENPALLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37588 (Experiment 1)	37588	64.638	548.328247	2+	2+	1094.6447934990601	0	-2.601019809387754								93.43832020997375	Confident
3053	P04350, P07437, P68371, Q13509, Q13885, Q9BVA1	EIVHIQAGQCGNQIGAK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20564 (Experiment 1)	20564	44.202	608.313171	3+	3+	1821.91556568189	0	1.1605426463432955								100.0	Confident
3054	P47756	DYLLCDYNR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35833 (Experiment 1)	35833	62.503	616.270264	2+	2+	1230.5339227207403	0	-6.448147493934294								99.45652173913044	Doubtful
3055	P53675, Q00610	IVLDNSVFSEHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32685 (Experiment 1)	32685	58.84	472.581299	3+	3+	1414.7204776204605	0	1.1214866732814623								100.0	Confident
3056	Q8NEY8	SFYSSHYAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16460 (Experiment 1)	16460	38.91	599.240295	2+	2+	1196.4651880621102	0	0.70840101547424	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 7: 0.0)	Phosphorylation of Y (3: 96.16055846422339)		0	Y3-{Y3 Y7}	1	96.24664879356568	Confident
3057	P32119, Q06830	QITVNDLPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32895 (Experiment 1)	32895	59.077	606.342041	2+	2+	1210.66698549562	0	2.097476274791937								100.0	Confident
3058	Q07955	KEDMTYAVR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13890 (Experiment 1)	13890	35.092	596.75708	2+	2+	1191.4995249655003	0	0.06878919738662814	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
3059	P62424	KVVNPLFEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23517 (Experiment 1)	23517	48.082	537.321411	2+	2+	1072.6280808057604	0	0.1751843911165431								100.0	Confident
3060	Q7L2H7	YTVYCSLIK	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35985 (Experiment 1)	35985	62.693	613.78009	2+	2+	1225.5454125287602	0	0.17476752393672626	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 16.666495241286455)	Phosphorylation of Y (4: 99.82547993019197)		0	Y4-{Y1 Y4}	1	99.72826086956522	Confident
3061	O75368	VYIASSSGSTAIK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22054 (Experiment 1)	22054	46.297	682.329163	2+	2+	1362.6432119937303	0	0.4111453141703735	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 87.23747980613894)	Y2	1		0	98.71134020618557	Confident
3062	Q86UX7	LTQLYEQAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20688 (Experiment 1)	20688	44.342	561.302979	2+	2+	1120.5876725457604	0	3.3248826083448235								100.0	Confident
3063	Q9HCC0	AFYGDTLVTGFAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45955 (Experiment 1)	45955	78.674	749.343201	2+	2+	1496.6700954479106	0	1.1701050432233628	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.12739965095986)	Y3	1		0	99.7289972899729	Confident
3064	Q9UBE0	AQNLNPMVDVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28605 (Experiment 1)	28605	54.116	614.822083	2+	2+	1227.6281574587504	0	1.183764692969912								99.45652173913044	Confident
3065	Q9NWQ8	SPSSCNDLYATVK	Phosphorylation of Y(9)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22871 (Experiment 1)	22871	47.29	761.316772	2+	2+	1520.6218249261506	0	-1.8611533363374064	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	99.45799457994579	Confident
3066	P23526	FDNLYGCR	Phosphorylation of Y(5)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23293 (Experiment 1)	23293	47.803	562.71698	2+	2+	1123.4157953415402	0	3.2091944573019915	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
3067	P53041	TECYGYALGDATR	Phosphorylation of Y(4)	Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28216 (Experiment 1)	28216	53.666	778.809448	2+	2+	1555.6014238347402	0	1.8741664692244084	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 6: 0.0)	Phosphorylation of Y (4: 0.6456824222210642)		0	Y4-{Y4 Y6}	1	100.0	Confident
3068	Q02790	GEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38770 (Experiment 1)	38770	66.081	707.012817	3+	3+	2118.0187069452804	0	-0.983171080792197	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 9.229755610067862)	Phosphorylation of Y (7: 24.694589877835956)		0	Y7-{Y7 Y12}	1	100.0	Confident
3069	P49736	IFASIAPSIYGHEDIKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32897 (Experiment 1)	32897	59.08	480.263641	4+	4+	1916.0155969929904	1	3.388620041927087								100.0	Doubtful
3070	P14618	LDIDSPPITAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32283 (Experiment 1)	32283	58.379	599.326538	2+	2+	1196.64010204144	0	-1.3172893940679544								99.73118279569893	Confident
3071	P05388, Q8NHW5	IIQLLDDYPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42070 (Experiment 1)	42070	70.817	609.342896	2+	2+	1216.6703395405602	0	0.7381118951804666								100.0	Confident
3072	P08238, P14625, Q58FF6, Q58FF7, Q58FF8	ELISNASDALDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28261 (Experiment 1)	28261	53.716	638.325989	2+	2+	1274.6354105838202	0	1.5779443177991739								100.0	Confident
3073	P09622	ALLNNSHYYHMAHGK	Phosphorylation of Y(8, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15685 (Experiment 1)	15685	37.881	639.261597	3+	3+	1914.7637688234406	0	-0.42091455755591667	Phosphorylation of Y (8: Very Confident, 9: Very Confident)		Phosphorylation of Y (8: 99.47643979057592, 9: 99.47643979057592)	Y8, Y9	2		0	99.24812030075188	Confident
3074	P09429	KHPDASVNFSEFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23774 (Experiment 1)	23774	48.416	531.595276	3+	3+	1591.7630707084304	0	0.5818283916942686								100.0	Confident
3075	Q9NR09	TAEIVYAATTSLR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43631 (Experiment 1)	43631	73.49	738.357117	2+	2+	1474.7068748794504	0	-4.871476054349768	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 98.86914378029078)	Y6	1		0	99.45652173913044	Doubtful
3076	Q15717	DANLYISGLPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42384 (Experiment 1)	42384	71.316	649.812195	2+	2+	1297.6067669153601	0	2.3623427599817806	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	99.73890339425587	Confident
3077	P47756	STLNEIYFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37231 (Experiment 1)	37231	64.202	586.303467	2+	2+	1170.5920892198603	0	0.2488869710835305								99.73262032085562	Confident
3078	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23203 (Experiment 1)	23203	47.684	673.307434	2+	2+	1344.6002845525904	0	0.022659623565177228	Phosphorylation of Y (7: Random)	Phosphorylation of Y (4: 0.0, 7: 0.0)	Phosphorylation of Y (7: 12.41014657245024)		0	Y9-{Y4 Y7 Y9}	1	95.32467532467533	Confident
3079	P00519	QFDSSTFGGHKSEKPALPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19154 (Experiment 1)	19154	42.491	418.614777	5+	5+	2088.0388516187104	0	-0.6444836518075889								100.0	Doubtful
3080	Q9Y230	TTEMETIYDLGTK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40276 (Experiment 1)	40276	68.142	791.341858	2+	2+	1580.6681064122301	0	0.6676348789658788	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	99.72826086956522	Confident
3081	P20645	HTLADNFNPVSEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29305 (Experiment 1)	29305	54.926	543.593384	3+	3+	1627.7590479571504	0	-0.44479156982175744								100.0	Confident
3082	P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8	YESLTDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16699 (Experiment 1)	16699	39.204	520.251099	2+	2+	1038.4869554449801	0	0.6627778913046249								100.0	Confident
3083	P46940	LQQTYAALNSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17350 (Experiment 1)	17350	40.078	658.816772	2+	2+	1315.6173315990602	0	1.2594316630889386	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3084	P63010	LLSTDPVTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20763 (Experiment 1)	20763	44.431	522.799622	2+	2+	1043.5862755634303	0	-1.5153938398145628								99.1891891891892	Confident
3085	P0C7P4, P47985	VPDFSEYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27651 (Experiment 1)	27651	52.997	546.723938	2+	2+	1091.4324909515003	0	0.7610015319411136	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.33507853403141)	Y7	1		0	96.19565217391303	Confident
3086	P11142	GTLDPVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15519 (Experiment 1)	15519	37.641	429.731812	2+	2+	857.4494477374503	0	-0.43826277071495845								99.7340425531915	Confident
3087	Q70E73, Q7Z5R6	ASGIYYVPK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29156 (Experiment 1)	29156	54.756	539.255005	2+	2+	1076.4943629320703	0	1.014487955925261	Phosphorylation of Y (6: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (6: 1.3979911885671052)		0	Y6-{Y5 Y6}	1	99.7289972899729	Confident
3088	Q9Y5S9	GYTLVEYETYK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36610 (Experiment 1)	36610	63.458	723.317444	2+	2+	1444.6163285395505	0	2.7695570975910218	Phosphorylation of Y (2: Random)	Phosphorylation of Y (7: 0.0, 10: 0.0)	Phosphorylation of Y (10: 0.0)		0	Y2-{Y2 Y7 Y10}	1	96.4769647696477	Doubtful
3089	P56545, Q13363	PLVALLDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41164 (Experiment 1)	41164	69.417	477.293091	2+	2+	952.57056592964	0	1.1137160166072253								97.289972899729	Confident
3090	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29307 (Experiment 1)	29307	54.928	677.841492	2+	2+	1353.6693671719202	0	-0.6905042763926236	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.68411867364746)	Y4	1		0	99.73045822102425	Confident
3091	P63010, Q10567	NVEGQDMLYQSLK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39673 (Experiment 1)	39673	67.283	802.857422	2+	2+	1603.6953242195802	0	3.093240482833723	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	99.7340425531915	Confident
3092	P17844, Q92841	APILIATDVASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34765 (Experiment 1)	34765	61.246	613.859497	2+	2+	1225.7030366511704	0	1.1439236657391982								100.0	Confident
3093	Q9HCC0	KFEEEGNPYYSSAR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17474 (Experiment 1)	17474	40.256	586.244934	3+	3+	1755.7141450878605	0	-0.6666653288475677	Phosphorylation of Y (9: Random)	Phosphorylation of Y (9: 0.0, 10: 0.0)	Phosphorylation of Y (9: 2.2617124394184165)		0	Y9-{Y9 Y10}	1	100.0	Confident
3094	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12965 (Experiment 1)	12965	33.683	600.786865	2+	2+	1199.5587540937802	0	0.35201563922002943	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 90.40139616055846)	Y9	1		0	98.91891891891892	Confident
3095	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21764 (Experiment 1)	21764	45.902	759.859253	2+	2+	1517.7014551458406	0	1.6436758723036196	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 96.33507853403141)	Y11	1		0	99.1869918699187	Confident
3096	P29401	ISSDLDGHPVPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16094 (Experiment 1)	16094	38.464	422.222839	3+	3+	1263.6459156978704	0	0.6093955551127416								99.24812030075188	Confident
3097	P60174	DCGATWVVLGHSER		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34587 (Experiment 1)	34587	61.044	529.5849	3+	3+	1585.7307250343304	0	1.3504716184415986								100.0	Confident
3098	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18216 (Experiment 1)	18216	41.289	506.239624	3+	3+	1515.6953850714303	0	1.0914001091539722								100.0	Confident
3099	P06748	ADKDYHFK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6390 (Experiment 1)	6390	20.855	552.231262	2+	2+	1102.4484753688105	0	-0.4566041792883136	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.68411867364746)	Y5	1		0	99.19137466307278	Confident
3100	P29692	FYEQMNGPVAGASR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27020 (Experiment 1)	27020	52.251	536.229919	3+	3+	1605.6646927976403	0	2.0108342296844177	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
3101	B2RPK0, P09429, P23497	FKDPNAPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7499 (Experiment 1)	7499	23.481	458.748474	2+	2+	915.4814165720702	0	1.066483492436492								99.74811083123426	Confident
3102	P68363, P68366, Q71U36, Q9BQE3	EDMAALEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18382 (Experiment 1)	18382	41.51	453.715729	2+	2+	905.4164333570104	0	0.51982946671446								99.45945945945947	Confident
3103	Q00688	AWTVEQLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34129 (Experiment 1)	34129	60.509	501.769989	2+	2+	1001.5294293936502	0	-3.9901861249510544								98.75311720698254	Confident
3104	P60842, Q14240	GYDVIAQAQSGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24857 (Experiment 1)	24857	49.74	697.84845	2+	2+	1393.6837577585704	0	-1.0107429262188379								100.0	Confident
3105	P62280	NMSVHLSPCFR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29158 (Experiment 1)	29158	54.758	449.881866	3+	3+	1346.62236088566	0	1.043025942766706								100.0	Confident
3106	P27797	AKIDDPTDSKPEDWDKPEHIPDPDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24677 (Experiment 1)	24677	49.534	592.685486	5+	5+	2958.3883105313703	0	0.9236389830860128								100.0	Doubtful
3107	P48643	HKLDVTSVEDYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20761 (Experiment 1)	20761	44.429	505.235229	3+	3+	1512.6861394348705	0	-1.5054584085036116	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3108	P61158	QYTGINAISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21356 (Experiment 1)	21356	45.232	547.795532	2+	2+	1093.5767735088903	0	-0.23954416953316296								99.7289972899729	Confident
3109	P55072	MDELQLFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43299 (Experiment 1)	43299	72.97	526.265869	2+	2+	1050.5168161046201	0	0.3505470397040076								100.0	Confident
3110	P36542	SEVATLTAAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18822 (Experiment 1)	18822	42.076	524.288147	2+	2+	1046.5607890915803	0	0.9078744820182529								100.0	Confident
3111	P62258	QMVETELK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19077 (Experiment 1)	19077	42.385	489.250305	2+	2+	976.4899326504403	0	-3.9607218171068843								92.34828496042216	Confident
3112	P84090	ADTQTYQPYNKDWIK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30125 (Experiment 1)	30125	55.873	650.959595	3+	3+	1949.8560582942803	0	0.45947843917078646	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 9: 0.0)	Phosphorylation of Y (6: 0.17452006980802792)		0	Y6-{Y6 Y9}	1	100.0	Confident
3113	P38919	EQIYDVYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30190 (Experiment 1)	30190	55.951	583.250305	2+	2+	1164.4852548003503	0	0.6877549574471263	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 12.680432057035638)	Phosphorylation of Y (4: 52.87842071249991)		0	Y7-{Y4 Y7}	1	100.0	Confident
3114	O95185, Q8IZJ1	LSDTANYTCVAK	Phosphorylation of Y(7)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31535 (Experiment 1)	31535	57.512	711.801331	2+	2+	1421.5897965218803	0	-1.1853402282015966	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.86914378029078)	Y7	1		0	98.93048128342245	Confident
3115	P07437, Q13509, Q13885, Q9BVA1	AILVDLEPGTMDSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44005 (Experiment 1)	44005	74.141	539.28363	3+	3+	1614.8287077401003	0	0.21810387032644507								98.7012987012987	Confident
3116	Q9UK45	ESILDLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35356 (Experiment 1)	35356	61.935	452.752289	2+	2+	903.4913125494302	0	-1.4218384475841777								96.4769647696477	Confident
3117	P35268	AGNLGGGVVTIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27572 (Experiment 1)	27572	52.898	621.843323	2+	2+	1241.6727991520504	0	-0.5677356718738885								100.0	Confident
3118	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29459 (Experiment 1)	29459	55.102	609.259399	2+	2+	1216.5053215385904	0	-0.8834260622151218	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.33452891645359)	Phosphorylation of Y (8: 0.0)		0	Y8-{Y3 Y6 Y8}	1	100.0	Confident
3119	Q969Q0	DSLYAQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12800 (Experiment 1)	12800	33.438	495.208435	2+	2+	988.4015251763901	0	0.7995528379215701	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.38449111470113)	Y4	1		0	99.74358974358975	Confident
3120	P18085, P61204, P84077, P84085	HYFQNTQGLIFVVDSNDR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44388 (Experiment 1)	44388	75.111	745.007507	3+	3+	2232.0000967590204	0	0.2661452832014823	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	99.25373134328358	Doubtful
3121	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	HQGVMVGMGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13295 (Experiment 1)	13295	34.147	586.289612	2+	2+	1170.56378338038	0	0.757037690666821								100.0	Confident
3122	P23396	DEILPTTPISEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33739 (Experiment 1)	33739	60.045	735.886841	2+	2+	1469.7613393729305	0	-1.5017955968501482								99.73684210526315	Confident
3123	P04083	SEIDMNDIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26067 (Experiment 1)	26067	51.15	532.750549	2+	2+	1063.4855755459903	0	0.90992047735168								96.22641509433963	Confident
3124	O14979, Q14103, Q99729	FGEVVDCTIK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29757 (Experiment 1)	29757	55.448	584.289673	2+	2+	1166.5641602198602	0	0.5415523220446765								100.0	Confident
3125	P60866	LIDLHSPSEIVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31572 (Experiment 1)	31572	57.562	675.885986	2+	2+	1349.7554661468505	0	1.4447128563287783								99.73333333333333	Confident
3126	P54819	APSVPAAEPEYPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22270 (Experiment 1)	22270	46.571	678.346313	2+	2+	1354.6768814729803	0	0.8783083355146374								92.40837696335078	Confident
3127	P04406	QASEGPLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8795 (Experiment 1)	8795	26.207	415.224152	2+	2+	828.4341320264803	0	-0.4587400896239156								99.74554707379136	Confident
3128	P24666	SPIAEAVFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33947 (Experiment 1)	33947	60.288	495.274231	2+	2+	988.5341804209204	0	-0.2739436589046038								99.74811083123426	Confident
3129	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	DLTDYLMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44127 (Experiment 1)	44127	74.4	499.747406	2+	2+	997.4790336135702	0	1.2260737061163844								98.92183288409704	Confident
3130	Q96AE4	QQAAYYAQTSPQGMPQHPPAPQGQ	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25992 (Experiment 1)	25992	51.062	887.724792	3+	3+	2660.1479002748606	0	1.744659625461981	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 6: 0.0)	Phosphorylation of Y (6: 0.0)		0	Y5-{Y5 Y6}	1	100.0	Confident
3131	P61978	NLPLPPPPPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30206 (Experiment 1)	30206	55.97	597.853516	2+	2+	1193.6920780446499	0	0.3353847136333865								99.7289972899729	Confident
3132	P0C7P4, P47985	VPDFSEYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27886 (Experiment 1)	27886	53.271	546.723145	2+	2+	1091.4324909515003	0	-0.6894573711493132	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3133	Q5MCW4	HNLYEYDLFGK	Phosphorylation of Y(4, 6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34604 (Experiment 1)	34604	61.063	780.301758	2+	2+	1557.5942268035103	1	-5.52611337318629	Phosphorylation of Y (4: Very Confident, 6: Very Confident)		Phosphorylation of Y (4: 95.81151832460732, 6: 95.81151832460732)	Y4, Y6	2		0	95.13513513513514	Doubtful
3134	P06733	SCNCLLLK		Carbamidomethylation of C(2, 4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25523 (Experiment 1)	25523	50.524	504.254517	2+	2+	1006.4939724850601	0	0.5042905470739877								100.0	Confident
3135	P13639	RCLYASVLTAQPR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28915 (Experiment 1)	28915	54.479	512.277222	3+	3+	1533.80858143221	0	0.8167246986751229								100.0	Confident
3136	P61224, P62834	LVVLGSGGVGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26730 (Experiment 1)	26730	51.911	493.305176	2+	2+	984.5967806774802	0	-0.9949319155635049								100.0	Confident
3137	P62826	NLQYYDISAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30121 (Experiment 1)	30121	55.869	647.789429	2+	2+	1293.5642333970404	0	0.055318392264353644	Phosphorylation of Y (5: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 8.55148342059337)		0	Y5-{Y4 Y5}	1	99.45652173913044	Confident
3138	A6NNZ2, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1, Q9H4B7	IREEYPDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9728 (Experiment 1)	9728	28.088	539.26947	2+	2+	1076.5250722892001	0	-0.6353246634004968								98.91891891891892	Confident
3139	P50990	LVPGGGATEIELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31450 (Experiment 1)	31450	57.414	677.880127	2+	2+	1353.7503807664104	0	-3.4517045825830057								99.72972972972973	Confident
3140	Q93084	SMSVYCTPTRPHPTGQGSK	Phosphorylation of Y(5)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13299 (Experiment 1)	13299	34.152	724.317505	3+	3+	2169.9336740753206	0	-1.3753046263878865	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
3141	Q7L576	ALNLAYSSIYGSYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42422 (Experiment 1)	42422	71.37	829.38501	2+	2+	1656.7548877010302	0	0.3492741856925842	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 2.118731618668638)	Phosphorylation of Y (13: 0.0)		0	Y10-{Y6 Y10 Y13}	1	100.0	Confident
3142	Q96RP9	EYGCPCITGKPK	Phosphorylation of Y(2)	Carbamidomethylation of C(4, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14313 (Experiment 1)	14313	35.756	745.312317	2+	2+	1488.61423744791	0	-2.788341108765726	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 91.97207678883072)	Y2	1		0	98.91598915989161	Confident
3143	P06744	EWFLQAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40644 (Experiment 1)	40644	68.668	496.763123	2+	2+	991.5127167003504	0	-1.0303028468645676								99.45652173913044	Confident
3144	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36473 (Experiment 1)	36473	63.301	964.385315	2+	2+	1926.7560694694905	0	0.00393871891090448	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 25.214519957742368)	Phosphorylation of Y (10: 0.16155088852988692)		0	Y10-{Y10 Y14}	1	100.0	Confident
3145	P31948	LAYINPDLALEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41619 (Experiment 1)	41619	70.093	744.902161	2+	2+	1487.7871601979505	0	1.7511514467633778								98.93617021276596	Confident
3146	Q02790	VLQLYPNNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27225 (Experiment 1)	27225	52.487	544.809143	2+	2+	1087.6025943339102	0	1.0450757574453953								99.73333333333333	Confident
3147	Q06124	VYENVGLMQQQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27360 (Experiment 1)	27360	52.648	758.848877	2+	2+	1515.6792802326204	0	2.583415488564833	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	99.45799457994579	Confident
3148	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21275 (Experiment 1)	21275	45.116	673.310364	2+	2+	1344.6002845525904	0	4.374312254358037	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.33452891645359)	Phosphorylation of Y (9: 98.70759289176091)		0	Y9-{Y4 Y7 Y9}	1	99.47368421052632	Confident
3149	P17096	KQPPVSPGTALVGSQKEPSEVPTPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22873 (Experiment 1)	22873	47.293	640.601746	4+	4+	2557.375167096881	1	-0.2513472534843654								100.0	Doubtful
3150	P34932	LKKEDIYAVEIVGGATR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33278 (Experiment 1)	33278	59.514	648.006104	3+	3+	1940.9972432247105	0	-0.39126424067738497	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	100.0	Confident
3151	O75431	NYSNLLAFCR	Phosphorylation of Y(2)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43079 (Experiment 1)	43079	72.561	669.289185	2+	2+	1336.5635222043902	0	0.22028000538097164	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
3152	Q86VP6	MLTGPVYSQSTALTHK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27882 (Experiment 1)	27882	53.267	605.290649	3+	3+	1812.8481364628706	0	1.0910124241602819	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.28057553956835	Confident
3153	P02786	VEYHFLSPYVSPK	Phosphorylation of Y(9, 3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36689 (Experiment 1)	36689	63.554	863.370789	2+	2+	1724.7252409730604	0	1.0332149184447368	Phosphorylation of Y (3: Very Confident, 9: Very Confident)		Phosphorylation of Y (3: 94.58987783595113, 9: 94.58987783595113)	Y3, Y9	2		0	99.22879177377892	Confident
3154	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3, Q9H853, Q9NY65	NLDIERPTYTNLNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28834 (Experiment 1)	28834	54.387	600.287964	3+	3+	1797.84107693648	0	0.5473282172028926	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3155	P38159, Q96E39	DRDYSDHPSGGSYR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.41 min, Period: 1, Cycle(s): 7968 (Experiment 1)	7968	24.383	564.552917	3+	3+	1690.6372917494903	0	-0.21855042822700096	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 15.102399024346495)	Phosphorylation of Y (4: 99.03069466882067)		0	Y4-{Y4 Y13}	1	100.0	Confident
3156	P53396	SAYDSTMETMNYAQIR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37790 (Experiment 1)	37790	64.879	980.894897	2+	2+	1959.7743794692603	0	0.4391895077569268	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 14.0602723289365)	Phosphorylation of Y (12: 99.82547993019197)		0	Y12-{Y3 Y12}	1	99.45945945945947	Confident
3157	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20906 (Experiment 1)	20906	44.597	673.308105	2+	2+	1344.6002845525904	0	1.0192326321676604	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 26.491151515825344)	Phosphorylation of Y (4: 0.0)		0	Y4-{Y4 Y7 Y9}	1	100.0	Confident
3158	P35579	VIQYLAYVASSHK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34844 (Experiment 1)	34844	61.34	779.887573	2+	2+	1557.7592448054806	0	0.8643951431358696	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 7: 0.0)	Phosphorylation of Y (4: 1.4539579967689822)		0	Y4-{Y4 Y7}	1	100.0	Confident
3159	P41250	ELSEALTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19888 (Experiment 1)	19888	43.406	459.748535	2+	2+	917.4818104948902	0	0.7684331488667556								99.45652173913044	Confident
3160	Q86VP6	VIRPLDQPSSFDATPYIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37806 (Experiment 1)	37806	64.898	683.033691	3+	3+	2046.0785911723704	0	0.3183968863357332								100.0	Confident
3161	P67936	KIQALQQQADEAEDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17136 (Experiment 1)	17136	39.775	581.629761	3+	3+	1741.8594902744105	0	4.5638205095534525								100.0	Confident
3162	P62273	GHQQLYWSHPR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18708 (Experiment 1)	18708	41.931	496.889282	3+	3+	1487.6459463887402	0	0.047100249272079155	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3163	P08238, Q58FF7	DNSTMGYMMAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29977 (Experiment 1)	29977	55.703	624.754333	2+	2+	1247.4984658121502	0	-3.4835537598555786								100.0	Confident
3164	Q06830	DISLSDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26296 (Experiment 1)	26296	51.415	510.718048	2+	2+	1019.4212575614604	0	0.27951332114050303	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 97.09208400646203)	Y7	1		0	99.73614775725594	Confident
3165	P63104	KGIVDQSQQAYQEAFEISKK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29370 (Experiment 1)	29370	55.001	793.052673	3+	3+	2376.1362558786604	0	-0.027858214585486003	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.03069466882067)	Y11	1		0	99.27007299270073	Confident
3166	P62269	VITIMQNPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26255 (Experiment 1)	26255	51.368	536.30304	2+	2+	1070.59064975122	0	0.8179292376916938								99.73614775725594	Confident
3167	Q10570	VYAVATSTNTPCAR	Phosphorylation of Y(2)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17992 (Experiment 1)	17992	40.944	795.853455	2+	2+	1589.6909075454803	0	0.910671560578584	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3168	O60341	STSQTFIYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23269 (Experiment 1)	23269	47.771	577.76062	2+	2+	1153.5056558917604	0	0.8923899449057638	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 75.2827140549273)	Y8	1		0	92.50645994832041	Confident
3169	A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536	IIPGFMCQGGDFTR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42469 (Experiment 1)	42469	71.443	533.587036	3+	3+	1597.73811891389	0	0.7244594514113429								100.0	Confident
3170	P49736	QLVAEQVTYQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24626 (Experiment 1)	24626	49.473	707.839233	2+	2+	1413.6653444206404	0	-1.0110719712440916	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3171	P11216	HLEIIYAINQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41684 (Experiment 1)	41684	70.197	483.913422	3+	3+	1448.7177143466702	0	0.49750859028148975	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3172	Q02790	KLYANMFER	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30724 (Experiment 1)	30724	56.564	626.284729	2+	2+	1250.5518948915303	0	2.4032057147243417	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.95287958115183)	Y3	1		0	99.45799457994579	Confident
3173	Q96PK6	RLPDAHSDYAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10526 (Experiment 1)	10526	29.644	434.218903	3+	3+	1299.6319969692302	0	2.2128905435885464								100.0	Confident
3174	P27797	QIDNPDYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11138 (Experiment 1)	11138	30.764	536.721497	2+	2+	1071.4274055710603	0	0.9646495624538114	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73890339425587	Confident
3175	P04406	VPTANVSVVDLTCR		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36424 (Experiment 1)	36424	63.246	510.936829	3+	3+	1529.7871772812903	0	0.9657552032319764								99.24812030075188	Confident
3176	P40227	EMDRETLIDVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29908 (Experiment 1)	29908	55.622	483.244965	3+	3+	1446.7136779878604	0	-0.4224138080634427								100.0	Confident
3177	P07910	GFAFVQYVNER	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44001 (Experiment 1)	44001	74.135	705.314575	2+	2+	1408.6176659522303	0	-2.175539317287096	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.03069466882067)	Y7	1		0	99.7289972899729	Confident
3178	Q86UX7	VVLAGGVAPALFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44347 (Experiment 1)	44347	75.013	635.386353	2+	2+	1268.7604919576402	0	-1.8405234457088246								100.0	Confident
3179	P30050	IGPLGLSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30463 (Experiment 1)	30463	56.263	441.276154	2+	2+	880.5382031722002	0	-0.5077382863905501								100.0	Confident
3180	P84095	EVFAEAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23222 (Experiment 1)	23222	47.709	460.746246	2+	2+	919.4763311916302	0	1.7448623460088033								99.45799457994579	Confident
3181	P61158	NIVLSGGSTMFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38744 (Experiment 1)	38744	66.048	641.335938	2+	2+	1280.6547065597601	0	2.0398918867489204								92.7807486631016	Confident
3182	P0DMV8, P11021, P11142, P17066, P34931, P48741, P54652	VEIIANDQGNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17752 (Experiment 1)	17752	40.619	614.817261	2+	2+	1227.6207635791902	0	-0.6461369510452905								100.0	Confident
3183	Q96I51	KVVENEIYSESHR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13962 (Experiment 1)	13962	35.218	557.257324	3+	3+	1668.7508649497504	0	-0.4320863647270654	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3184	P11021	TKPYIQVDIGGGQTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25923 (Experiment 1)	25923	50.983	535.626953	3+	3+	1603.85697109327	0	1.281058841144378								97.76119402985076	Confident
3185	P25685	GKDYYQTLGLAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27963 (Experiment 1)	27963	53.359	732.847168	2+	2+	1463.6809944847803	0	-0.8265143511851014	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 0.0)		0	Y4-{Y4 Y5}	1	100.0	Confident
3186	P10809	GYISPYFINTSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39816 (Experiment 1)	39816	67.479	695.355347	2+	2+	1388.6976169175603	0	-1.061219723455453								100.0	Confident
3187	P36578	IEEVPELPLVVEDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45553 (Experiment 1)	45553	77.783	804.940125	2+	2+	1607.8658044414703	0	-0.06669756175732991								98.6449864498645	Confident
3188	P06748	ADKDYHFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7820 (Experiment 1)	7820	24.1	512.25	2+	2+	1022.4821448480604	0	3.223259111317044								99.73190348525469	Confident
3189	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30948 (Experiment 1)	30948	56.825	528.262573	2+	2+	1054.5100129962104	0	0.5490361360970805	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 95.81151832460732)	Y7	1		0	95.13513513513514	Confident
3190	Q92945	IGGGIDVPVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32768 (Experiment 1)	32768	58.935	540.314087	2+	2+	1078.6134933707801	0	0.11816794511506629								100.0	Confident
3191	Q9GZR7	TSEIYVHR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 12997 (Experiment 1)	12997	33.726	542.745056	2+	2+	1083.4750244698203	0	0.49249349480832566	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.60383944153578)	Y5	1		0	99.45799457994579	Confident
3192	P27635, Q96L21	MLSCAGADR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11393 (Experiment 1)	11393	31.158	490.717957	2+	2+	979.42153582079	0	-0.17805990215341602								100.0	Confident
3193	P08238, Q58FF8	SIYYITGESK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30985 (Experiment 1)	30985	56.867	620.778809	2+	2+	1239.5424353233002	0	0.5072204350361477	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.17452006980802792)		0	Y3-{Y3 Y4}	1	100.0	Confident
3194	P33316	LSEHATAPTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7154 (Experiment 1)	7154	22.704	541.782349	2+	2+	1081.5516213902101	0	-1.362467627128385								92.63157894736842	Confident
3195	P29401	TSRPENAIIYNNNEDFQVGQAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32041 (Experiment 1)	32041	58.104	863.397095	3+	3+	2587.17040954125	0	-0.3682899175561392	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3196	P00390	LNAIYQNNLTK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25189 (Experiment 1)	25189	50.129	686.337585	2+	2+	1370.6595307642103	0	0.7913766118303291	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
3197	P40429, Q6NVV1	MVVPAALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27841 (Experiment 1)	27841	53.22	414.753754	2+	2+	827.4938958320702	0	-1.1341243063331499								100.0	Confident
3198	Q02878	AVDSQILPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23122 (Experiment 1)	23122	47.592	485.780884	2+	2+	969.5494961318902	0	-2.3478282428417043								99.45799457994579	Confident
3199	Q96ST3	FQGQPDIYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22019 (Experiment 1)	22019	46.256	588.261719	2+	2+	1174.5059902449302	0	2.460493751990676	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 96.50959860383944)	Y8	1		0	96.22641509433963	Confident
3200	P27348, P31946, P63104	EMQPTHPIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9722 (Experiment 1)	9722	28.078	554.784973	2+	2+	1107.54951321523	0	5.2992443836973715								98.92761394101876	Doubtful
3201	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21715 (Experiment 1)	21715	45.833	449.20755	3+	3+	1344.6002845525904	0	0.3977724675509548	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 7.577302748266)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
3202	P63104	VVSSIEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9362 (Experiment 1)	9362	27.408	445.253387	2+	2+	888.4916469026002	0	0.6447611211632298								99.7289972899729	Confident
3203	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16490 (Experiment 1)	16490	38.946	514.76355	2+	2+	1027.5120650773501	0	0.4681656766297929								100.0	Confident
3204	O15511	ALAAGGVGSIVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28161 (Experiment 1)	28161	53.596	535.818604	2+	2+	1069.6243924076502	0	-1.621200201658805								100.0	Confident
3205	O94905	VAQVAEITYGQK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23436 (Experiment 1)	23436	47.98	693.837952	2+	2+	1385.6591964110405	0	1.5527103083896205	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3206	Q7L5N7	AVQPVLVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20645 (Experiment 1)	20645	44.295	484.799072	2+	2+	967.5814649665101	0	2.1927687684018284								100.0	Confident
3207	P62826	VCENIPIVLCGNK		Carbamidomethylation of C(2, 10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37066 (Experiment 1)	37066	64.009	758.38678	2+	2+	1514.7585200053002	0	0.3211166419441482								99.74424552429667	Confident
3208	O75083	AHDGGIYAISWSPDSTHLLSASGDK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42206 (Experiment 1)	42206	71.047	889.070435	3+	3+	2664.1857252522204	0	1.4060950512563803	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3209	Q01469	FEETTADGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10269 (Experiment 1)	10269	29.141	513.230896	2+	2+	1024.4461532621601	0	1.0578137177942084								94.32432432432432	Confident
3210	P06744	VFEGNRPTNSIVFTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26893 (Experiment 1)	26893	52.101	570.305725	3+	3+	1707.8944192311503	0	0.5414457982369396								100.0	Confident
3211	O75964	TPALVNAAVTYSKPR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28785 (Experiment 1)	28785	54.332	556.624084	3+	3+	1666.8443714117707	0	3.6237560772849315	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3212	P0DMV8, P11142, P17066, P34931, P48741, P54652	TTPSYVAFTDTER	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30946 (Experiment 1)	30946	56.822	784.336304	2+	2+	1566.6603186098505	0	-1.4429653433079364	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3213	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	DLTDYLMK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46330 (Experiment 1)	46330	79.312	539.730408	2+	2+	1077.4453641343202	0	0.8327609403742857	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.73045822102425	Confident
3214	Q9NX40	GILSSHPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.46 min, Period: 1, Cycle(s): 9360 (Experiment 1)	9360	27.405	419.742493	2+	2+	837.4708518883701	0	-0.49890324667662983								96.2059620596206	Confident
3215	P22695	YEDFSNLGTTHLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37875 (Experiment 1)	37875	64.979	555.946228	3+	3+	1664.8158345572804	0	0.6115956641679084								100.0	Confident
3216	P78527	LLALNSLYSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42204 (Experiment 1)	42204	71.044	609.85791	2+	2+	1217.7019740220103	0	-0.5796065060345678								100.0	Confident
3217	GSTP1_HUMAN, P09211	ALPGQLKPFETLLSQNQGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44537 (Experiment 1)	44537	75.504	709.392273	3+	3+	2125.15315309496	0	0.8629481217705463								100.0	Confident
3218	ALDOA_RABIT, P04075	ADDGRPFPQVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26736 (Experiment 1)	26736	51.918	448.241791	3+	3+	1341.7040992803304	0	-0.41322975530980505								100.0	Confident
3219	Q8WXF1	YGEPSEVFINR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32477 (Experiment 1)	32477	58.603	655.822754	2+	2+	1309.6302656337302	0	0.5256244952340963								100.0	Confident
3220	O14979	DLTEYLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39288 (Experiment 1)	39288	66.747	498.752808	2+	2+	995.4923751785902	0	-1.3153915798921219								99.72972972972973	Confident
3221	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	LLLPGELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37755 (Experiment 1)	37755	64.838	477.304932	2+	2+	952.5957180483204	0	-0.4263330875681895								99.7289972899729	Confident
3222	Q9BZZ5	SLQTVSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9840 (Experiment 1)	9840	28.269	424.235291	2+	2+	846.45593010022	0	0.1166406587699839								99.7289972899729	Confident
3223	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44260 (Experiment 1)	44260	74.745	624.291748	3+	3+	1869.85097291384	0	1.3037114538417127	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
3224	ALDOA_RABIT, P04075	GILAADESTGSIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26031 (Experiment 1)	26031	51.108	666.854126	2+	2+	1331.6932598131104	0	0.3293474486050809								100.0	Confident
3225	Q8IZQ5	NAAALSQALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23558 (Experiment 1)	23558	48.138	507.788483	2+	2+	1013.5617921510902	0	0.611392032540963								99.48717948717949	Confident
3226	P12268	LVGIISSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25998 (Experiment 1)	25998	51.068	422.765503	2+	2+	843.5178020807903	0	-1.5954616120024068								99.46666666666667	Confident
3227	P07900, Q58FG0	HIYYITGETK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22278 (Experiment 1)	22278	46.58	652.801758	2+	2+	1303.5849688416204	0	3.0593031697477344	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y4}	1	99.45652173913044	Confident
3228	P04075	PYQYPALTPEQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28781 (Experiment 1)	28781	54.326	717.866272	2+	2+	1433.7190806381304	0	-0.7588954727685193								99.74811083123426	Confident
3229	Q96S55	SIEVYSAYNNVK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30196 (Experiment 1)	30196	55.959	733.83374	2+	2+	1465.6490256501602	0	2.6582496647526557	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 11.577561945624158)	Phosphorylation of Y (5: 99.82547993019197)		0	Y5-{Y5 Y8}	1	99.72826086956522	Confident
3230	P11021	KKELEEIVQPIISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30518 (Experiment 1)	30518	56.327	551.998413	3+	3+	1652.9712725695204	0	1.290482455028896								96.35036496350365	Confident
3231	P0DMV8, P34931	NALESYAFNMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39592 (Experiment 1)	39592	67.169	644.306335	2+	2+	1286.5965229773003	0	1.2370598897714264								100.0	Confident
3232	P19338	ALELTGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32165 (Experiment 1)	32165	58.243	422.760162	2+	2+	843.5065686907501	0	-0.9433523937595516								99.72972972972973	Confident
3233	HBA_HUMAN, P02008, P69905	LRVDPVNFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25996 (Experiment 1)	25996	51.066	544.317688	2+	2+	1086.6185787512202	0	2.0615899794894874								95.67567567567568	Confident
3234	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1	NMMAACDPR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15766 (Experiment 1)	15766	38.001	533.218018	2+	2+	1064.4201559218	0	1.2444686626687462								100.0	Confident
3235	P18077	DETEFYLGKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27845 (Experiment 1)	27845	53.224	419.874878	3+	3+	1256.6037165327202	0	-0.7239716271956694								99.42857142857143	Confident
3236	Q9UHX1	GYGFIEYEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34516 (Experiment 1)	34516	60.962	553.264526	2+	2+	1104.5127762700004	0	1.5569397430323708								99.72826086956522	Confident
3237	Q16658	KVTGTLDANR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7828 (Experiment 1)	7828	24.12	537.799255	2+	2+	1073.5829215184904	0	0.9627652631382592								95.22546419098144	Confident
3238	P07900, P08238, Q14568, Q58FF8	ADLINNLGTIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39608 (Experiment 1)	39608	67.2	621.856567	2+	2+	1241.6979512707305	0	0.5063836242540678								100.0	Confident
3239	Q9BUJ2	NYILDQTNVYGSAQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33398 (Experiment 1)	33398	59.653	911.414185	2+	2+	1820.8094424550304	0	2.3999087989023273	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 39.194839587790256)	Phosphorylation of Y (10: 100.0)		0	Y10-{Y2 Y10}	1	100.0	Confident
3240	O15143	ASSEGGTAAGAGLDSLHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18133 (Experiment 1)	18133	41.178	543.599304	3+	3+	1627.7801773245503	0	-2.5108658007193556								99.28057553956835	Confident
3241	Q15393	LTISSPLEAHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26589 (Experiment 1)	26589	51.751	399.227295	3+	3+	1194.6608374860205	0	-0.652832739456334								99.28057553956835	Confident
3242	P62805	TVTAMDVVYALKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 42928 (Experiment 1)	42928	72.318	489.606354	3+	3+	1465.7962854130105	0	0.6448630663618967								100.0	Confident
3243	P45880	LTFDTTFSPNTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37549 (Experiment 1)	37549	64.591	714.853943	2+	2+	1427.6932598131104	0	0.05123652866289748								100.0	Confident
3244	Q86UE4	KREEAAAVPAAAPDDLALLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33239 (Experiment 1)	33239	59.469	513.039429	4+	4+	2048.1266039939505	0	0.9775763075357908								100.0	Doubtful
3245	P39687	ELVLDNSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20372 (Experiment 1)	20372	43.978	473.255432	2+	2+	944.4927095317603	0	3.805078691511892								99.7340425531915	Confident
3246	P16885	MYVDPSEINPSMPQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37751 (Experiment 1)	37751	64.834	922.387207	2+	2+	1842.7681718900103	0	-4.505041988220457	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Doubtful
3247	P49411	LLDAVDTYIPVPAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44796 (Experiment 1)	44796	76.106	771.930115	2+	2+	1541.8453437804103	0	0.215878374885118								100.0	Confident
3248	P35613	FFVSSSQGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20979 (Experiment 1)	20979	44.696	507.754211	2+	2+	1013.4930438849301	0	0.8125802786317027								96.7654986522911	Confident
3249	Q10713	DTTMYAVSADSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20521 (Experiment 1)	20521	44.153	684.773743	2+	2+	1367.5316129394205	0	0.9639156300108629	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3250	P21281	KDHADVSNQLYACYAIGK	Phosphorylation of Y(11)	Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27694 (Experiment 1)	27694	53.049	711.654602	3+	3+	2131.93980500158	0	1.0171601908097334	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 13.739487640234529)	Phosphorylation of Y (11: 36.12565445026178)		0	Y11-{Y11 Y14}	1	100.0	Confident
3251	P06733	IGAEVYHNLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18135 (Experiment 1)	18135	41.18	408.531708	3+	3+	1222.5747385110903	0	-1.1781295446276745	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.38219895287958)	Y6	1		0	92.14285714285715	Doubtful
3252	P26641	EYFSWEGAFQHVGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46124 (Experiment 1)	46124	78.962	588.91864	3+	3+	1763.7344866096205	0	-0.2241452615423477	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
3253	Q9UFN0	LVGVFHTEYGALNR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 34983 (Experiment 1)	34983	61.505	552.603638	3+	3+	1654.7868565356503	0	1.3439813247399972	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 91.59935379644588)	Y9	1		0	97.79411764705883	Confident
3254	Q8TA94	KRYECKECGKTFSSRR	Phosphorylation of Y(3)	Carbamidomethylation of C(5, 8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 38968 (Experiment 1)	38968	66.317	1087.002075	2+	2+	2170.9765419468104	1	4.46402278797709	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.38219895287958)	Y3	1		0	97.289972899729	Doubtful
3255	P05141	DFLAGGVAAAISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43552 (Experiment 1)	43552	73.343	610.337158	2+	2+	1218.6608374860205	0	-0.8801845707243323								100.0	Confident
3256	P00338, P07195, P07864, Q6ZMR3	VIGSGCNLDSAR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17407 (Experiment 1)	17407	40.163	624.803711	2+	2+	1247.5928345791901	0	0.027598416992770738								100.0	Confident
3257	Q8NC51	EETQPPVALKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13034 (Experiment 1)	13034	33.777	413.902649	3+	3+	1238.6870522338604	0	-0.7527000170334832								100.0	Confident
3258	O14744	YSQYQQAIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21548 (Experiment 1)	21548	45.552	686.302185	2+	2+	1370.5907824980504	0	-0.7033570755096783	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 22.008726686274073)	Phosphorylation of Y (9: 98.95287958115183)		0	Y9-{Y1 Y4 Y9}	1	98.91304347826086	Confident
3259	P49411	AEAGDNLGALVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31311 (Experiment 1)	31311	57.251	593.316895	2+	2+	1184.6149499227602	0	3.6128746213237606								100.0	Confident
3260	P07900, Q58FG0	HIYYITGETK	Phosphorylation of Y(3, 4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21123 (Experiment 1)	21123	44.886	692.783081	2+	2+	1383.5512993623704	0	0.22352167889939747	Phosphorylation of Y (3: Very Confident, 4: Very Confident)		Phosphorylation of Y (3: 99.83844911147011, 4: 99.83844911147011)	Y3, Y4	2		0	100.0	Confident
3261	Q9Y624	KVIYSQPSAR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9129 (Experiment 1)	9129	26.904	614.808472	2+	2+	1227.6012876121004	0	0.897397576724566	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 97.73123909249564)	Y4	1		0	99.72826086956522	Confident
3262	P55854, P61956, Q6EEV6	VAGQDGSVVQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23927 (Experiment 1)	23927	48.623	617.825256	2+	2+	1233.6353510141705	0	0.4920910067950028								100.0	Confident
3263	Q16891	VVSQYHELVVQAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23176 (Experiment 1)	23176	47.655	804.399658	2+	2+	1606.7868565356505	0	-1.30126021907947	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.72826086956522	Confident
3264	P83731	VELCSFSGYK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32476 (Experiment 1)	32476	58.602	595.281982	2+	2+	1188.5485101557201	0	0.7567097313900182								100.0	Confident
3265	P26639	IYGISFPDPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42494 (Experiment 1)	42494	71.483	568.804688	2+	2+	1135.59136094387	0	3.0433408121793466								96.22641509433963	Confident
3266	Q9NYU1, Q9NYU2	NYLSPTFK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30356 (Experiment 1)	30356	56.142	525.238464	2+	2+	1048.4630628037903	0	-0.6546902133910405	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47643979057592)	Y2	1		0	99.75247524752476	Confident
3267	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32557 (Experiment 1)	32557	58.695	630.797241	2+	2+	1259.5798834611805	0	0.03614885573903541	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3268	P31948	TLLSDPTYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29171 (Experiment 1)	29171	54.773	573.264526	2+	2+	1144.5165549286303	0	-1.7931151106495922	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 94.4153577661431)	Y8	1		0	93.6	Confident
3269	Q9UL46	DEAAYGELR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18910 (Experiment 1)	18910	42.182	552.223999	2+	2+	1102.43321922749	0	0.20448127249302475	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.86914378029078)	Y5	1		0	99.72826086956522	Confident
3270	P52272	GNFGGSFAGSFGGAGGHAPGVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33064 (Experiment 1)	33064	59.268	678.98877	3+	3+	2033.9456199402102	0	-0.55933178821597								100.0	Confident
3271	Q96PK6	LSESQLSFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29501 (Experiment 1)	29501	55.151	533.779602	2+	2+	1065.5454733806102	0	-0.7702744709562164								100.0	Confident
3272	P00519	QFDSSTFGGHKSEKPALPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19128 (Experiment 1)	19128	42.457	523.017029	4+	4+	2088.0388516187104	0	0.07576906890833976								100.0	Doubtful
3273	P13796	EGESLEDLMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40002 (Experiment 1)	40002	67.739	575.768433	2+	2+	1149.5223549775303	0	-0.036395841289881666								100.0	Confident
3274	O94903	DLPAIQPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25872 (Experiment 1)	25872	50.925	455.26123	2+	2+	908.5079656730802	0	-0.06436601281533902								93.76693766937669	Confident
3275	P35579	KMEDSVGCLETAEEVKR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22810 (Experiment 1)	22810	47.22	660.982605	3+	3+	1979.9292267103506	0	-1.6344885449190156								96.75324675324676	Confident
3276	P14866	IEYAKPTR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7930 (Experiment 1)	7930	24.299	529.257813	2+	2+	1056.5005109416702	0	0.531050265556102	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3277	Q8TDN6	IFQGSFGGPTLYENPHYQSPNMHR	Phosphorylation of Y(17)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35430 (Experiment 1)	35430	62.019	715.069763	4+	4+	2856.2479486693005	0	0.6983461437393608	Phosphorylation of Y (17: Random)	Phosphorylation of Y (12: 0.0, 17: 0.0)	Phosphorylation of Y (17: 0.012969181278141003)		0	Y17-{Y12 Y17}	1	100.0	Doubtful
3278	P26447	ELPSFLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38769 (Experiment 1)	38769	66.08	445.752258	2+	2+	889.4909186266102	0	-1.071850105965497								98.92761394101876	Confident
3279	Q14240	DQIYEIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43092 (Experiment 1)	43092	72.587	632.28717	2+	2+	1262.5584197406104	0	1.081254933430066	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
3280	P68104, Q05639, Q5VTE0	LPLQDVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30437 (Experiment 1)	30437	56.233	488.279297	2+	2+	974.5436824754604	0	0.36719870116347647								100.0	Confident
3281	P09651, P51991, Q32P51	WGTLTDCVVMR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39761 (Experiment 1)	39761	67.411	669.320862	2+	2+	1336.6267775597603	0	0.29395970875355515								99.72826086956522	Confident
3282	P22234	VVVLMGSTSDLGHCEK		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28583 (Experiment 1)	28583	54.09	577.952637	3+	3+	1730.8331414975403	0	1.6957023931681612								100.0	Confident
3283	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40420 (Experiment 1)	40420	68.356	895.950073	2+	2+	1789.88464239309	0	0.5305394903474498								92.40837696335078	Confident
3284	P08238, Q58FF7	IDIIPNPQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33145 (Experiment 1)	33145	59.363	597.827148	2+	2+	1193.6404363946103	0	-0.5798731580057984								100.0	Confident
3285	P55060	VIVPNMEFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38334 (Experiment 1)	38334	65.552	552.797913	2+	2+	1103.5797507143502	0	1.3769535720365451								100.0	Confident
3286	Q15233	VELDNMPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32860 (Experiment 1)	32860	59.039	543.783752	2+	2+	1085.55392988933	0	-0.9000104080787374								99.45799457994579	Confident
3287	P49458	VTDDLVCLVYK		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43503 (Experiment 1)	43503	73.265	662.843689	2+	2+	1323.6744389448304	0	-1.2173884405398079								99.18478260869566	Confident
3288	P62995	RPHTPTPGIYMGRPTYGSSR	Phosphorylation of Y(10, 16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20434 (Experiment 1)	20434	44.054	797.688843	3+	3+	2390.03921538055	0	2.291717140192494	Phosphorylation of Y (10: Very Confident, 16: Very Confident)		Phosphorylation of Y (10: 100.0, 16: 100.0)	Y10, Y16	2		0	100.0	Confident
3289	P19338	SISLYYTGEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31261 (Experiment 1)	31261	57.189	580.7948	2+	2+	1159.5761048025502	0	-0.9105928730094743								100.0	Confident
3290	O43776	YGTCPHGGYGLGLER		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24771 (Experiment 1)	24771	49.642	546.256531	3+	3+	1635.74637509847	0	0.8472833986189915								99.28057553956835	Confident
3291	Q9UGN4	EELHYASVVFDSNTNR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35875 (Experiment 1)	35875	62.555	980.924377	2+	2+	1959.8363854788604	0	-1.1134446769981647	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.30191972076788)	Y5	1		0	99.7289972899729	Confident
3292	P46781	KQVVNIPSFIVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39289 (Experiment 1)	39289	66.749	467.285645	3+	3+	1398.8347195270603	0	0.27540086324172314								98.49624060150376	Confident
3293	P41240, P42685	WTAPEALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29185 (Experiment 1)	29185	54.788	472.253998	2+	2+	942.4923156089401	0	1.1936995628005425								93.21148825065274	Confident
3294	Q13310	FSPAGPVLSIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37813 (Experiment 1)	37813	64.908	572.331787	2+	2+	1142.6447934990601	0	3.6932973367258852								99.46949602122017	Confident
3295	GSTP1_HUMAN, P09211	PPYTVVYFPVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46385 (Experiment 1)	46385	79.393	709.350342	2+	2+	1416.6842889600703	0	1.2984477403562993	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 30.544134551967666)	Phosphorylation of Y (7: 100.0)		0	Y7-{Y3 Y7}	1	100.0	Confident
3296	Q96IX5	AGPESDAQYQFTGIKK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25615 (Experiment 1)	25615	50.629	607.280334	3+	3+	1818.8189445095704	0	0.1251975457812369	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3297	Q15126	EAYGAVTQTVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17672 (Experiment 1)	17672	40.523	637.791748	3+	2+	1273.5703814066403	0	-1.1275927033657056	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.86914378029078)	Y3	1		0	98.93048128342245	Confident
3298	P46013	NIYAFMGTPVQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40866 (Experiment 1)	40866	68.98	724.835083	2+	2+	1447.6570882360604	0	-1.0175888405072893	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3299	P22626	NMGGPYGGGNYGPGGSGGSGGYGGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22575 (Experiment 1)	22575	46.942	757.295959	3+	3+	2268.8644082151895	0	0.7215961553565376	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 2.345442983988523)	Phosphorylation of Y (11: 0.0)		0	Y6-{Y6 Y11 Y22}	1	97.79411764705883	Confident
3300	P51659	IIMTSSASGIYGNFGQANYSAAK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40340 (Experiment 1)	40340	68.249	811.039124	3+	3+	2430.092676814521	0	1.1778258012379161	Phosphorylation of Y (11: Random)	Phosphorylation of Y (11: 0.0, 19: 0.0)	Phosphorylation of Y (11: 77.55464430857101)		0	Y11-{Y11 Y19}	1	100.0	Confident
3301	P55072	KGDIFLVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26972 (Experiment 1)	26972	52.194	474.287537	2+	2+	946.5600012459402	0	0.548001665875594								99.73333333333333	Confident
3302	P22234	TKEVYELLDSPGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31941 (Experiment 1)	31941	57.99	779.87561	2+	2+	1557.73275527412	0	2.5079653834080586	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.72826086956522	Confident
3303	P27797	KIKDPDASKPEDWDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14592 (Experiment 1)	14592	36.179	482.988434	4+	4+	1927.9275698342303	0	-1.5216187378457586								100.0	Doubtful
3304	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26622 (Experiment 1)	26622	51.788	523.251343	2+	2+	1044.4892775516303	0	-1.0936273915415506	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.65095986038395)	Y7	1		0	99.73333333333333	Confident
3305	P39019	IAGQVAAANK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7863 (Experiment 1)	7863	24.171	471.772339	2+	2+	941.5294293936502	0	0.7372976129642235								100.0	Confident
3306	Q9BXS5, Q9Y6Q5	SGYQALPWVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43786 (Experiment 1)	43786	73.744	628.794556	2+	2+	1255.5750728642602	0	-0.40855766768686735	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3307	B2RXH8, B7ZW38, O60812, P07910	VDSLLENLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40785 (Experiment 1)	40785	68.873	580.314636	2+	2+	1158.6132185872605	0	1.2928168290571307								99.1891891891892	Confident
3308	P26641	VLSAPPHFHFGQTNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26319 (Experiment 1)	26319	51.442	427.722931	4+	4+	1706.8641221623802	0	-0.879090292475121								100.0	Doubtful
3309	P0DMV8	FGDPVVQSDMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26210 (Experiment 1)	26210	51.316	611.79248	2+	2+	1221.5699738762903	0	0.3540336412956268								100.0	Confident
3310	P29401	SVPTSTVFYPSDGVATEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34843 (Experiment 1)	34843	61.339	942.96698	2+	2+	1883.9152738150308	0	2.19162520604688								99.45799457994579	Confident
3311	Q92540	AVPALGKSPPHHSGFQQYQQADASK	Phosphorylation of Y(18)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20103 (Experiment 1)	20103	43.674	683.077271	4+	4+	2728.2758776693004	0	1.5007341698785936	Phosphorylation of Y (18: Very Confident)	Phosphorylation of Y (18: 100.0)	Phosphorylation of Y (18: 99.82547993019197)	Y18	1		0	100.0	Doubtful
3312	Q04446	KGNNESYHYAR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.32 min, Period: 1, Cycle(s): 5575 (Experiment 1)	5575	19.226	473.532715	3+	3+	1417.5775920454003	0	-0.8985262255689255	Phosphorylation of Y (9: Random)	Phosphorylation of Y (7: 0.0, 9: 0.0)	Phosphorylation of Y (9: 87.06324216795421)		0	Y9-{Y7 Y9}	1	99.28057553956835	Confident
3313	Q07955	KEDMTYAVRK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.56 min, Period: 1, Cycle(s): 13065 (Experiment 1)	13065	33.823	660.802368	2+	2+	1319.5944879795004	0	-3.2573272361758083	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 97.90575916230367)	Y6	1		0	99.22680412371135	Confident
3314	P14625	GVVDSDDLPLNVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36882 (Experiment 1)	36882	63.788	743.380554	2+	2+	1484.7470862911202	0	-0.35730323573625733								96.24664879356568	Confident
3315	P16989, P67809, Q9Y2T7	SVGDGETVEFDVVEGEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38268 (Experiment 1)	38268	65.461	898.418091	2+	2+	1794.8159536965807	0	3.1585448790284913								99.7340425531915	Confident
3316	Q8NC51	SKSEEAHAEDSVMDHHFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15546 (Experiment 1)	15546	37.675	528.735718	4+	4+	2110.912665129421	0	0.5205832831702668								100.0	Doubtful
3317	P13796, P13797	YAFVNWINK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43867 (Experiment 1)	43867	73.904	577.802612	2+	2+	1153.5920296502102	0	-1.1756456348486097								99.73890339425587	Confident
3318	P17174	HIYLLPSGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31617 (Experiment 1)	31617	57.615	568.286804	2+	2+	1134.55869452413	0	0.3172186628098521	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	99.1891891891892	Confident
3319	P62158	VFDKDGNGYISAAELR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31342 (Experiment 1)	31342	57.287	612.282959	3+	3+	1833.8298435464403	0	-1.5221408006727608	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 97.38219895287958)	Y9	1		0	96.99248120300751	Confident
3320	P02786	GFVEPDHYVVVGAQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33505 (Experiment 1)	33505	59.778	584.944397	3+	3+	1751.8032348757806	0	4.631073460631622	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3321	Q8WUM4	HCIMQANAEYHQSILAK	Phosphorylation of Y(10)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22494 (Experiment 1)	22494	46.847	698.648804	3+	3+	2092.9223811156303	0	1.0503542616669168	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.03069466882067)	Y10	1		0	100.0	Confident
3322	P23526	VAVVAGYGDVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21488 (Experiment 1)	21488	45.443	607.792969	2+	2+	1213.5744041579203	0	-2.4836450898052194	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.86914378029078)	Y7	1		0	99.46091644204851	Confident
3323	Q14151, Q15424	ADSLLAVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35546 (Experiment 1)	35546	62.151	458.279419	2+	2+	914.5436824754604	0	0.6574496768880596								97.58713136729223	Confident
3324	P50402	DSAYQSITHYRPVSASR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24528 (Experiment 1)	24528	49.361	673.308777	3+	3+	2016.9054680981903	0	-0.4784818877010529	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 0.9985174595713977)	Phosphorylation of Y (4: 85.77661431064573)		0	Y4-{Y4 Y10}	1	100.0	Confident
3325	P08865	YVDIAIPCNNK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31011 (Experiment 1)	31011	56.898	653.826477	2+	2+	1305.6387221424502	0	-0.24553609168580096								99.73333333333333	Confident
3326	O60506	VTEGLTDVILYHQPDDKKK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31511 (Experiment 1)	31511	57.485	570.538391	4+	4+	2278.1246285658003	0	-0.07468079203121558	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.47643979057592)	Y11	1		0	100.0	Doubtful
3327	Q9UPN3	AENMYAQIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20010 (Experiment 1)	20010	43.559	574.245972	2+	2+	1146.4780612449304	0	-0.5835288325997011	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.38219895287958)	Y5	1		0	99.45799457994579	Confident
3328	Q8TD57	KTMQIGESLPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38754 (Experiment 1)	38754	66.059	616.33429	2+	2+	1230.6642086143002	0	-8.259692826613291								96.4769647696477	Doubtful
3329	A6NHL2, P68363, P68366, Q71U36, Q9BQE3	YMACCLLYR		Carbamidomethylation of C(4, 5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36564 (Experiment 1)	36564	63.407	625.279358	2+	2+	1248.54535643492	0	-0.9542673927064376								100.0	Confident
3330	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32558 (Experiment 1)	32558	58.698	932.894592	2+	2+	1863.7750310922602	0	-0.21440032025638553	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 0.34904013961605584)		0	Y6-{Y6 Y11}	1	100.0	Confident
3331	Q15181	GISCMNTTLSESPFK		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39039 (Experiment 1)	39039	66.404	836.388733	2+	2+	1670.7643932313804	0	-0.8848539180363733								99.75247524752476	Confident
3332	P46779	NCSSFLIK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28429 (Experiment 1)	28429	53.912	484.748047	2+	2+	967.4797023199101	0	1.896603776674565								92.40837696335078	Confident
3333	P07339	VGFAEAAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17267 (Experiment 1)	17267	39.969	410.719391	2+	2+	819.4239016959502	0	0.3985331146217005								100.0	Confident
3334	P14314	ESLQQMAEVTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31889 (Experiment 1)	31889	57.931	646.31842	2+	2+	1290.6238003543003	0	-1.1706970636698193								100.0	Confident
3335	Q14974	VLANPGNSQVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13301 (Experiment 1)	13301	34.156	613.335815	2+	2+	1224.65748344108	0	-0.33128227606723526								99.72972972972973	Confident
3336	P19623	VLIIGGGDGGVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39457 (Experiment 1)	39457	66.987	613.366699	2+	2+	1224.71902106848	0	-0.14347215064163615								99.46666666666667	Confident
3337	P07900, P08238, Q58FF7, Q58FG0	EGLELPEDEEEKKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18869 (Experiment 1)	18869	42.132	558.281067	3+	3+	1671.8203108010307	0	0.633372249094212								100.0	Confident
3338	Q15393	TVLDPVTGDLSDTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35706 (Experiment 1)	35706	62.341	744.881714	2+	2+	1487.7467519379502	0	1.42514671222472								100.0	Confident
3339	P11310	IYQIYEGTSQIQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32389 (Experiment 1)	32389	58.499	560.265686	3+	3+	1677.7763514216003	0	-0.6680290646284678	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.94303226579954)	Phosphorylation of Y (5: 0.17452006980802792)		0	Y2-{Y2 Y5}	1	100.0	Confident
3340	P62424	VAPAPAVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13234 (Experiment 1)	13234	34.054	426.27121	2+	2+	850.5276384885003	0	0.2681132711781609								100.0	Confident
3341	Q9NY33	GDYAPILQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27742 (Experiment 1)	27742	53.106	542.757935	2+	2+	1083.5001765885002	0	1.0506332568637604	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
3342	P15531	NIIHGSDSVESAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14004 (Experiment 1)	14004	35.293	495.911011	3+	3+	1484.7107007824006	0	0.3379755118276643								100.0	Confident
3343	P45880	VNNSSLIGVGYTQTLRPGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33741 (Experiment 1)	33741	60.047	702.05658	3+	3+	2102.1484020676903	1	-1.8270759622429968								100.0	Confident
3344	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43772 (Experiment 1)	43772	73.722	586.326355	3+	3+	1755.9559568585505	0	0.7269796261685519								100.0	Confident
3345	P39023	AGMTHIVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9944 (Experiment 1)	9944	28.448	442.742065	2+	2+	883.4698063425501	0	-0.25892741251307033								98.9556135770235	Confident
3346	P11586	VLLSALER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34342 (Experiment 1)	34342	60.759	450.779297	2+	2+	899.5440168286302	0	0.02688427202226053								92.66304347826086	Confident
3347	P14550, Q96JD6	SPAQILLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30752 (Experiment 1)	30752	56.595	449.278839	2+	2+	896.5443511818	0	-1.3645353892005883								99.45945945945947	Confident
3348	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20772 (Experiment 1)	20772	44.442	449.208649	3+	3+	1344.6002845525904	0	2.844304003153412	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 13.492309544630924)	Phosphorylation of Y (4: 62.47818499127399)		0	Y4-{Y4 Y7 Y9}	1	100.0	Confident
3349	P30086	NRPTSISWDGLDSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30699 (Experiment 1)	30699	56.535	544.936951	3+	3+	1631.79034808543	0	-0.8101761683988672								100.0	Confident
3350	P22102	VLAVTAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27157 (Experiment 1)	27157	52.409	421.776428	2+	2+	841.5385375253702	0	-0.27794219089728744								99.7340425531915	Confident
3351	P61313	GATYGKPVHHGVNQLK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7272 (Experiment 1)	7272	22.995	447.22522	4+	4+	1784.8723174951103	0	-0.3037408050487601	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Doubtful
3352	P62995	AAQDRDQIYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9128 (Experiment 1)	9128	26.902	658.292847	2+	2+	1314.5717783889702	0	-0.4840720118896733	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.86914378029078)	Y9	1		0	99.7289972899729	Confident
3353	P41212	LQPIYWSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40015 (Experiment 1)	40015	67.757	571.77356	2+	2+	1141.5321454231203	0	0.3687153801024402	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	99.7289972899729	Confident
3354	P32322	EGATVYATGTHAQVEDGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15378 (Experiment 1)	15378	37.452	647.950317	3+	3+	1940.8265490711506	0	1.3234203048227282	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	99.37888198757764	Confident
3355	ALDOA_RABIT, P04075	QLLLTADDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28584 (Experiment 1)	28584	54.092	522.788452	2+	2+	1043.5611234447501	0	1.1741107348467827								99.72826086956522	Confident
3356	P27348, P31946, P31947, P61981, P62258, P63104, Q04917	NLLSVAYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33159 (Experiment 1)	33159	59.379	454.266266	2+	2+	906.5174677276202	0	0.5628186395035745								100.0	Confident
3357	P35579	IAEFTTNLTEEEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33519 (Experiment 1)	33519	59.795	827.396729	2+	2+	1652.7781116358806	0	0.4794742642784467								94.90616621983914	Confident
3358	Q12906	VLQDMGLPTGAEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32875 (Experiment 1)	32875	59.055	722.363403	2+	2+	1442.7187633683002	0	-4.50623090848387								100.0	Doubtful
3359	A5A3E0, P60709, P62736, P63261, P63267, P68032, P68133, Q562R1, Q6S8J3, Q9BYX7	SYELPDGQVITIGNER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43609 (Experiment 1)	43609	73.44	896.451416	2+	2+	1789.88464239309	1	0.1572831142112595								100.0	Confident
3360	P78527	ILDVMYSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33200 (Experiment 1)	33200	59.425	498.763275	2+	2+	995.5110024481903	0	0.9970854184616174								99.49367088607595	Confident
3361	P60900	AINQGGLTSVAVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26056 (Experiment 1)	26056	51.138	643.364929	2+	2+	1284.7149983172003	0	0.23839444363497883								94.3089430894309	Confident
3362	P09651	SSGPYGGGGQYFAKPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20548 (Experiment 1)	20548	44.184	814.894531	2+	2+	1627.7743040984703	0	0.12576347217620767								100.0	Confident
3363	P42704	EKDIQEESTFSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15705 (Experiment 1)	15705	37.907	519.245972	3+	3+	1554.7161800856604	0	-0.060014004724984006								99.37888198757764	Confident
3364	P68104, Q05639, Q5VTE0	EHALLAYTLGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36307 (Experiment 1)	36307	63.106	438.917694	3+	3+	1313.7343367794504	0	-2.3422558904013595								100.0	Confident
3365	ALDOA_RABIT, P04075	ALQASALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14331 (Experiment 1)	14331	35.785	401.244873	2+	2+	800.4756029156401	0	-0.5107218588296415								99.20424403183023	Confident
3366	P23526	ALDIAENEMPGLMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43437 (Experiment 1)	43437	73.169	780.381653	2+	2+	1558.74834924442	0	0.2587336970137477								100.0	Confident
3367	P78527	HSSLITPLQAVAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34000 (Experiment 1)	34000	60.356	507.623444	3+	3+	1519.8470751159105	0	0.937364765539112								100.0	Confident
3368	P61088, Q5JXB2	LLAEPVPGIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32112 (Experiment 1)	32112	58.185	518.826477	2+	2+	1035.6328318330302	0	5.367173306971273								93.08510638297872	Doubtful
3369	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20932 (Experiment 1)	20932	44.629	759.859863	2+	2+	1517.7014551458406	0	2.446457440449893	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.47643979057592)	Y11	1		0	99.72972972972973	Confident
3370	P35579	KQELEEICHDLEAR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30592 (Experiment 1)	30592	56.412	590.621094	3+	3+	1768.8413976821203	0	0.030994177731724238								100.0	Confident
3371	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17929 (Experiment 1)	17929	40.851	798.83905	2+	2+	1595.6617155921804	0	1.1463362332214493	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3372	P23396	ELTAVVQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16078 (Experiment 1)	16078	38.445	444.263855	2+	2+	886.5123823471804	0	0.8719141366288796								99.72826086956522	Confident
3373	P13073	VNPIQGLASK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27256 (Experiment 1)	27256	52.524	513.801025	2+	2+	1025.5869442697704	0	0.5379484235532065								100.0	Confident
3374	P19338	GLSEDTTEETLKESFDGSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38253 (Experiment 1)	38253	65.443	734.012939	3+	3+	2199.0179009602607	0	-0.41477939047217866								100.0	Confident
3375	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35046 (Experiment 1)	35046	61.575	630.797974	2+	2+	1259.5798834611805	0	1.1981704671579947	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3376	P37837	TIVMGASFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31024 (Experiment 1)	31024	56.915	491.263062	2+	2+	980.5113368013601	0	0.238431392374481								93.45549738219894	Confident
3377	P07437, Q13509, Q13885, Q9BVA1	AILVDLEPGTMDSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44030 (Experiment 1)	44030	74.199	808.423096	2+	2+	1614.8287077401003	0	1.8129934711841158								100.0	Confident
3378	P08621	REFEVYGPIKR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22836 (Experiment 1)	22836	47.25	491.91394	3+	3+	1472.7177143466702	0	1.5424489392515153	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3379	P38919	EQIYDVYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30867 (Experiment 1)	30867	56.729	583.250671	2+	2+	1164.4852548003503	0	1.3152732777397285	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 12.680432057035638)	Phosphorylation of Y (4: 46.0047423002762)		0	Y7-{Y4 Y7}	1	100.0	Confident
3380	O00148, Q13838	DFLLKPELLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43933 (Experiment 1)	43933	74.023	622.373901	2+	2+	1242.7336085034601	0	-0.28876289622802126								99.7289972899729	Confident
3381	P53041	GNHETDNMNQIYGFEGEVK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34938 (Experiment 1)	34938	61.454	754.642639	3+	3+	2260.90962707211	0	-1.5634185992320653	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 97.38219895287958)	Y12	1		0	92.14285714285715	Doubtful
3382	Q9Y230	TTEMETIYDLGTK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40446 (Experiment 1)	40446	68.396	791.343201	2+	2+	1580.6681064122301	0	2.3647533658455386	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3383	P49327	AQVADVVVSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20604 (Experiment 1)	20604	44.249	522.29657	2+	2+	1042.5771078620603	0	1.41605985479001								100.0	Confident
3384	P14866	NPNGPYPYTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27259 (Experiment 1)	27259	52.529	632.321594	2+	2+	1262.6295373577404	0	-0.7134745431612431								98.91891891891892	Confident
3385	P25705	VVDALGNAIDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29502 (Experiment 1)	29502	55.152	586.319214	2+	2+	1170.6244519773002	0	-0.4919765775497542								100.0	Confident
3386	P18669, Q8N0Y7	SYDVPPPPMEPDHPFYSNISK	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38254 (Experiment 1)	38254	65.445	833.031006	3+	3+	2496.0708787407802	0	0.12398851102424215	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 11.910990120317246)	Phosphorylation of Y (16: 91.97207678883072)		0	Y16-{Y2 Y16}	1	97.74436090225565	Confident
3387	P00558, P07205	LGDVYVNDAFGTAHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32113 (Experiment 1)	32113	58.186	545.931824	3+	3+	1633.7848687821704	1	-8.908211594285019								98.7012987012987	Doubtful
3388	P00519, P42684	LMTGDTYTAHAGAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12478 (Experiment 1)	12478	32.917	758.829468	2+	2+	1515.6428947239006	0	0.9806840651939707	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3389	P13010	TLFPLIEAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45005 (Experiment 1)	45005	76.564	516.310852	2+	2+	1030.6062827320204	0	0.8409033842378173								100.0	Confident
3390	P49327	QEPLLIGSTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28189 (Experiment 1)	28189	53.633	543.312195	2+	2+	1084.61282466444	0	-2.749422778985428								97.8319783197832	Confident
3391	P37108	FQMAYSNLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42811 (Experiment 1)	42811	72.095	621.818604	2+	2+	1241.6226781554901	0	-0.018565795224115528								99.22077922077922	Confident
3392	P35232	DLQNVNITLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35797 (Experiment 1)	35797	62.462	593.334717	2+	2+	1184.6513354314802	0	2.9878965345754014								100.0	Confident
3393	P62913	VLEQLTGQTPVFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38002 (Experiment 1)	38002	65.138	773.929016	2+	2+	1545.8402583999705	0	2.080729007582769								99.7289972899729	Confident
3394	Q07666	KDDEENYLDLFSHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39341 (Experiment 1)	39341	66.825	584.941162	3+	3+	1751.8002440627904	0	0.804945865943432								100.0	Confident
3395	P39023	NNASTDYDLSDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17573 (Experiment 1)	17573	40.387	671.792114	2+	2+	1341.5684532228101	0	0.9093919467918389								100.0	Confident
3396	P62736, P63267, P68032, P68133	YPIEHGIITNWDDMEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38838 (Experiment 1)	38838	66.161	654.308044	3+	3+	1959.90366358551	0	-0.6933456979172203								100.0	Confident
3397	P04083	TPAQFDADELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29000 (Experiment 1)	29000	54.577	631.804688	2+	2+	1261.5938801250102	0	0.7462290857858609								100.0	Confident
3398	P05543, P50991	FSNISAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12559 (Experiment 1)	12559	33.038	419.225891	2+	2+	836.4392174069203	0	-2.3714372987274643								99.45799457994579	Confident
3399	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29369 (Experiment 1)	29369	55.0	452.230438	3+	3+	1353.6693671719202	0	0.08655443787258378	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
3400	Q04446	IYESHVGISSHEGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11775 (Experiment 1)	11775	31.746	541.57843	3+	3+	1621.7137511650403	0	-0.1788386243952857	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3401	P51991	EDSVKPGAHLTVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11161 (Experiment 1)	11161	30.808	460.92099	3+	3+	1379.7408787118702	0	0.18939453050992097								100.0	Confident
3402	P07910	VPPPPPIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19139 (Experiment 1)	19139	42.471	472.289154	2+	2+	942.5650866263802	0	-1.409685269897016								98.91598915989161	Confident
3403	P60842	LQMEAPHIIVGTPGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33744 (Experiment 1)	33744	60.05	540.294861	3+	3+	1617.86609630833	0	-2.0622701379337913								100.0	Confident
3404	P62826	FNVWDTAGQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35035 (Experiment 1)	35035	61.564	647.807373	2+	2+	1293.5989655054502	0	0.9474746196522623								100.0	Confident
3405	P50995	DAQELYAAGENR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19615 (Experiment 1)	19615	43.049	708.79364	2+	2+	1415.5718379586206	0	0.6271982864455807	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3406	Q16666	TTIYEIQDDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26880 (Experiment 1)	26880	52.086	627.302429	2+	2+	1252.5935457718401	0	-2.5830420413305144								99.2248062015504	Confident
3407	P50990	IAVYSCPFDGMITETK	Phosphorylation of Y(4)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45251 (Experiment 1)	45251	77.098	956.417786	2+	2+	1910.8195387565304	0	0.7738830313879902	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3408	P25705	HALIIYDDLSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34854 (Experiment 1)	34854	61.352	684.334656	2+	2+	1366.6533827546102	0	1.005584868131861	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3409	P12268	HGFCGIPITDTGR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29342 (Experiment 1)	29342	54.969	477.901093	3+	3+	1429.6772329094902	1	0.6015584825978569								100.0	Confident
3410	P27105	YLQTLTTIAAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35543 (Experiment 1)	35543	62.148	676.378052	2+	2+	1350.7394817295406	0	1.5297214292640988								99.21465968586386	Confident
3411	P49736	TSIHEAMEQQSISISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25888 (Experiment 1)	25888	50.942	596.966614	3+	3+	1787.8723634572304	0	3.1543696754127217								100.0	Confident
3412	P13796	QFVTATDVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28255 (Experiment 1)	28255	53.71	568.309448	2+	2+	1134.6033226099003	0	0.8978008330689633								100.0	Confident
3413	P62328	TETQEKNPLPSKETIEQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16630 (Experiment 1)	16630	39.12	558.03656	4+	4+	2228.1172210787104	0	-0.03895172891613629								100.0	Doubtful
3414	P13639	CLYASVLTAQPR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35941 (Experiment 1)	35941	62.637	689.860474	2+	2+	1377.70747040861	0	-0.7793904976157652								99.73333333333333	Confident
3415	P26038	EALLQASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17823 (Experiment 1)	17823	40.714	444.250793	2+	2+	886.4872302285003	0	-0.2219040275951764								99.7289972899729	Confident
3416	P62280	CPFTGNVSIR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27599 (Experiment 1)	27599	52.937	575.787964	2+	2+	1149.56007789893	0	1.1264293351007533								100.0	Confident
3417	Q9GIY3	YFHNQEEFVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20614 (Experiment 1)	20614	44.261	456.881989	3+	3+	1367.6258489596305	0	-1.2485776568146474								100.0	Confident
3418	Q8IY18	ENTSQYFFITPK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43188 (Experiment 1)	43188	72.772	777.847839	2+	2+	1553.6803257784404	0	0.5137819417008722	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 89.17975567190227)	Y6	1		0	91.44385026737967	Confident
3419	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29762 (Experiment 1)	29762	55.453	677.842529	2+	2+	1353.6693671719202	0	0.8393508537263353	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
3420	P31040	IDEYDYSKPIQGQQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20369 (Experiment 1)	20369	43.974	946.428833	2+	2+	1890.8400738769703	0	1.605611631542712	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 8.987596469669938)	Phosphorylation of Y (4: 0.6980802792321117)		0	Y4-{Y4 Y6}	1	100.0	Confident
3421	P26885	KGDVLHMHYTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25884 (Experiment 1)	25884	50.938	693.357849	2+	2+	1384.6921546976403	0	6.483251783590457								98.94459102902374	Doubtful
3422	P09651, P22626, Q32P51	IFVGGIKEDTEEHHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20261 (Experiment 1)	20261	43.855	470.745972	4+	4+	1878.9588103928604	0	-2.1392915343285552								100.0	Doubtful
3423	P26038	ERQEAEEAKEALLQASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25729 (Experiment 1)	25729	50.762	490.254303	4+	4+	1956.9864816926806	0	0.828366730783321								100.0	Doubtful
3424	Q16629	VYVGNLGTGAGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24796 (Experiment 1)	24796	49.67	608.292236	2+	2+	1214.56965313065	0	0.2185921241349222	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
3425	Q9BRG1	LIYQWVSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38503 (Experiment 1)	38503	65.757	572.781982	2+	2+	1143.5477954872601	0	1.4102934841370318	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 93.01919720767889)	Y3	1		0	99.45799457994579	Confident
3426	P0DME0, Q01105	VEVTEFEDIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35874 (Experiment 1)	35874	62.554	604.806519	2+	2+	1207.5972341699503	0	1.0341304862057015								100.0	Confident
3427	O00571, O15523	DKDAYSSFGSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13508 (Experiment 1)	13508	34.505	656.764465	2+	2+	1311.5132604533403	0	0.8500870892204784	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.55671902268762)	Y5	1		0	99.1869918699187	Confident
3428	Q92918	DHYDLLQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24270 (Experiment 1)	24270	49.057	570.248596	2+	2+	1138.48083812625	0	1.5790858428024734	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 82.89703315881326)	Y3	1		0	92.67676767676768	Confident
3429	P62917	GVAMNPVEHPFGGGNHQHIGKPSTIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19946 (Experiment 1)	19946	43.481	457.068573	6+	6+	2736.3666851851904	0	0.39892423106718367								100.0	Doubtful
3430	P45880	LTLSALVDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41456 (Experiment 1)	41456	69.835	508.802673	2+	2+	1015.5913609438703	0	-0.5580524704433343								100.0	Confident
3431	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44471 (Experiment 1)	44471	75.34	918.96936	2+	2+	1835.9222873793005	0	1.0227158160102097	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
3432	Q06830	TIAQDYGVLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28679 (Experiment 1)	28679	54.203	594.28949	2+	2+	1186.5635051210502	0	0.775670827358908	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
3433	P38159, Q96E39	GGHMDDGGYSMNFNMSSSR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30082 (Experiment 1)	30082	55.826	710.589966	3+	3+	2128.74382470031	0	1.9907907069841537	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.65095986038395)	Y9	1		0	100.0	Confident
3434	P62328	TETQEKNPLPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9718 (Experiment 1)	9718	28.073	457.908295	3+	3+	1370.7041588499803	0	-0.8031080621090759								92.66666666666666	Doubtful
3435	P39023	HGSLGFLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26975 (Experiment 1)	26975	52.198	492.274414	2+	2+	982.53484912726	0	-0.5830696588610379								99.72972972972973	Confident
3436	P06753, P07951, P09493, P67936	IQLVEEELDRAQER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33699 (Experiment 1)	33699	60.0	576.635864	3+	3+	1726.8849767462605	0	0.45427493588831014								100.0	Confident
3437	B2RXH8, B7ZW38, O60812, P07910	AAVAGEDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.33 min, Period: 1, Cycle(s): 5785 (Experiment 1)	5785	19.585	423.209412	3+	2+	844.4038945273601	0	0.4448615423065761								98.91598915989161	Confident
3438	Q7L5N7	HLDEYASIASSSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18103 (Experiment 1)	18103	41.14	744.327454	2+	2+	1486.6341038620105	0	4.19924764433981	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 91.2739965095986)	Y5	1		0	92.44791666666666	Confident
3439	P23396	ELAEDGYSGVEVR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25100 (Experiment 1)	25100	50.025	752.321411	2+	2+	1502.6290184815703	0	-0.4980682525846109	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.7289972899729	Confident
3440	P12235, P12236	AAYFGVYDTAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33664 (Experiment 1)	33664	59.959	603.295654	2+	2+	1204.5764391557202	0	0.2618208305411225								99.73118279569893	Confident
3441	Q13547, Q92769	YGEYFPGTGDLR	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40369 (Experiment 1)	40369	68.286	727.803284	2+	2+	1453.5915107740402	0	0.3464483613640877	Phosphorylation of Y (1: Doubtfull)	Phosphorylation of Y (1: 9.808129952130962)	Phosphorylation of Y (1: 7.431340872374798)		0	Y1-{Y1 Y4}	1	93.76693766937669	Confident
3442	P36578	AAAAAAALQAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13167 (Experiment 1)	13167	33.959	478.779938	2+	2+	955.5450794577903	0	0.2544056553690654								100.0	Confident
3443	P07237	VDATEESDLAQQYGVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34025 (Experiment 1)	34025	60.385	890.922485	2+	2+	1779.8275214397904	0	1.6250747623408603								99.7289972899729	Confident
3444	P07900, Q58FG0	HIYYITGETK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22060 (Experiment 1)	22060	46.303	652.799683	2+	2+	1303.5849688416204	0	-0.11931319060342839	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 4: 0.0)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y4}	1	100.0	Confident
3445	P45880	NNFAVGYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21984 (Experiment 1)	21984	46.21	470.735718	2+	2+	939.4562644533901	0	0.6570708030676731								99.73045822102425	Confident
3446	P0DMV8, P34931	DAGVIAGLNVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44811 (Experiment 1)	44811	76.147	599.351624	2+	2+	1196.6877209402	0	0.8126506448390423								99.73190348525469	Confident
3447	P23284	HYGPGWVSMANAGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29931 (Experiment 1)	29931	55.649	518.890137	3+	3+	1553.6486488106805	0	-0.043176200467801	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3448	P48643	FSELTAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17916 (Experiment 1)	17916	40.833	462.737244	2+	2+	923.4600124211504	0	-0.08358390090638469								100.0	Confident
3449	P30101	FLQDYFDGNLKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38359 (Experiment 1)	38359	65.581	505.924377	3+	3+	1514.7517777487403	0	-0.3137155462688523								99.24812030075188	Confident
3450	P50552	VQIYHNPTANSFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22740 (Experiment 1)	22740	47.138	542.919678	3+	3+	1625.7351553159604	0	1.258188681875904	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.28057553956835	Confident
3451	P0C0S5, Q71UI9	ATIAGGGVIPHIHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21053 (Experiment 1)	21053	44.794	457.60202	3+	3+	1369.7830183073702	0	0.8830768595679285								100.0	Confident
3452	O60361, P22392	NIIHGSDSVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9874 (Experiment 1)	9874	28.333	535.285645	2+	2+	1068.5563724174804	0	0.3406116184821206								99.73474801061008	Confident
3453	P31146	QVALWDTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31776 (Experiment 1)	31776	57.801	480.76181	2+	2+	959.5076313199102	0	1.4932016020899892								99.73544973544973	Confident
3454	Q13838	NCPHIVVGTPGR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16589 (Experiment 1)	16589	39.067	436.227692	3+	3+	1305.66118892253	0	0.0440725776657329								100.0	Confident
3455	P49458	PQYQTWEEFSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37317 (Experiment 1)	37317	64.304	735.837769	2+	2+	1469.6575430107305	0	2.338874029631053								99.73958333333334	Confident
3456	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28174 (Experiment 1)	28174	53.614	523.251831	2+	2+	1044.4892775516303	0	-0.16099822038564102	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3457	Q02878	YYPTEDVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22666 (Experiment 1)	22666	47.05	570.272949	2+	2+	1138.5294889633	0	1.6273839568395005								100.0	Confident
3458	P22626	GFGFVTFDDHDPVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42141 (Experiment 1)	42141	70.952	848.884766	2+	2+	1694.75765097482	1	-3.5518888336369763								99.72972972972973	Confident
3459	P60709, P62736, P63261, P63267, P68032, P68133	EITALAPSTMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27903 (Experiment 1)	27903	53.289	581.3125	2+	2+	1160.6111104122804	0	-0.570558456970837								100.0	Confident
3460	P31689	VKETTYYDVLGVKPNATQEELKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29590 (Experiment 1)	29590	55.255	684.09906	4+	4+	2732.3673780123004	0	-0.08912434658897758	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 7: 0.0)	Phosphorylation of Y (7: 0.0)		0	Y6-{Y6 Y7}	1	100.0	Doubtful
3461	P04908, Q7L7L0, Q93077	NDEELNKLLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34423 (Experiment 1)	34423	60.854	434.233307	3+	3+	1299.67827845531	0	-0.14343726910795315								99.40476190476191	Confident
3462	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21124 (Experiment 1)	21124	44.888	759.857422	2+	2+	1517.7014551458406	0	-0.7659848671901524	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3463	P62263	VKADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33597 (Experiment 1)	33597	59.882	643.802612	4+	4+	2571.1788660499706	0	0.9615078890561434	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Doubtful
3464	P38117	EIDGGLETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30685 (Experiment 1)	30685	56.519	551.791809	2+	2+	1101.5666027480104	0	2.231207331407714								99.73890339425587	Confident
3465	Q9NR30	STYEQVDLIGKK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24514 (Experiment 1)	24514	49.346	487.57254	3+	3+	1459.6959758425803	0	-0.12664303091753246	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
3466	O43665	EIYMTFLSSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46790 (Experiment 1)	46790	80.004	649.788757	2+	2+	1297.5665418961603	0	-2.7553723262169307	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.65095986038395)	Y3	1		0	99.45799457994579	Confident
3467	Q16698	SLAAEWGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25700 (Experiment 1)	25700	50.729	431.226471	2+	2+	860.4392174069201	0	-0.9604463131544441								99.45799457994579	Confident
3468	Q9HCS7	AAEIYGVTHTR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17570 (Experiment 1)	17570	40.381	649.302124	2+	2+	1296.58636582395	0	2.5637148240427696	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	100.0	Confident
3469	O75746, Q9UJS0	IYSTLAGTR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19942 (Experiment 1)	19942	43.477	531.254456	2+	2+	1060.4954255612304	0	-1.0037504363239036	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	99.7340425531915	Confident
3470	Q86VH4	QMNSPLQEYYVDYK	Phosphorylation of Y(9, 13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35117 (Experiment 1)	35117	61.657	969.883057	2+	2+	1936.7355479565806	1	6.52908901944929	Phosphorylation of Y (9: Doubtfull, 13: Doubtfull)		Phosphorylation of Y (9: 63.994862031511246, 13: 63.994862031511246)		0	Y9-{Y9}, Y13-{Y13}	2	94.02173913043478	Doubtful
3471	P68104, Q05639, Q5VTE0	LPLQDVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30660 (Experiment 1)	30660	56.49	488.279297	2+	2+	974.5436824754604	0	0.36719870116347647								100.0	Confident
3472	P12955	EASFDGISK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20864 (Experiment 1)	20864	44.548	477.233582	2+	2+	952.4501760134401	0	2.5512235938564527								94.08602150537635	Confident
3473	O75390	AYAQGISR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.50 min, Period: 1, Cycle(s): 10651 (Experiment 1)	10651	29.862	473.214264	2+	2+	944.4116959372702	0	2.4081423234040855	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
3474	Q15631	TKFPAEQYYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21389 (Experiment 1)	21389	45.278	691.811096	2+	2+	1381.6067669153604	0	0.6303393876754367	Phosphorylation of Y (8: Random)	Phosphorylation of Y (8: 0.0, 9: 0.0)	Phosphorylation of Y (9: 0.0)		0	Y8-{Y8 Y9}	1	99.45799457994579	Confident
3475	P23246	ISDSEGFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13816 (Experiment 1)	13816	34.961	441.713806	2+	2+	881.4130622287303	0	-0.0035796415896717886								92.75	Confident
3476	P52209	AGQAVDDFIEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29431 (Experiment 1)	29431	55.071	596.796082	2+	2+	1191.5771674317102	0	0.37168041464637563								100.0	Confident
3477	P49321	EAQLYAAQAHLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21621 (Experiment 1)	21621	45.68	711.843811	2+	2+	1421.6704298010804	0	1.8538267435113545	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3478	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32364 (Experiment 1)	32364	58.47	616.268311	2+	2+	1230.5209716027305	0	0.8904113703965235	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 43.16022828057617)	Phosphorylation of Y (3: 87.41258741258741)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
3479	P27797	QIDNPDYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11866 (Experiment 1)	11866	31.893	496.738159	2+	2+	991.4610750503102	0	0.6945475524611711								98.74371859296483	Confident
3480	O60488, O95573	LQAGEYVSLGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27838 (Experiment 1)	27838	53.217	622.798645	2+	2+	1243.5849688416204	0	-1.7917277628693677	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 96.33507853403141)	Y6	1		0	99.2	Confident
3481	GSTP1_HUMAN, P09211	ASCLYGQLPK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27404 (Experiment 1)	27404	52.697	568.792908	2+	2+	1135.56957995347	0	1.4795502654338117								99.73890339425587	Confident
3482	P04179	HHAAYVNNLNVTEEK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16982 (Experiment 1)	16982	39.569	606.943909	3+	3+	1817.8097768082005	0	0.06633856915545348	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.30191972076788)	Y5	1		0	100.0	Confident
3483	Q16881	KVVYENAYGQFIGPHR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28720 (Experiment 1)	28720	54.252	653.315857	3+	3+	1956.9247469907903	0	0.5074672880246358	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 5.927251481515231)	Phosphorylation of Y (4: 0.3490401396160559)		0	Y4-{Y4 Y8}	1	100.0	Confident
3484	P63244	LTRDETNYGIPQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17073 (Experiment 1)	17073	39.694	548.257874	3+	3+	1641.7511993029202	0	0.36071642310201096	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3485	P62318	VAQLEQVYIR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34853 (Experiment 1)	34853	61.349	649.829468	2+	2+	1297.6431524240802	0	0.9468972411906348	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.30191972076788)	Y8	1		0	99.73045822102425	Confident
3486	P61604	KFLPLFDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39549 (Experiment 1)	39549	67.11	518.303955	2+	2+	1034.5913013742202	0	1.9830991182361137								98.9501312335958	Confident
3487	P19338	AVTTPGKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4051 (Experiment 1)	4051	16.616	401.245087	2+	2+	800.4756029156401	0	0.022618016976468376								99.45799457994579	Confident
3488	P33991	DYIAYAHSTIMPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34920 (Experiment 1)	34920	61.429	809.36084	2+	2+	1616.7058293336302	0	0.8017028512236382	Phosphorylation of Y (5: Random)	Phosphorylation of Y (2: 0.0, 5: 0.0)	Phosphorylation of Y (5: 2.6178010471204187)		0	Y5-{Y2 Y5}	1	100.0	Confident
3489	P27797	VHVIFNYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25229 (Experiment 1)	25229	50.175	510.287842	2+	2+	1018.5600012459402	0	1.1070435092881303								99.73474801061008	Confident
3490	Q02790	FQIPPNAELK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32701 (Experiment 1)	32701	58.858	578.82019	2+	2+	1155.6288090817502	0	-2.575936140737543								96.22641509433963	Confident
3491	P40926	SQETECTYFSTPLLLGKK	Phosphorylation of Y(8)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42269 (Experiment 1)	42269	71.148	728.009949	3+	3+	2181.00648757907	0	0.7005497511085245	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	99.28057553956835	Confident
3492	Q9Y3I0	GMAAAGNYAWVNR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31875 (Experiment 1)	31875	57.916	730.811157	2+	2+	1459.6067839987004	0	0.668482082693306	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3493	P08621	EFEVYGPIKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29864 (Experiment 1)	29864	55.571	659.315796	2+	2+	1316.6166033230702	0	0.33045124373723117	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3494	O43933, P55072, Q8IYT4	GILLYGPPGTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36700 (Experiment 1)	36700	63.568	586.83667	2+	2+	1171.6601092100302	0	-1.1264992735648298								99.73544973544973	Confident
3495	Q14152	ITTMQLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22313 (Experiment 1)	22313	46.626	496.266022	2+	2+	990.5168161046201	0	0.6800407292217764								97.83783783783784	Confident
3496	P08575	NSNVIPYDYNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27495 (Experiment 1)	27495	52.806	677.822388	2+	2+	1353.6313282628903	0	-0.8152545806207803								91.32791327913279	Confident
3497	P55072	LGDVISIQPCPDVK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36486 (Experiment 1)	36486	63.316	770.906067	2+	2+	1539.7966793358303	0	0.5848514569876582								100.0	Confident
3498	P16401	NGLSLAALKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25228 (Experiment 1)	25228	50.173	507.819	2+	2+	1013.6233297784904	0	0.11548199185652078								100.0	Confident
3499	P30520	ELPVNAQNYVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29865 (Experiment 1)	29865	55.572	651.843567	2+	2+	1301.6727991520504	0	-0.16728372349684267								99.45652173913044	Confident
3500	P26038	ERQEAEEAKEALLQASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25704 (Experiment 1)	25704	50.734	653.335938	3+	3+	1956.9864816926806	0	-0.25361786153524424								100.0	Confident
3501	P16150	RPTLTTFFGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36052 (Experiment 1)	36052	62.781	399.224182	3+	3+	1194.6509415086603	0	-0.18778843578582613								100.0	Confident
3502	Q9Y3Q3	TVIDSQTHYR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12129 (Experiment 1)	12129	32.319	650.289124	2+	2+	1298.5656303793703	0	-1.4880381996052172	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3503	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13812 (Experiment 1)	13812	34.957	400.860077	3+	3+	1199.5587540937802	0	-0.2931148407820501	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3504	P13639	STLTDSLVCK		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27732 (Experiment 1)	27732	53.094	562.286743	2+	2+	1122.5590748394202	0	-0.12606826341317684								100.0	Confident
3505	P50990	HFSGLEEAVYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29430 (Experiment 1)	29430	55.07	694.306763	2+	2+	1386.5969305076505	0	1.4709360751826794	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3506	P62491, Q15907	NEFNLESK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22642 (Experiment 1)	22642	47.021	490.737732	2+	2+	979.4610750503102	0	-0.16707896710047								99.45799457994579	Confident
3507	P62937, PPIA_HUMAN	EGMNIVEAMER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41280 (Experiment 1)	41280	69.57	639.794861	2+	2+	1277.5744076337305	0	0.5950603426112062								100.0	Confident
3508	P14625	LIINSLYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36381 (Experiment 1)	36381	63.196	482.29657	2+	2+	962.5800679841802	0	-1.5352747901417614								99.7289972899729	Confident
3509	P60174	IIYGGSVTGATCK	Phosphorylation of Y(3)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20639 (Experiment 1)	20639	44.289	703.820007	2+	2+	1405.63126741104	0	-4.124861936243329	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3510	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26147 (Experiment 1)	26147	51.243	523.252502	2+	2+	1044.4892775516303	0	1.1213668899265758	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.60383944153578)	Y7	1		0	99.73118279569893	Confident
3511	P49327	SLYQSAGVAPESFEYIEAHGTGTK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41887 (Experiment 1)	41887	70.489	874.730896	3+	3+	2621.168678205751	0	0.8308824403784737	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 4.331398227279771)	Phosphorylation of Y (3: 83.24607329842932)		0	Y3-{Y3 Y15}	1	99.28057553956835	Confident
3512	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13811 (Experiment 1)	13811	34.954	600.786926	2+	2+	1199.5587540937802	0	0.45354918628356355	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3513	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21554 (Experiment 1)	21554	45.562	506.908051	3+	3+	1517.7014551458406	0	0.5710793884885212	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3514	P29401	ILATPPQEDAPSVDIANIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40365 (Experiment 1)	40365	68.28	674.029724	3+	3+	2019.0636693842202	0	1.8165479877313004								100.0	Confident
3515	P62263	TKTPGPGAQSALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10221 (Experiment 1)	10221	29.06	428.574158	3+	3+	1282.6993482530602	0	1.008264098264944								100.0	Confident
3516	P62273	GHQQLYWSHPR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18502 (Experiment 1)	18502	41.67	496.88916	3+	3+	1487.6459463887402	0	-0.19842729608243528	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3517	P62805	ISGLIYEETR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31378 (Experiment 1)	31378	57.327	591.319885	2+	2+	1179.6135529404305	1	7.032067114813054								100.0	Doubtful
3518	P62851	LNNLVLFDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40798 (Experiment 1)	40798	68.889	538.30957	2+	2+	1074.6073453611803	0	-2.5619902481537404								100.0	Confident
3519	P62829	LPAAGVGDMVMATVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43253 (Experiment 1)	43253	72.886	730.389099	2+	2+	1458.7574573761403	0	4.2359041601436145								96.7479674796748	Confident
3520	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35569 (Experiment 1)	35569	62.178	630.797607	2+	2+	1259.5798834611805	0	0.616367013693716	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
3521	P13796, P13797, Q14651	LSPEELLLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44496 (Experiment 1)	44496	75.396	535.316345	2+	2+	1068.61791004488	0	0.21204428552786658								99.73333333333333	Confident
3522	Q92945	VQISPDSGGLPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24340 (Experiment 1)	24340	49.141	677.851685	2+	2+	1353.68884313901	0	-0.019231813022769835								99.7289972899729	Confident
3523	P04406	LVINGNPITIFQERDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44495 (Experiment 1)	44495	75.394	681.369324	3+	3+	2040.1003892461104	1	-8.614993359562455								100.0	Doubtful
3524	P11142	EIAEAYLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26471 (Experiment 1)	26471	51.617	497.265686	2+	2+	992.5178616504402	0	-1.0483158203571112								99.73333333333333	Confident
3525	P27216, P50995	SELSGNFEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18788 (Experiment 1)	18788	42.034	505.743805	2+	2+	1009.4716397340103	0	1.4012374821115694								99.7289972899729	Confident
3526	Q12934	RSYVFQTR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12284 (Experiment 1)	12284	32.609	568.761597	2+	2+	1135.5175579881404	0	-7.838830815282324	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 90.57591623036649)	Y3	1		0	92.3076923076923	Doubtful
3527	O14910, Q9HAP6, Q9NUP9	EQNSPIYISR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27993 (Experiment 1)	27993	53.392	643.792664	2+	2+	1285.57038140664	0	0.3057349656439489	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3528	P29401	TSRPENAIIYNNNEDFQVGQAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32031 (Experiment 1)	32031	58.092	863.730408	3+	3+	2587.17040954125	1	-1.6870483281071853	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3529	O00160, Q12965	HQVEYLGLK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 24039 (Experiment 1)	24039	48.762	583.784058	2+	2+	1165.5532747905202	0	0.24690287687326015	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.50959860383944)	Y5	1		0	96.22641509433963	Confident
3530	P10412, P16402, P16403, P22492, Q02539	KALAAAGYDVEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15716 (Experiment 1)	15716	37.925	412.559723	3+	3+	1234.6557521055804	0	1.2826393620825025								100.0	Confident
3531	P07900	ELISNSSDALDKIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30250 (Experiment 1)	30250	56.02	520.946167	3+	3+	1559.8155002041103	0	0.7495312733126129								100.0	Confident
3532	P11021	KSDIDEIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34685 (Experiment 1)	34685	61.155	530.289551	3+	3+	1587.84680033239	0	0.014625452631844255								100.0	Confident
3533	O14950, P19105	FTDEEVDELYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36392 (Experiment 1)	36392	63.209	708.319702	2+	2+	1414.6252398229403	0	-0.27442160417175626								100.0	Confident
3534	P78527	VVQMLGSLGGQINK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37737 (Experiment 1)	37737	64.817	722.404663	2+	2+	1442.79153438574	0	2.241602291308648								99.73190348525469	Confident
3535	B2RPK0, P09429, P26583	MSSYAFFVQTCR	Phosphorylation of Y(4)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43359 (Experiment 1)	43359	73.063	526.215942	3+	3+	1575.6251364847806	0	0.5448430219275865	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.83844911147011)	Y4	1		0	100.0	Confident
3536	P61978	TDYNASVSVPDSSGPER	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23091 (Experiment 1)	23091	47.558	930.890747	2+	2+	1859.7574664518204	0	5.089030481109393	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Doubtful
3537	HBB_HUMAN, P02042, P02100, P68871, P69891, P69892	LLVVYPWTQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45244 (Experiment 1)	45244	77.085	637.866699	2+	2+	1273.71829279249	0	0.43290716213616726								99.73190348525469	Confident
3538	O75477, O94905	ISEIEDAAFLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40942 (Experiment 1)	40942	69.09	667.852295	2+	2+	1333.6877805098504	0	1.689415724582427								99.73333333333333	Confident
3539	P48643	HKLDVTSVEDYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20512 (Experiment 1)	20512	44.143	478.580536	3+	3+	1432.7198089141204	0	-0.021114214177141682								100.0	Confident
3540	P62191	SKENVLYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10099 (Experiment 1)	10099	28.814	530.757141	2+	2+	1059.5001765885004	0	-0.42158823800161954	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.33507853403141)	Y7	1		0	98.91598915989161	Confident
3541	P43243	SQAFIEMETR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30663 (Experiment 1)	30663	56.495	606.290466	2+	2+	1210.5652228490203	0	0.9535185879892113								100.0	Confident
3542	P19784	VYAEVNSLR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23419 (Experiment 1)	23419	47.96	565.766602	2+	2+	1129.5168892818003	0	1.556991268526111	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
3543	O60711	EEIGSSPFFER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38411 (Experiment 1)	38411	65.646	649.308838	2+	2+	1296.5986311522804	0	3.4590085412433815								99.73045822102425	Confident
3544	P35232	FDAGELITQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36542 (Experiment 1)	36542	63.381	575.297974	2+	2+	1148.5825871653203	0	-1.0360697962925238								100.0	Confident
3545	Q13564	TYGLVGYMR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39320 (Experiment 1)	39320	66.793	570.251709	2+	2+	1138.4882320058102	0	0.5550714772403447	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 18.51042067382668)	Phosphorylation of Y (2: 99.83844911147011)		0	Y2-{Y2 Y7}	1	100.0	Confident
3546	O75391	TYGCVPVANKR	Phosphorylation of Y(2)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12121 (Experiment 1)	12121	32.305	672.805847	2+	2+	1343.60572136954	0	-6.376466918760929	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.47826086956522)	Y2	1		0	99.74619289340102	Doubtful
3547	P12955	AFTPFSGPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30776 (Experiment 1)	30776	56.622	476.251404	2+	2+	950.4861675993402	0	2.1915647839796524								99.45652173913044	Confident
3548	P25789	TTIFSPEGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26132 (Experiment 1)	26132	51.227	504.261627	2+	2+	1006.5083595959002	0	0.3385847476715156								99.73190348525469	Confident
3549	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17682 (Experiment 1)	17682	40.534	514.763184	2+	2+	1027.5120650773501	0	-0.24284070937805705								100.0	Confident
3550	Q15428	FMSAYEQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19872 (Experiment 1)	19872	43.381	516.234558	2+	2+	1030.4542158480601	0	0.33629909805385216								99.72826086956522	Confident
3551	P12956	IMLFTNEDNPHGNDSAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28749 (Experiment 1)	28749	54.287	634.959167	3+	3+	1901.8577760222504	0	-1.1047536444502144								100.0	Confident
3552	O75083	YEYQPFAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24524 (Experiment 1)	24524	49.357	591.749573	2+	2+	1181.4794411439204	0	4.353146261245343	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 12.252901686149535)	Phosphorylation of Y (3: 10.55846422338569)		0	Y3-{Y1 Y3}	1	100.0	Confident
3553	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10335 (Experiment 1)	10335	29.255	405.50769	3+	3+	1213.5016331404804	0	-0.3226743490503415	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3554	P62995	RPHTPTPGIYMGRPTYGSSR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20276 (Experiment 1)	20276	43.871	578.524353	4+	4+	2310.0728848598	0	-1.9786193809222619	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 1.5763197007060767)	Phosphorylation of Y (10: 0.9693053311793215)		0	Y10-{Y10 Y16}	1	100.0	Doubtful
3555	P50990	GSTDNLMDDIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36967 (Experiment 1)	36967	63.888	683.301514	2+	2+	1364.5878087684002	0	0.48755804488956866								100.0	Confident
3556	P50552	VQIYHNPTANSFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22983 (Experiment 1)	22983	47.426	813.874878	2+	2+	1625.7351553159604	0	0.029335232063782867	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.4458804523425)	Y4	1		0	99.46091644204851	Confident
3557	P16401	ATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32229 (Experiment 1)	32229	58.316	606.845703	2+	2+	1211.6761531969903	0	0.5766455835378674								100.0	Confident
3558	P68431, P84243, Q16695, Q6NXT2, Q71DI3	YRPGTVALR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 15035 (Experiment 1)	15035	36.892	516.801575	2+	2+	1031.5876129761102	0	0.9520977199972823								100.0	Confident
3559	Q8TEM1	VGQALELPLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 37994 (Experiment 1)	37994	65.129	548.329956	2+	2+	1094.64479349906	0	0.5157183202386807								100.0	Confident
3560	P25205	CSVLAAANPVYGR	Phosphorylation of Y(11)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34784 (Experiment 1)	34784	61.269	729.336304	2+	2+	1456.6533998379502	0	3.191424351817128	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 99.82547993019197)	Y11	1		0	99.73190348525469	Confident
3561	GSTP1_HUMAN, P09211	MLLADQGQSWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33221 (Experiment 1)	33221	59.448	638.822021	2+	2+	1275.6281574587501	0	1.042237876665119								92.51336898395722	Confident
3562	Q13813	LQIASDENYKDPTNLQGK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24344 (Experiment 1)	24344	49.145	705.332092	3+	3+	2112.9728789516703	0	0.7408562446612608	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3563	P07900	DQVANSAFVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22302 (Experiment 1)	22302	46.612	618.304443	2+	2+	1234.5942144781804	0	0.09589790927956088								100.0	Confident
3564	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30878 (Experiment 1)	30878	56.741	630.796204	2+	2+	1259.5798834611805	0	-1.6078025918593022	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
3565	Q9Y2R9	FYQVPVPLPDR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42215 (Experiment 1)	42215	71.059	705.845825	2+	2+	1409.67445255236	0	1.8732978762169752	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
3566	P20700	DAALATALGDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21046 (Experiment 1)	21046	44.781	587.327942	2+	2+	1172.6401020414403	0	1.0462861832433177								100.0	Confident
3567	P62750	LDHYAIIK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20910 (Experiment 1)	20910	44.603	526.763428	2+	2+	1051.5103473493803	0	1.8563557396962767	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.03069466882067)	Y4	1		0	98.91304347826086	Confident
3568	P36969	TEVNYTQLVDLHAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33590 (Experiment 1)	33590	59.874	580.27655	3+	3+	1737.8087141790404	0	-0.5133064097277704	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3569	P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3	TIGGGDDSFNTFFSETGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45427 (Experiment 1)	45427	77.49	1004.448792	2+	2+	2006.8857645919009	0	-1.3607073985196394								100.0	Confident
3570	Q08211	SSVNCPFSSQDMK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24444 (Experiment 1)	24444	49.262	743.820984	2+	2+	1485.6228143781302	0	3.092614064850718								99.7289972899729	Confident
3571	P61353	KVTAAMGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.30 min, Period: 1, Cycle(s): 4828 (Experiment 1)	4828	17.716	403.233978	2+	2+	804.4527592960801	0	0.7982596271106717								100.0	Confident
3572	Q15056	AYSSFGGGR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13836 (Experiment 1)	13836	34.997	491.195007	2+	2+	980.3753104285499	0	0.1533381315438663	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.03069466882067)	Y2	1		0	99.74293059125964	Confident
3573	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	DLTDYLMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44228 (Experiment 1)	44228	74.654	499.746979	2+	2+	997.4790336135702	0	0.37164100990059645								100.0	Confident
3574	P51571	VQNMALYADVGGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31279 (Experiment 1)	31279	57.212	723.830078	2+	2+	1444.6421664479103	1	0.05653080255524038	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.72972972972973	Confident
3575	Q13435	LAEIGAPIQGNREELVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30015 (Experiment 1)	30015	55.748	665.360657	3+	3+	1993.0592527101205	0	0.44531730263749686								100.0	Confident
3576	P11586	YVVVTGITPTPLGEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39271 (Experiment 1)	39271	66.72	815.957825	2+	2+	1629.8977732760904	0	2.0367456216483393								100.0	Confident
3577	P60228	VLVPATDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16838 (Experiment 1)	16838	39.38	435.7565	2+	2+	869.4970666362101	0	1.5839492383409899								99.7289972899729	Confident
3578	Q06830	KQGGLGPMNIPLVSDPKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33515 (Experiment 1)	33515	59.79	477.518005	4+	4+	1906.0458515754503	0	-1.537867761102057								100.0	Doubtful
3579	Q08211	AAECNIVVTQPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20430 (Experiment 1)	20430	44.046	679.349182	2+	2+	1356.6819839367602	0	1.3447665215846945								100.0	Confident
3580	P06576	IMNVIGEPIDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36441 (Experiment 1)	36441	63.266	693.358093	2+	2+	1384.702050675	0	-0.30114922036772457								100.0	Confident
3581	P27105, Q8TAV4	LLAQTTLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21227 (Experiment 1)	21227	45.039	458.284973	2+	2+	914.5549158655001	0	0.5206379790937562								99.23273657289002	Confident
3582	P07900	YYTSASGDEMVSLKDYCTR		Carbamidomethylation of C(17)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32579 (Experiment 1)	32579	58.72	749.663818	3+	3+	2244.96673441788	1	-0.2066986121979626								92.80575539568345	Doubtful
3583	Q92841	VLEEANQAINPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19974 (Experiment 1)	19974	43.515	663.355774	2+	2+	1324.69867954672	0	-1.269664237153177								100.0	Confident
3584	P09651, P22626, Q32P51	KIFVGGIKEDTEEHHLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17588 (Experiment 1)	17588	40.407	502.770874	4+	4+	2007.0537734068607	0	0.30666358782783887								100.0	Doubtful
3585	P48735	YFDLGLPNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41712 (Experiment 1)	41712	70.24	547.7854	2+	2+	1093.5556441414901	0	0.5503297618967978								99.45652173913044	Confident
3586	P29350	GQESEYGNITYPPAMK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33490 (Experiment 1)	33490	59.761	932.895752	2+	2+	1863.7750310922602	0	1.0290410730910504	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 39.26701570680628)		0	Y6-{Y6 Y11}	1	100.0	Confident
3587	P30050	IGPLGLSPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30696 (Experiment 1)	30696	56.532	441.276428	2+	2+	880.5382031722002	0	0.11318776725260019								100.0	Confident
3588	P60174	VPADTEVVCAPPTAYIDFAR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45298 (Experiment 1)	45298	77.216	731.362	3+	3+	2191.0619551320606	0	1.0097460811316021								94.73684210526316	Confident
3589	P08238, P14625, Q58FF6, Q58FF7, Q58FF8	ELISNASDALDKIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35966 (Experiment 1)	35966	62.669	515.61377	3+	3+	1543.8205855845501	0	-0.7143487761967675								100.0	Confident
3590	P11142, P54652	VQVEYKGETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9948 (Experiment 1)	9948	28.454	394.212006	3+	3+	1179.6135529404303	0	0.5374937560143204								100.0	Confident
3591	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32384 (Experiment 1)	32384	58.494	565.800171	2+	2+	1129.58800689893	0	-1.95990415087072								100.0	Confident
3592	P04843	VTAEVVLAHLGGGSTSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36589 (Experiment 1)	36589	63.434	551.968384	3+	3+	1652.8845828234403	0	-0.7610477662257749								100.0	Confident
3593	Q9Y224	KLTALDYHNPAGFNCKDETEFR	Phosphorylation of Y(7)	Carbamidomethylation of C(15)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30320 (Experiment 1)	30320	56.1	677.30719	4+	4+	2705.1945161141102	0	1.8964911570085243	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Doubtful
3594	P23396	TEIIILATR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38150 (Experiment 1)	38150	65.319	515.319397	2+	2+	1028.6229954253204	0	1.20861214248518								99.73262032085562	Confident
3595	P27695	EGYSGVGLLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33491 (Experiment 1)	33491	59.762	569.298218	2+	2+	1136.58258716532	0	-0.6183916324753402								100.0	Confident
3596	P61604	VLLPEYGGTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29773 (Experiment 1)	29773	55.465	538.803345	2+	2+	1075.59136094387	0	0.7202285138242857								100.0	Confident
3597	P61158	DYEEIGPSICR	Phosphorylation of Y(2)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31251 (Experiment 1)	31251	57.178	709.786865	2+	2+	1417.5584963936	0	0.4794911936132063	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3598	P23284	DKPLKDVIIADCGK		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22913 (Experiment 1)	22913	47.338	524.620544	3+	3+	1570.8388785009802	0	0.5871539833846736								100.0	Confident
3599	P26373	VATWFNQPAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33671 (Experiment 1)	33671	59.967	595.309937	2+	2+	1188.6039913162404	0	1.1168565632585106								100.0	Confident
3600	P07437	ISVYYNEATGGK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26478 (Experiment 1)	26478	51.624	691.30603	2+	2+	1380.5962618013102	0	0.9006620317822058	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (4: 0.0)		0	Y4-{Y4 Y5}	1	100.0	Confident
3601	P98179	YYDSRPGGYGYGYGR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22677 (Experiment 1)	22677	47.064	604.24469	3+	3+	1809.7148137942	0	-1.4195082588068222	Phosphorylation of Y (2: Random)	Phosphorylation of Y (9: 0.0, 11: 0.0)	Phosphorylation of Y (2: 34.26939552594003)		0	Y2-{Y1 Y2 Y9 Y11 Y13}	1	91.7910447761194	Doubtful
3602	Q7L1Q6	DINAVAASLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35798 (Experiment 1)	35798	62.463	515.288757	2+	2+	1028.5614577979202	0	1.4586682011629313								100.0	Confident
3603	P30626	LSPQAVNSIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21212 (Experiment 1)	21212	45.019	564.324158	2+	2+	1126.6346227381805	0	-0.7616820382715553								99.46949602122017	Confident
3604	Q16181	DVTNNVHYENYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18590 (Experiment 1)	18590	41.782	535.224365	3+	3+	1602.6463998812103	0	3.0303385625952726	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 7.329830238079078)	Phosphorylation of Y (11: 0.0)		0	Y8-{Y8 Y11}	1	99.28057553956835	Confident
3605	P60709, P62736, P63261, P63267, P68032, P68133, Q562R1	HQGVMVGMGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13241 (Experiment 1)	13241	34.065	586.790894	2+	2+	1170.56378338038	1	0.0825942221973903								100.0	Confident
3606	O75347	QAEILQESR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17507 (Experiment 1)	17507	40.299	537.284729	2+	2+	1072.5512870370403	0	3.366968501049111								99.7289972899729	Confident
3607	Q9BZK7	HQEPVYSVAFSPDGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29174 (Experiment 1)	29174	54.776	590.26178	3+	3+	1767.7617639866203	0	0.9863503085699935	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3608	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36952 (Experiment 1)	36952	63.872	630.796997	2+	2+	1259.5798834611805	0	-0.3506632495040093	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
3609	P35232	IFTSIGEDYDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33925 (Experiment 1)	33925	60.263	722.840027	2+	2+	1443.65178892395	0	9.484998044608044								100.0	Doubtful
3610	P11142	NSLESYAFNMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39016 (Experiment 1)	39016	66.377	652.30365	2+	2+	1302.5914375968603	0	1.003727964607942								100.0	Confident
3611	A8MTJ3, P04899, P08754, P11488, P19087, P38405, P63092, P63096, Q5JWF2	MFDVGGQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23494 (Experiment 1)	23494	48.053	455.217041	2+	2+	908.4174364165201	0	2.2985240857597447								98.91598915989161	Confident
3612	P16298, Q08209	LFEVGGSPANTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27040 (Experiment 1)	27040	52.273	624.321777	2+	2+	1246.6305999869003	0	-1.2805243512856765								99.7289972899729	Confident
3613	P36578	KLDELYGTWR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34093 (Experiment 1)	34093	60.467	454.215027	3+	3+	1359.6224169795003	0	0.6125003397110091	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
3614	Q08211	YTQVGPDHNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7068 (Experiment 1)	7068	22.46	396.190582	3+	3+	1185.5526840193702	0	-2.3283519668804282								99.28057553956835	Confident
3615	P07948, P08631	VIEDNEYTAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16123 (Experiment 1)	16123	38.499	605.29071	2+	2+	1208.5673310240002	0	-0.38325174899918557								99.73753280839895	Confident
3616	P11310	IYQIYEGTSQIQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31035 (Experiment 1)	31035	56.927	839.897034	2+	2+	1677.7763514216003	0	1.8833562958570642	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 26.63435965086682)	Phosphorylation of Y (2: 67.07428696957494)		0	Y2-{Y2 Y5}	1	100.0	Confident
3617	P41252	APLKPYPVSPSDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17330 (Experiment 1)	17330	40.054	466.92569	3+	3+	1397.7554661468503	0	-0.16101580671964277								98.7012987012987	Confident
3618	P23193	IGMSVNAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27301 (Experiment 1)	27301	52.575	480.768463	2+	2+	959.5222358382302	0	0.14271751994730408								100.0	Confident
3619	B2RPK0, P09429, P26583	MSSYAFFVQTCR	Phosphorylation of Y(4)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43271 (Experiment 1)	43271	72.92	788.82019	2+	2+	1575.6251364847806	0	0.4377308709763462	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
3620	P07237	LITLEEEMTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37006 (Experiment 1)	37006	63.937	603.818237	2+	2+	1205.6213407428106	0	0.4805451445956097								96.7479674796748	Confident
3621	P00558	AHSSMVGVNLPQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20442 (Experiment 1)	20442	44.064	684.3573	2+	2+	1366.7027193813403	0	-1.9524229134165567								100.0	Confident
3622	P62942	GWEEGVAQMSVGQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36144 (Experiment 1)	36144	62.907	767.35553	2+	2+	1532.7041759333201	0	-4.9969201521690145								100.0	Doubtful
3623	P62263	ADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38070 (Experiment 1)	38070	65.223	782.346191	3+	3+	2344.0154891229804	0	0.5344936671003672	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3624	P06744	SNTPILVDGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21050 (Experiment 1)	21050	44.789	522.291382	2+	2+	1042.5658744720201	0	2.236873575655856								96.19565217391303	Confident
3625	P15880	SPYQEFTDHLVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35978 (Experiment 1)	35978	62.683	488.576874	3+	3+	1462.7092442304206	0	-0.3081266848617317								100.0	Confident
3626	Q16881	KVVYENAYGQFIGPHR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26235 (Experiment 1)	26235	51.346	490.239075	4+	4+	1956.9247469907903	0	1.2479344978831644	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 5.742056009221643)	Phosphorylation of Y (8: 0.17512709613779498)		0	Y8-{Y4 Y8}	1	100.0	Doubtful
3627	Q02790	MEKGEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35191 (Experiment 1)	35191	61.741	627.558228	4+	4+	2506.1967479602404	0	2.8117679134396676	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 7.9188738538873675)	Phosphorylation of Y (10: 68.760907504363)		0	Y10-{Y10 Y15}	1	100.0	Doubtful
3628	P30101	GFPTIYFSPANK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45617 (Experiment 1)	45617	77.932	711.328918	2+	2+	1420.6428180709106	0	0.32684993225573905	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3629	P62318	VLHEAEGHIVTCETNTGEVYR	Phosphorylation of Y(20)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20262 (Experiment 1)	20262	43.856	832.038208	3+	3+	2493.0995531001104	0	-2.7076009179363076	Phosphorylation of Y (20: Very Confident)	Phosphorylation of Y (20: 100.0)	Phosphorylation of Y (20: 100.0)	Y20	1		0	100.0	Confident
3630	Q9UI08	INIYHNTASNTFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23173 (Experiment 1)	23173	47.651	815.871399	2+	2+	1629.7300699355208	0	-1.1183546244527673	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.73045822102425	Confident
3631	P30101	YGVSGYPTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29019 (Experiment 1)	29019	54.599	542.787048	2+	2+	1083.5600608155903	0	-0.47693563191165755								100.0	Confident
3632	P07910	VPPPPPIAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19355 (Experiment 1)	19355	42.731	472.290314	2+	2+	942.5650866263802	0	1.0464337304394309								99.1869918699187	Confident
3633	Q02790	RGEAHLAVNDFELAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29439 (Experiment 1)	29439	55.08	425.223297	4+	4+	1696.8645160852006	0	-0.2551320335978008								100.0	Doubtful
3634	P42704	TVLDQQQTPSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13723 (Experiment 1)	13723	34.83	636.831055	2+	2+	1271.6469783270302	0	0.45439022177496996								100.0	Confident
3635	P62826	HLTGEFEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11457 (Experiment 1)	11457	31.261	480.742859	2+	2+	959.4712458111903	0	-0.08397920627868666								99.73045822102425	Confident
3636	Q16851	LVEIAQVPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27644 (Experiment 1)	27644	52.989	498.808411	2+	2+	995.6015317047502	0	0.7391236340372399								99.7289972899729	Confident
3637	P31943, P55795	DLNYCFSGMSDHR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31899 (Experiment 1)	31899	57.943	841.310913	2+	2+	1680.6061919453502	0	0.642522106632615	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
3638	P31943, P55795	DLNYCFSGMSDHR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31846 (Experiment 1)	31846	57.881	561.210266	3+	3+	1680.6061919453502	0	1.6492088387100508	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3639	P13639	KEDLYLKPIQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23099 (Experiment 1)	23099	47.566	494.928253	3+	3+	1481.7643301859202	0	-0.9432916296958698	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3640	Q92979	TYELLNCDK	Phosphorylation of Y(2)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26234 (Experiment 1)	26234	51.345	618.254272	2+	2+	1234.4941052318902	0	-0.09232892432975728	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82578397212544)	Y2	1		0	99.73118279569893	Confident
3641	P84103	AFGYYGPLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43878 (Experiment 1)	43878	73.925	562.25116	2+	2+	1122.4899462579701	0	-1.9379127391572948	Phosphorylation of Y (5: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (5: 26.375718522315385)		0	Y5-{Y4 Y5}	1	99.72826086956522	Confident
3642	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23768 (Experiment 1)	23768	48.409	420.234863	3+	3+	1257.68296991293	0	-0.1668220555314557								99.28057553956835	Confident
3643	P84098	LLADQAEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14011 (Experiment 1)	14011	35.304	493.767609	2+	2+	985.5192586327703	0	1.4241877992502625								99.73190348525469	Confident
3644	Q14204	EYQTQLIQR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21962 (Experiment 1)	21962	46.179	629.794373	2+	2+	1257.5754667870801	0	-1.0112184793731698	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	99.73118279569893	Confident
3645	E9PAV3, Q13765	SPASDTYIVFGEAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40283 (Experiment 1)	40283	68.152	782.850342	2+	2+	1563.6858050817007	0	0.2082037430929094	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3646	Q96AE4	IQIAPDSGGLPER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28425 (Experiment 1)	28425	53.907	676.862427	2+	2+	1351.70957858359	0	0.533700160254993								99.7289972899729	Confident
3647	Q01518	LSDLLAPISEQIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44640 (Experiment 1)	44640	75.758	713.910706	2+	2+	1425.8078956425304	0	-0.7259839313921059								100.0	Confident
3648	Q9BVL2	TPPGLQHEYAAPADYFR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37007 (Experiment 1)	37007	63.938	671.968689	3+	3+	2011.8829417484606	1	-1.0218779199857786	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.269214828136036)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y9 Y15}	1	100.0	Confident
3649	P01111, P01112, P01116, P61224, P62834	YDPTIEDSYRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18753 (Experiment 1)	18753	41.989	462.889069	3+	3+	1385.6463096206903	0	-0.6711618853750756								100.0	Confident
3650	P62899	EMGTPDVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14269 (Experiment 1)	14269	35.694	452.714111	2+	2+	903.4120166829102	0	1.8249778847915326								96.24664879356568	Confident
3651	P23246	AELDDTPMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 19960 (Experiment 1)	19960	43.5	524.241577	2+	2+	1046.4702598350202	0	-1.5820626337610466								100.0	Confident
3652	P28340	VSANSVYGFTGAQVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32546 (Experiment 1)	32546	58.683	832.887573	2+	2+	1663.7607013574602	0	-0.06500942077099682	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3653	P62081	VETFSGVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24911 (Experiment 1)	24911	49.803	555.249695	2+	2+	1108.4841921711902	0	0.5807257220506211	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 98.86914378029078)	Y8	1		0	99.7289972899729	Confident
3654	O94903	DLPAIQPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25637 (Experiment 1)	25637	50.656	455.261536	2+	2+	908.5079656730802	0	0.6077755184773406								99.46380697050938	Confident
3655	P37840	TKEQVTNVGGAVVTGVTAVAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35043 (Experiment 1)	35043	61.572	719.733276	3+	3+	2156.1800961187905	0	-0.9714326399049845								100.0	Confident
3656	P11142, P54652	VQVEYKGETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9950 (Experiment 1)	9950	28.459	590.813599	2+	2+	1179.6135529404303	0	-0.76832469539783								100.0	Confident
3657	P18615	SLYESFVSSSDR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37818 (Experiment 1)	37818	64.913	728.805542	2+	2+	1455.5919046968604	0	3.173949656381466	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.03069466882067)	Y3	1		0	99.72826086956522	Confident
3658	P63244	DVLSVAFSSDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41489 (Experiment 1)	41489	69.885	655.323242	2+	2+	1308.6309939097205	0	0.7150344025041726								92.73182957393485	Confident
3659	P29401	TSRPENAIIYNNNEDFQVGQAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32271 (Experiment 1)	32271	58.364	863.730408	3+	3+	2587.17040954125	1	-1.6870483281071853	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3660	P51610	LVIYGGMSGCR	Phosphorylation of Y(4)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30314 (Experiment 1)	30314	56.094	646.780273	2+	2+	1291.5454296121	0	0.4355841889337802	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 70.92084006462036)	Y4	1		0	91.37466307277629	Confident
3661	P60709, P63261	VAPEEHPVLLTEAPLNPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33678 (Experiment 1)	33678	59.975	652.027283	3+	3+	1953.0571274518006	0	1.4785434673654096								100.0	Confident
3662	P68104, Q5VTE0	YYVTIIDAPGHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31521 (Experiment 1)	31521	57.495	468.913727	3+	3+	1403.71974934447	0	-0.28274198476401585								100.0	Confident
3663	P07900	DNSTMGYMAAK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20439 (Experiment 1)	20439	44.061	634.739197	2+	2+	1267.4614252046204	0	1.9030385742496339	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3664	P04406	VVDLMAHMASK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27633 (Experiment 1)	27633	52.976	401.20694	3+	3+	1200.5995001827605	0	-0.42337501336910593								100.0	Confident
3665	P33991	DYIAYAHSTIMPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35036 (Experiment 1)	35036	61.566	539.908569	3+	3+	1616.7058293336302	0	-1.2049766857857163	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 10.453282433761643)	Phosphorylation of Y (5: 0.17452006980802792)		0	Y5-{Y2 Y5}	1	100.0	Confident
3666	ALDOA_RABIT, P04075	ALQASALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14490 (Experiment 1)	14490	36.041	401.244232	2+	2+	800.4756029156401	0	-2.1082492435609472								98.94179894179894	Confident
3667	P23284	VIFGLFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.33 min, Period: 1, Cycle(s): 46656 (Experiment 1)	46656	79.811	440.767914	2+	2+	879.5218248320703	0	-0.6236449317326858								99.21875	Confident
3668	P09874	KPPLLNNADSVQAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17155 (Experiment 1)	17155	39.8	498.946198	3+	3+	1493.8201916617304	0	-2.289528299103212								100.0	Confident
3669	Q02543	DLTTAGAVTQCYR		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27745 (Experiment 1)	27745	53.109	728.3479	2+	2+	1454.6823778595804	0	-0.7762721130486676								99.45945945945947	Confident
3670	P07900, P08238, Q58FF6, Q58FF7	EDQTEYLEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21737 (Experiment 1)	21737	45.866	656.287781	2+	2+	1310.5626395663803	0	-1.2422126590217542								100.0	Confident
3671	P16401	ATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32451 (Experiment 1)	32451	58.572	606.845642	2+	2+	1211.6761531969903	0	0.47612573997055263								100.0	Confident
3672	P60709, P63261	KDLYANTVLSGGTTMYPGIADR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41442 (Experiment 1)	41442	69.814	808.382446	3+	3+	2422.1239769428003	0	0.6315730622869278	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 17.042304452848985)	Phosphorylation of Y (4: 80.87342413258644)		0	Y4-{Y4 Y16}	1	100.0	Confident
3673	Q14240	DQIYEIFQK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43281 (Experiment 1)	43281	72.94	632.287476	2+	2+	1262.5584197406104	0	1.5652127700049279	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 86.59127625201938)	Y4	1		0	97.86096256684492	Confident
3674	P67809	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20445 (Experiment 1)	20445	44.067	826.878662	4+	4+	3302.4888006228407	1	-2.000088333483961	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Doubtful
3675	P62277	GLSQSALPYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25461 (Experiment 1)	25461	50.45	546.295715	2+	2+	1090.57710786206	0	-0.2112369081291732								100.0	Confident
3676	Q13263	IVAERPGTNSTGPAPMAPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19054 (Experiment 1)	19054	42.356	673.687073	3+	3+	2018.0367434437303	0	1.309292006334516								100.0	Confident
3677	P63104	GIVDQSQQAYQEAFEISKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40939 (Experiment 1)	40939	69.086	723.700012	3+	3+	2168.0749623439106	0	1.4942934214145345								100.0	Confident
3678	P33316	TDIQIALPSGCYGR		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39105 (Experiment 1)	39105	66.491	775.885071	2+	2+	1549.75587715301	0	-0.18565029241090664								99.7289972899729	Confident
3679	P11142	SFYPEEVSSMVLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45071 (Experiment 1)	45071	76.73	808.898499	2+	2+	1615.7803605653505	0	1.2884828651468572								100.0	Confident
3680	P04406	RVIISAPSADAPMFVMGVNHEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38517 (Experiment 1)	38517	65.773	790.410828	3+	3+	2368.20315714583	0	3.161848317352973								97.76119402985076	Confident
3681	P04406	VPTANVSVVDLTCR		Carbamidomethylation of C(13)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36149 (Experiment 1)	36149	62.914	765.901123	2+	2+	1529.7871772812903	0	0.3367179154978354								100.0	Confident
3682	P05204, Q15651	LSAKPAPPKPEPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7634 (Experiment 1)	7634	23.748	453.937927	3+	3+	1358.7921860087404	0	-0.17213009537656954								100.0	Confident
3683	P61978	VVLIGGKPDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16041 (Experiment 1)	16041	38.396	527.324585	2+	2+	1052.63422881536	0	0.3681329959428505								96.48648648648648	Confident
3684	Q9BZZ5	PTVEELYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27073 (Experiment 1)	27073	52.311	503.762665	2+	2+	1005.5131106231702	0	-2.3161218083125936								99.73753280839895	Confident
3685	Q13283	FYVHNDIFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33214 (Experiment 1)	33214	59.44	404.204895	3+	3+	1209.5930922793702	0	-0.1951813406984206								100.0	Confident
3686	Q9Y2W1	WEGLVYAPPGK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40182 (Experiment 1)	40182	67.989	648.803894	2+	2+	1295.5951396025002	0	-1.4677264938077796	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 96.50959860383944)	Y6	1		0	99.21052631578947	Confident
3687	Q13200	LNILDTLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43366 (Experiment 1)	43366	73.078	508.803314	2+	2+	1015.5913609438703	0	0.7017672519691946								96.2059620596206	Confident
3688	P31939	TLTPISAAYAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29730 (Experiment 1)	29730	55.416	582.324951	2+	2+	1162.6346227381803	0	0.6236454812906694								100.0	Confident
3689	P36578	KLDELYGTWR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33924 (Experiment 1)	33924	60.261	680.81842	2+	2+	1359.6224169795003	0	-0.09540951617873837	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3690	GSTP1_HUMAN, P09211	PPYTVVYFPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43842 (Experiment 1)	43842	73.858	669.366638	2+	2+	1336.7179584393202	0	0.571157456074267								97.289972899729	Confident
3691	P23284	TVDNFVALATGEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42487 (Experiment 1)	42487	71.467	682.857178	2+	2+	1363.6983451935505	0	1.067481186794047								100.0	Confident
3692	Q9NRZ9	EVVVYAPLSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31863 (Experiment 1)	31863	57.902	592.802307	2+	2+	1183.5889915929004	0	0.9020498298263064	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3693	P16989, P67809, Q9Y2T7	NGYGFINR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26326 (Experiment 1)	26326	51.45	470.735382	2+	2+	939.4562644533903	0	-0.056705968156238136								99.73474801061008	Confident
3694	P38919	GFKEQIYDVYR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34777 (Experiment 1)	34777	61.26	499.89679	3+	3+	1496.6700954479102	0	-1.0367785011791733	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 5.668272110935822)	Phosphorylation of Y (7: 99.82547993019197)		0	Y10-{Y7 Y10}	1	99.28057553956835	Confident
3695	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13321 (Experiment 1)	13321	34.19	600.786926	2+	2+	1199.5587540937802	0	0.45354918628356355	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3696	P61604	GKGGEIQPVSVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12114 (Experiment 1)	12114	32.297	599.843201	2+	2+	1197.6717365228903	0	0.0938107624849624								96.7479674796748	Confident
3697	Q01130	VDNLTYRTSPDTLRR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20501 (Experiment 1)	20501	44.131	629.6427	3+	3+	1885.9047398222	0	0.8103953794237182	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.47643979057592)	Y6	1		0	99.24812030075188	Confident
3698	Q15233	AGEVFIHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14178 (Experiment 1)	14178	35.57	450.750793	2+	2+	899.4865019525103	0	0.5891439204932306								92.41192411924119	Confident
3699	Q9NUU7, Q9UMR2	QYYVLCSSR	Phosphorylation of Y(2)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27981 (Experiment 1)	27981	53.38	628.262817	2+	2+	1254.5104240023702	0	0.5229215636750882	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 2.4432809773123907)		0	Y2-{Y2 Y3}	1	100.0	Confident
3700	Q15631	KVEEVVYDLSIR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39708 (Experiment 1)	39708	67.334	765.385132	2+	2+	1528.75382507187	0	1.2320573986594936	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3701	P07437	ISVYYNEATGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24388 (Experiment 1)	24388	49.196	651.321777	2+	2+	1300.6299312805602	0	-0.7140967436694845								100.0	Confident
3702	P39748	LIADVAPSAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31000 (Experiment 1)	31000	56.885	563.335266	2+	2+	1124.6553581827602	0	0.5510785453773286								99.73333333333333	Confident
3703	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13480 (Experiment 1)	13480	34.445	600.786621	2+	2+	1199.5587540937802	0	-0.05411854941256697	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3704	Q00839	MCLFAGFQR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44051 (Experiment 1)	44051	74.245	565.267456	2+	2+	1128.5208559392402	0	-0.4395022573666039								99.7289972899729	Confident
3705	Q9UKY7	LQLDNQYAVLENQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34537 (Experiment 1)	34537	60.986	878.419434	2+	2+	1754.8240298900107	0	0.16232360103211707	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3706	P46781	IGVLDEGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21215 (Experiment 1)	21215	45.022	415.734558	2+	2+	829.4545331178902	0	0.03601876055211476								100.0	Confident
3707	P23528	KAVLFCLSEDKK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23331 (Experiment 1)	23331	47.852	479.930511	3+	3+	1436.7697363120003	0	-0.02272025830599559								100.0	Confident
3708	P62081	HVVFIAQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17256 (Experiment 1)	17256	39.949	485.285126	2+	2+	968.5555845718402	0	0.11796626687786012								94.87870619946092	Confident
3709	O15143	NAYVWTLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38193 (Experiment 1)	38193	65.372	497.770813	2+	2+	993.5283667644903	0	-1.299490045781242								96.24664879356568	Confident
3710	P18077	NNTVTPGGKPNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.29 min, Period: 1, Cycle(s): 4664 (Experiment 1)	4664	17.41	613.829224	2+	2+	1225.6414990237702	0	1.951721413971088								99.45652173913044	Confident
3711	P78527	SIGEYDVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33219 (Experiment 1)	33219	59.447	526.273621	2+	2+	1050.5345743437401	0	-1.7911537954126209								99.7289972899729	Confident
3712	P51571	VQNMALYADVGGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31286 (Experiment 1)	31286	57.22	723.327942	2+	2+	1444.6421664479103	0	-0.5774566441723994	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3713	P62191, P62195, Q8NB90	GVLLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34106 (Experiment 1)	34106	60.482	619.812744	2+	2+	1237.6107896666401	0	0.11729329066823704	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.86914378029078)	Y5	1		0	99.73190348525469	Confident
3714	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29686 (Experiment 1)	29686	55.365	609.260315	2+	2+	1216.5053215385904	0	0.6200373102765451	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.33452891645359)	Phosphorylation of Y (8: 3.4904013961605584)		0	Y8-{Y3 Y6 Y8}	1	99.7289972899729	Confident
3715	P07900	RAPFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39830 (Experiment 1)	39830	67.498	422.218933	3+	3+	1263.6360197205104	0	-0.8290486236467527								100.0	Confident
3716	P00519	AGSGAPGGTSKGPAEESR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6072 (Experiment 1)	6072	20.239	539.259827	3+	3+	1614.7597762331402	0	-1.31330061417066								100.0	Confident
3717	P38919	ELAVQIQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21374 (Experiment 1)	21374	45.259	464.776611	2+	2+	927.5389314481902	0	-0.28226650589813496								98.91304347826086	Confident
3718	O00299	YLSNAYAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16472 (Experiment 1)	16472	38.925	479.243805	2+	2+	956.4715801643601	0	1.5408694658715354								100.0	Confident
3719	P78347	SPSWYGIPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38194 (Experiment 1)	38194	65.373	571.755005	2+	2+	1141.4957599144	0	-0.26484065840559723	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.73262032085562	Confident
3720	P26373	LATQLTGPVMPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35553 (Experiment 1)	35553	62.16	691.895203	2+	2+	1381.7751560456102	0	0.5037042559523841								92.93478260869566	Confident
3721	O15042	KPGQSFQEQVEHYR	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20110 (Experiment 1)	20110	43.682	604.941162	3+	3+	1811.7992121245006	0	1.3469510255971877	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 90.14539579967689)	Y13	1		0	96.2406015037594	Confident
3722	P06748	VDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17150 (Experiment 1)	17150	39.793	784.867371	2+	2+	1567.7226624484301	0	-1.5756663153169361								96.22641509433963	Confident
3723	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30412 (Experiment 1)	30412	56.205	528.263245	2+	2+	1054.5100129962104	0	1.8211314979635536	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	99.73190348525469	Confident
3724	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4, 9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20500 (Experiment 1)	20500	44.13	713.290833	2+	2+	1424.5666150733405	0	0.3490814589397616	Phosphorylation of Y (4: Doubtfull, 9: Doubtfull)		Phosphorylation of Y (4: 51.169289697222375, 9: 31.82552504038772)		0	Y4-{Y4}, Y9-{Y9}	2	99.73890339425587	Confident
3725	O76021	KKVPVSVNLLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20441 (Experiment 1)	20441	44.063	437.950653	3+	3+	1310.8285715174604	0	1.185890039229302								99.43181818181817	Confident
3726	P51659	IIMTSSASGIYGNFGQANYSAAK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40186 (Experiment 1)	40186	67.993	811.038757	3+	3+	2430.092676814521	0	0.7253193544034502	Phosphorylation of Y (11: Random)	Phosphorylation of Y (11: 0.0, 19: 0.0)	Phosphorylation of Y (11: 99.82547993019197)		0	Y11-{Y11 Y19}	1	99.28057553956835	Confident
3727	Q13356	HYYDGTIFHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23764 (Experiment 1)	23764	48.402	463.530396	3+	3+	1387.5710501129804	0	-1.2163972945499657	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 3: 0.0)	Phosphorylation of Y (2: 6.457242582897034)		0	Y2-{Y2 Y3}	1	99.24812030075188	Confident
3728	P48047	LVRPPVQVYGIEGR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33583 (Experiment 1)	33583	59.866	554.962891	3+	3+	1661.8654412095202	0	0.8423333330683915	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3729	Q14697	SGGMERPFVLAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28108 (Experiment 1)	28108	53.526	440.568848	3+	3+	1318.6815900139402	0	2.364059574926566								100.0	Confident
3730	P08621	EFEVYGPIKR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29685 (Experiment 1)	29685	55.363	439.879395	3+	3+	1316.6166033230702	0	-0.18772074234674704	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3731	P62424	MGVPYCIIK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37821 (Experiment 1)	37821	64.916	540.783142	2+	2+	1079.55075908519	0	0.8986800658118649								99.46091644204851	Confident
3732	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHRK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12375 (Experiment 1)	12375	32.756	575.592896	3+	3+	1723.7566786061805	0	0.10423652067658214	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3733	Q08170, Q13243, Q13247	LIVENLSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27122 (Experiment 1)	27122	52.367	515.798462	2+	2+	1029.58185888933	0	0.4964897510798244								99.73333333333333	Confident
3734	P11021	SDIDEIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41540 (Experiment 1)	41540	69.97	730.884033	2+	2+	1459.7518373183902	0	1.1463856310252667								99.46091644204851	Confident
3735	A0A0B4J2A2, F5H284, P0DN26, P62937, PPIA_HUMAN, Q9Y536	IIPGFMCQGGDFTR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42409 (Experiment 1)	42409	71.353	799.876709	2+	2+	1597.73811891389	0	0.4664174024822893								100.0	Confident
3736	P31930	ADLTEYLSTHYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35120 (Experiment 1)	35120	61.66	760.837341	2+	2+	1519.6595903338603	0	0.35403934414112614	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 11: 0.0)	Phosphorylation of Y (6: 84.99127399650959)		0	Y6-{Y6 Y11}	1	95.16129032258065	Confident
3737	P49327	LQVVDQPLPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32871 (Experiment 1)	32871	59.051	632.374878	2+	2+	1262.7346711326202	0	0.42058436999868376								100.0	Confident
3738	P07814	VAVQGDVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15106 (Experiment 1)	15106	37.015	471.772369	2+	2+	941.5294293936502	0	0.8008876534919547								92.63157894736842	Confident
3739	Q969Q0	GKDSLYAQGR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8898 (Experiment 1)	8898	26.444	587.766418	2+	2+	1173.5179519109602	0	0.28170672815446807	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
3740	P08238, Q58FF7	EQVANSAFVER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20717 (Experiment 1)	20717	44.377	625.313049	2+	2+	1248.6098645423203	0	1.3437479965926438								100.0	Confident
3741	P54725, P54727	DAFPVAGQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19950 (Experiment 1)	19950	43.487	466.746033	2+	2+	931.4763311916302	0	1.266080650654003								99.19354838709677	Confident
3742	P06753, P09493	MELQEIQLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36715 (Experiment 1)	36715	63.585	566.307983	2+	2+	1130.6005457285803	0	0.7657833598105006								99.45799457994579	Confident
3743	P06748	VDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17301 (Experiment 1)	17301	40.015	523.581421	3+	3+	1567.7226624484301	0	-0.14569452096594251								100.0	Confident
3744	P13639	YFDPANGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17908 (Experiment 1)	17908	40.821	456.215973	2+	2+	910.4184819623401	0	-1.193398224715869								100.0	Confident
3745	P10809	APGFGDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12065 (Experiment 1)	12065	32.216	417.199036	2+	2+	832.3827651599602	0	0.9035340832457126								99.46666666666667	Confident
3746	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21293 (Experiment 1)	21293	45.14	759.857849	2+	2+	1517.7014551458406	0	-0.2040377696074536	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3747	Q13242	DAEDAIYGR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18849 (Experiment 1)	18849	42.107	545.216187	2+	2+	1088.4175691633502	0	0.23101211026654875	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
3748	Q9Y2W1	SGKWEGLVYAPPGK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33133 (Experiment 1)	33133	59.349	523.588562	3+	3+	1567.7435947413403	0	0.1667074025625872	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
3749	P49736	VAVGELTDEDVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26965 (Experiment 1)	26965	52.187	637.827454	2+	2+	1273.6401616110904	0	0.1516517621833142								92.44791666666666	Confident
3750	P20700	ALYETELADAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30448 (Experiment 1)	30448	56.245	626.314087	2+	2+	1250.6142812164203	0	-0.5270116945246263								100.0	Confident
3751	O00139	GIYALAAR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27911 (Experiment 1)	27911	53.3	457.728027	2+	2+	913.4422677895602	0	-0.8375306915477497	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	99.73474801061008	Confident
3752	Q9BZ11	KYLELYIVADHTLFLTRHR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33374 (Experiment 1)	33374	59.626	617.824341	2+	4+	2467.27771559261	0	-3.8269063866302586	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.249656530390226)	Phosphorylation of Y (2: 99.67689822294022)		0	Y2-{Y2 Y6}	1	100.0	Doubtful
3753	P62316	NNTQVLINCR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19861 (Experiment 1)	19861	43.366	616.31311	2+	2+	1230.6139043769401	0	-1.8150729450548422								100.0	Confident
3754	P17844	TGTAYTFFTPNNIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42568 (Experiment 1)	42568	71.639	827.879761	2+	2+	1653.7439886641603	0	0.5921166589301159	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.72826086956522	Confident
3755	P14625	IYFMAGSSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34174 (Experiment 1)	34174	60.561	556.235229	2+	2+	1110.4569318775302	0	-0.9229999765210066	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3756	O95757, Q92598	DISTTLNADEAVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33512 (Experiment 1)	33512	59.787	738.370361	2+	2+	1474.7263508465403	0	-0.12309550305943244								99.45945945945947	Confident
3757	P27797	IDDPTDSKPEDWDKPEHIPDPDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27072 (Experiment 1)	27072	52.31	690.820923	4+	4+	2759.256233732661	0	-0.5962467521933305								100.0	Doubtful
3758	P28062	KGPGLYYVDEHGTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18446 (Experiment 1)	18446	41.598	531.267212	3+	3+	1590.7790551257403	0	0.4714979335749956								92.14285714285715	Doubtful
3759	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22980 (Experiment 1)	22980	47.421	673.307495	2+	2+	1344.6002845525904	0	0.11325716990921555	Phosphorylation of Y (7: Random)	Phosphorylation of Y (7: 0.0, 9: 0.0)	Phosphorylation of Y (7: 79.73431455106848)		0	Y9-{Y4 Y7 Y9}	1	98.91891891891892	Confident
3760	Q14165	FAEVYFAQSQQK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36391 (Experiment 1)	36391	63.206	763.340637	2+	2+	1524.6650100674706	0	1.1207321737812854	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.67689822294022)	Y5	1		0	100.0	Confident
3761	P05141	QIFLGGVDKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23760 (Experiment 1)	23760	48.398	566.82782	2+	2+	1131.6400424717901	0	0.9214399076210349								99.7289972899729	Confident
3762	P14866	IEYAKPTR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7790 (Experiment 1)	7790	24.044	529.25824	2+	2+	1056.5005109416702	0	1.3378408621524975	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 98.77835951134381)	Y3	1		0	99.73890339425587	Confident
3763	P59998	AENFFILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44059 (Experiment 1)	44059	74.258	505.2771	2+	2+	1008.53926580136	0	0.377283237233275								99.7289972899729	Confident
3764	Q92608	DQPDYAMYSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22737 (Experiment 1)	22737	47.134	663.248291	2+	2+	1324.4795177969102	0	1.8931629783331427	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 8: 0.0)	Phosphorylation of Y (5: 1.1308562197092082)		0	Y5-{Y5 Y8}	1	100.0	Confident
3765	Q08945	LFDFVNAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40855 (Experiment 1)	40855	68.962	477.257507	2+	2+	952.5018176634803	0	-1.4212402700251066								100.0	Confident
3766	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44362 (Experiment 1)	44362	75.046	612.980896	3+	3+	1835.9222873793005	0	-0.7769565825334487	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
3767	P14868	NNAYLAQSPQLYK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30537 (Experiment 1)	30537	56.348	795.874084	2+	2+	1588.7286729531904	1	0.9978199872788209	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 17.173160207314368)	Phosphorylation of Y (12: 100.0)		0	Y12-{Y4 Y12}	1	100.0	Confident
3768	P49368	AMTGVEQWPYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35558 (Experiment 1)	35558	62.165	669.319458	2+	2+	1336.6234064314801	0	0.7146330261562833								100.0	Confident
3769	P11586	TPVPSDIDISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28094 (Experiment 1)	28094	53.509	600.317322	2+	2+	1198.6193665968601	0	0.6034058374764454								100.0	Confident
3770	P11586	TDTESELDLISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 36977 (Experiment 1)	36977	63.9	689.839661	2+	2+	1377.6623536076502	0	1.7507423036394343								99.74811083123426	Confident
3771	Q02878	YYPTEDVPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22892 (Experiment 1)	22892	47.314	570.271729	2+	2+	1138.5294889633	0	-0.5119459684832731								100.0	Confident
3772	Q99497	VTTHPLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6240 (Experiment 1)	6240	20.569	433.758331	2+	2+	865.5021520166504	0	-0.049509449266754386								92.63157894736842	Confident
3773	O14602, P47813	EDGQEYAQVIK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21565 (Experiment 1)	21565	45.579	680.295471	2+	2+	1358.5755263567305	0	0.6340702159457344	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
3774	P31949	DGYNYTLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23367 (Experiment 1)	23367	47.896	530.751343	2+	2+	1059.4872897981504	0	0.7944105149271261								100.0	Confident
3775	P62241	IIDVVYNASNNELVR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41445 (Experiment 1)	41445	69.819	600.296021	3+	3+	1797.8662290551604	0	0.0025234236454407893	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3776	P52565	AEEYEFLTPVEEAPK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42807 (Experiment 1)	42807	72.089	916.404114	2+	2+	1830.7964777294908	0	-1.529160981653959	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3777	P23193	LLDGPSTEKDLDEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20358 (Experiment 1)	20358	43.961	520.598938	3+	3+	1558.7726323326203	0	1.506130928956847								92.46575342465754	Doubtful
3778	P80303	ELDLVSHHVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17426 (Experiment 1)	17426	40.191	402.217865	3+	3+	1203.6360197205104	0	-3.5255403588265017								100.0	Confident
3779	Q9NR30	STYEQVDLIGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32972 (Experiment 1)	32972	59.163	666.806641	2+	2+	1331.6010128285802	0	-1.712459169623835	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
3780	P62873, P62879	IYAMHWGTDSR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30826 (Experiment 1)	30826	56.681	708.791809	2+	2+	1415.5693358608203	0	-0.19102534013858014	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
3781	Q9NV31	LYALGLVPTR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44246 (Experiment 1)	44246	74.709	591.817871	2+	2+	1181.6209604275202	0	0.19316660659419316	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.65095986038395)	Y2	1		0	100.0	Confident
3782	P35579, P35580, P35749, Q7Z406	KFDQLLAEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25111 (Experiment 1)	25111	50.038	610.82959	2+	2+	1219.6448530687105	0	-0.18499618915603042								99.1869918699187	Confident
3783	O60361, P22392	SCAHDWVYE		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28660 (Experiment 1)	28660	54.181	583.731323	2+	2+	1165.4498587436103	0	-1.5124034761621603								97.59358288770053	Confident
3784	Q15233	AAPGAEFAPNKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13481 (Experiment 1)	13481	34.448	614.823181	2+	2+	1227.6360197205101	0	-3.424268835374594								99.21052631578947	Confident
3785	P53621	GHYNNVSCAVFHPR	Phosphorylation of Y(3)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20788 (Experiment 1)	20788	44.46	579.914917	3+	3+	1736.7242733624303	0	-0.776988587170072	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3786	P26599	VLFSSNGGVVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27982 (Experiment 1)	27982	53.381	553.812683	2+	2+	1105.6131590176103	0	-2.1179961544494357								92.7807486631016	Confident
3787	Q16698	FNVIQPGPIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33303 (Experiment 1)	33303	59.543	556.826111	2+	2+	1111.63897984263	0	-1.1770054291645062								99.45945945945947	Confident
3788	P23193	DTYVSSFPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29259 (Experiment 1)	29259	54.872	536.258728	2+	2+	1070.5032742154601	0	-0.3460540000693586								99.7289972899729	Confident
3789	A6NHL2, P68363, P68366, Q13748, Q71U36, Q9BQE3, Q9NY65	LDHKFDLMYAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27675 (Experiment 1)	27675	53.025	460.903992	3+	3+	1379.6907577153104	0	-0.4419687446798827								100.0	Confident
3790	P23528, Q9Y281	YALYDATYETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31127 (Experiment 1)	31127	57.035	669.316345	2+	2+	1336.6186978905205	0	-0.41895279709225886								100.0	Confident
3791	O00567	VVSLSEYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22257 (Experiment 1)	22257	46.553	516.743042	2+	2+	1031.4688764602201	0	2.5686005988106073	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3792	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	KESYSIYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24786 (Experiment 1)	24786	49.659	680.31543	2+	2+	1358.6159346167303	0	0.27373313248418457	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 23.31525159244004)	Phosphorylation of Y (4: 0.16142060555526605)		0	Y4-{Y4 Y7 Y9}	1	100.0	Confident
3793	P00505	IAAAILNTPDLRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30018 (Experiment 1)	30018	55.751	465.948975	3+	3+	1394.8245487661802	0	0.3911970531588822								99.24812030075188	Confident
3794	P52272	GGNRFEPYANPTKR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14413 (Experiment 1)	14413	35.924	562.929993	3+	3+	1685.7675180734002	0	0.3739520057135596	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3795	P47756	DYLLCDYNR	Phosphorylation of Y(2)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37254 (Experiment 1)	37254	64.228	656.256836	2+	2+	1310.5002532414903	0	-0.8641236724294259	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 21.720648822875955)	Phosphorylation of Y (2: 99.19224555735056)		0	Y2-{Y2 Y7}	1	99.73544973544973	Confident
3796	Q02790	GEHSIVYLKPSYAFGSVGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38849 (Experiment 1)	38849	66.177	530.511475	4+	4+	2118.0187069452804	0	-0.9013993544797039	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 4.363113485639207)	Phosphorylation of Y (7: 0.16155088852988692)		0	Y7-{Y7 Y12}	1	100.0	Doubtful
3797	P26373	GFSLEELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39884 (Experiment 1)	39884	67.574	475.751129	2+	2+	949.48689587533	0	0.850435957913016								99.7289972899729	Confident
3798	P27797	IKDPDASKPEDWDER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17732 (Experiment 1)	17732	40.596	450.965729	4+	4+	1799.8326068202302	0	0.6670758147783964								100.0	Doubtful
3799	P06748	ADKDYHFKVDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23415 (Experiment 1)	23415	47.956	515.645691	5+	5+	2572.1942426127903	1	-2.143690438899541								100.0	Doubtful
3800	P19338	NDLAVVDVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28506 (Experiment 1)	28506	54.003	500.775879	2+	2+	999.5349086969102	0	2.29281683414253								100.0	Confident
3801	P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3	TIGGGDDSFNTFFSETGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45537 (Experiment 1)	45537	77.745	1004.452087	2+	2+	2006.8857645919009	0	1.9196942931269623								100.0	Confident
3802	P05141, P12235, P12236, Q9H0C2	TAVAPIER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13632 (Experiment 1)	13632	34.694	428.74646	2+	2+	855.4814165720702	0	-3.5562915775003168								99.72972972972973	Confident
3803	Q9Y230	LLIVSTTPYSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35128 (Experiment 1)	35128	61.669	675.878357	2+	2+	1349.7442327568103	0	-1.5325888437403483								100.0	Confident
3804	Q5JVS0, Q8NC51	EMTLDEWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36490 (Experiment 1)	36490	63.322	526.241821	2+	2+	1050.4691972058602	0	-0.10274693967287574								99.1869918699187	Confident
3805	P00338, Q6ZMR3, Q9BYZ2	LVIITAGAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27676 (Experiment 1)	27676	53.026	457.294159	2+	2+	912.5756513100803	0	-2.0623922008810287								100.0	Confident
3806	P28702	VYASLETYCK	Phosphorylation of Y(2)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28142 (Experiment 1)	28142	53.57	657.276855	2+	2+	1312.5410554243103	0	-1.4441062230527588	Phosphorylation of Y (2: Random)	Phosphorylation of Y (2: 0.0, 8: 0.0)	Phosphorylation of Y (2: 96.50959860383944)		0	Y2-{Y2 Y8}	1	98.94179894179894	Confident
3807	Q9NSD9	ASEGPAFFPGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32786 (Experiment 1)	32786	58.956	568.27887	2+	2+	1134.54580773378	0	-2.3057881437157164								100.0	Confident
3808	O75368	GDYDAFFEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41273 (Experiment 1)	41273	69.561	595.758911	2+	2+	1189.5040024914504	0	-0.6155381056776742								100.0	Confident
3809	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17731 (Experiment 1)	17731	40.594	798.838745	2+	2+	1595.6617155921804	0	0.764531726220561	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3810	P78527	LSFAVPFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43969 (Experiment 1)	43969	74.081	468.769928	2+	2+	935.5228874612301	0	2.576542591159546								99.7289972899729	Confident
3811	Q9P258	GNLYSFGCPEYGQLGHNSDGK	Phosphorylation of Y(11)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35762 (Experiment 1)	35762	62.42	793.9953	3+	3+	2378.9627252741298	0	0.5647918377632982	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 15.830096148044477)	Phosphorylation of Y (11: 0.0)		0	Y11-{Y4 Y11}	1	100.0	Confident
3812	O43930, P49137, P51817, Q16644, Q96PN8	LTDFGFAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34532 (Experiment 1)	34532	60.981	449.737183	2+	2+	897.4596184983302	0	0.2163130994670489								96.19565217391303	Confident
3813	O00299	GVTFNVTTVDTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32025 (Experiment 1)	32025	58.086	641.339722	2+	2+	1280.6612314088404	0	2.85314307809447								100.0	Confident
3814	Q12905	ILITTVPPNLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38328 (Experiment 1)	38328	65.545	618.887329	2+	2+	1235.7601576044701	0	-0.04244560320732722								94.9468085106383	Confident
3815	P49207	SACGVCPGR		Carbamidomethylation of C(3, 6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7638 (Experiment 1)	7638	23.753	482.209229	2+	2+	962.40622010982	0	-2.4004495844637277								100.0	Confident
3816	O43809	TVEGVLIVHEHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20025 (Experiment 1)	20025	43.579	463.928497	3+	3+	1387.7571974823504	1	2.2356386985636134								92.71523178807946	Doubtful
3817	P11142, P54652	STAGDTHLGGEDFDNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18795 (Experiment 1)	18795	42.043	564.581238	3+	3+	1690.7183053439803	0	2.113225937282834								99.37888198757764	Confident
3818	O14980	AVGHPFVIQLGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34533 (Experiment 1)	34533	60.982	431.919342	3+	3+	1292.73533983896	0	0.6612046023900234								100.0	Confident
3819	P13796	VYALPEDLVEVNPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.28 min, Period: 1, Cycle(s): 45072 (Experiment 1)	45072	76.733	833.411194	2+	2+	1664.8062545675507	0	0.9482116002470222	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	100.0	Confident
3820	P62158	DGNGYISAAELR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31557 (Experiment 1)	31557	57.541	673.292603	3+	2+	1344.5711096826303	0	-0.3390918730034308	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.38449111470113)	Y5	1		0	98.91304347826086	Confident
3821	P50990	HFSGLEEAVYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27827 (Experiment 1)	27827	53.204	436.55072	3+	3+	1306.6305999869005	0	-0.20569376302781703								100.0	Confident
3822	Q9BZZ5	PTVEELYR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25218 (Experiment 1)	25218	50.163	543.748047	2+	2+	1085.4794411439202	0	1.930973841844936	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 85.51483420593368)	Y7	1		0	96.48648648648648	Confident
3823	P62269	YSQVLANGLDNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25376 (Experiment 1)	25376	50.344	661.341614	2+	2+	1320.6673794184405	0	0.979561226120019								100.0	Confident
3824	P27348	QTIDNSQGAYQEAFDISKK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28505 (Experiment 1)	28505	54.0	741.670288	3+	3+	2221.9892572918006	0	-0.10008589979332419	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 99.82547993019197)	Y10	1		0	100.0	Confident
3825	P27348, P31946, P31947, P61981, P62258, P63104, Q04917	NLLSVAYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34864 (Experiment 1)	34864	61.363	494.248871	2+	2+	986.4837982483702	0	-0.6162701166085393	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.60383944153578)	Y7	1		0	99.1891891891892	Confident
3826	O75643	MTQNPNYYNLQGISHR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29256 (Experiment 1)	29256	54.869	672.632202	3+	3+	2014.8720597949302	0	1.3463565394717645	Phosphorylation of Y (7: Random)	Phosphorylation of Y (7: 0.0, 8: 0.0)	Phosphorylation of Y (7: 0.17528283235089528)		0	Y7-{Y7 Y8}	1	98.7012987012987	Confident
3827	O14979	DLTEYLSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38676 (Experiment 1)	38676	65.96	538.736877	2+	2+	1075.4587056993403	0	0.45974879813828584	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.67689822294022)	Y5	1		0	100.0	Confident
3828	P23528	HELQANCYEEVKDR	Phosphorylation of Y(8)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13326 (Experiment 1)	13326	34.2	624.265076	3+	3+	1869.7716770473203	0	0.9192429587032951	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3829	Q9HB71	TDTVLILCR		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35857 (Experiment 1)	35857	62.534	545.799683	2+	2+	1089.58523001761	0	-0.38196346384517144								100.0	Confident
3830	P83731	VFQFLNAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38760 (Experiment 1)	38760	66.07	483.773346	2+	2+	965.5334521449302	0	-1.3571197988836516								100.0	Confident
3831	P22914	ITFYEDKNFQGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30917 (Experiment 1)	30917	56.788	759.870239	2+	2+	1516.7310423041602	1	-5.578337551078544								92.22520107238606	Doubtful
3832	P49327	SEGVVAVLLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42896 (Experiment 1)	42896	72.253	558.337524	2+	2+	1114.6597748568602	0	0.6449593205685903								96.7654986522911	Confident
3833	P08238	NPDDITQEEYGEFYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35631 (Experiment 1)	35631	62.252	964.385559	2+	2+	1926.7560694694905	0	0.256949623492587	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 4.197843481395482)	Phosphorylation of Y (10: 95.89572730933989)		0	Y10-{Y10 Y14}	1	99.74226804123711	Confident
3834	P07108	TKPSDEEMLFIYGHYK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37229 (Experiment 1)	37229	64.199	679.973572	3+	3+	2036.8954805781104	0	1.6696860392309087	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 17.02388139820072)	Phosphorylation of Y (12: 2.10016155088853)		0	Y12-{Y12 Y15}	1	100.0	Confident
3835	P13639	RCLYASVLTAQPR	Phosphorylation of Y(4)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28379 (Experiment 1)	28379	53.853	538.932739	3+	3+	1613.77491195296	0	0.9126976607208008	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3836	P12956	SDSFENPVLQQHFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33980 (Experiment 1)	33980	60.331	568.610107	3+	3+	1702.8063325027404	0	1.26571765661684								100.0	Confident
3837	O75643	IIYIAPMR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39911 (Experiment 1)	39911	67.613	528.768433	2+	2+	1055.52388923854	0	-1.4904159521994251	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.67689822294022)	Y3	1		0	99.73821989528795	Confident
3838	Q9NZ63	NAEDCLYELPENIR	Phosphorylation of Y(7)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42593 (Experiment 1)	42593	71.674	908.382813	2+	2+	1814.7546300008503	0	-1.957835099653564	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
3839	P25705	HALIIYDDLSK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35079 (Experiment 1)	35079	61.613	684.334656	2+	2+	1366.6533827546102	0	1.005584868131861	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3840	P15170, Q8IYD1	HLIVLINK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25648 (Experiment 1)	25648	50.669	475.313416	2+	2+	948.6120368188001	0	0.2548293710934517								92.85714285714286	Confident
3841	P50991	DIEREDIEFICK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35843 (Experiment 1)	35843	62.518	522.922119	3+	3+	1565.7395583825303	0	3.167605393840615								92.71523178807946	Doubtful
3842	O14949	HVISYSLSPFEQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35250 (Experiment 1)	35250	61.811	521.603699	3+	3+	1561.7888915334504	0	0.2403269025449482								100.0	Confident
3843	Q9NRX4	IHVYGYSMAYGPAQHAISTEK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32575 (Experiment 1)	32575	58.716	801.701111	3+	3+	2402.0766328275604	0	2.025186111882651	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 6.206864492365192)	Phosphorylation of Y (6: 0.012969181278141003)		0	Y6-{Y4 Y6 Y10}	1	100.0	Confident
3844	P15311, P26038, P35241	RKPDTIEVQQMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12407 (Experiment 1)	12407	32.801	491.602112	3+	3+	1471.7816979780305	0	1.9044038621176065								100.0	Confident
3845	P54578	SSSSGHYVSWVK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23497 (Experiment 1)	23497	48.057	702.303406	2+	2+	1402.5918451272105	0	0.2947011817166244	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
3846	P10412, P16402, P16403	ASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31269 (Experiment 1)	31269	57.199	599.837219	2+	2+	1197.6605031328502	0	-0.51519490314609								100.0	Confident
3847	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21455 (Experiment 1)	21455	45.373	673.307251	2+	2+	1344.6002845525904	0	-0.24913301512924108	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 10.33452891645359)	Phosphorylation of Y (9: 26.33279483037157)		0	Y9-{Y4 Y7 Y9}	1	100.0	Confident
3848	Q9Y2W1	SIFQHIQSAQSQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23302 (Experiment 1)	23302	47.816	510.599396	3+	3+	1528.7746384516404	0	1.1229611503643804								99.27536231884058	Confident
3849	P26373	TIGISVDPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26954 (Experiment 1)	26954	52.175	479.271759	2+	2+	956.5290950404801	0	-0.13559539449099423								96.24664879356568	Confident
3850	P62851	LITPAVVSER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28238 (Experiment 1)	28238	53.692	542.821472	2+	2+	1083.6288090817504	0	-0.38503931333279423								99.23664122137404	Confident
3851	P46782	AQCPIVER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13120 (Experiment 1)	13120	33.901	486.751587	2+	2+	971.4858503295102	0	2.846158929727994								92.41192411924119	Confident
3852	P61604	VLQATVVAVGSGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24884 (Experiment 1)	24884	49.773	658.382202	2+	2+	1314.7507151195805	0	-0.6561937997501867								100.0	Confident
3853	Q9UBR2	NVDGVNYASITR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27869 (Experiment 1)	27869	53.252	694.8125	2+	2+	1387.6133088477804	0	-2.059386892920775	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	100.0	Confident
3854	P61978	NLPLPPPPPPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29978 (Experiment 1)	29978	55.705	597.852783	2+	2+	1193.6920780446499	0	-0.89066853551291								97.5609756097561	Confident
3855	P61313	GATYGKPVHHGVNQLK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.39 min, Period: 1, Cycle(s): 7394 (Experiment 1)	7394	23.251	447.225372	4+	4+	1784.8723174951103	0	0.03613258993897884	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Doubtful
3856	B2RPK0, P09429, P26583	MSSYAFFVQTCR	Phosphorylation of Y(4)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43440 (Experiment 1)	43440	73.172	788.820496	2+	2+	1575.6251364847806	0	0.8256521461263632	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3857	P49368	NLQDAMQVCR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25890 (Experiment 1)	25890	50.945	617.783203	2+	2+	1233.55942627593	0	-6.129304826499419								100.0	Doubtful
3858	P10412, P16401, P16402, P16403, P22492, Q02539	GTGASGSFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.38 min, Period: 1, Cycle(s): 7134 (Experiment 1)	7134	22.658	406.201019	2+	2+	810.3871818340601	0	0.37325414622258524								100.0	Confident
3859	P31949	DGYNYTLSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21141 (Experiment 1)	21141	44.909	570.734436	2+	2+	1139.4536203189004	0	0.6121480140220803	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0)	Phosphorylation of Y (3: 26.178010471204193)		0	Y3-{Y3 Y5}	1	96.21621621621621	Confident
3860	Q96JB5	EQFYHSCK	Phosphorylation of Y(4)	Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.44 min, Period: 1, Cycle(s): 8954 (Experiment 1)	8954	26.552	589.722473	2+	2+	1177.4263600252402	0	3.4194516159197232	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.33507853403141)	Y4	1		0	96.19565217391303	Confident
3861	Q92608	DQPDYAMYSR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22518 (Experiment 1)	22518	46.876	663.247437	2+	2+	1324.4795177969102	0	0.6055582783233078	Phosphorylation of Y (5: Random)	Phosphorylation of Y (5: 0.0, 8: 0.0)	Phosphorylation of Y (5: 2.504038772213247)		0	Y5-{Y5 Y8}	1	100.0	Confident
3862	P06744	TFTTQETITNAETAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25591 (Experiment 1)	25591	50.602	828.406799	2+	2+	1654.8049950900606	0	-3.59123218452813								98.92183288409704	Confident
3863	Q7Z5R6	TLYDNYQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17933 (Experiment 1)	17933	40.856	576.741272	2+	2+	1151.4648537089402	0	2.7199076269545546	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 6: 0.0)	Phosphorylation of Y (3: 79.40663176265271)		0	Y3-{Y3 Y6}	1	97.289972899729	Confident
3864	P17987	TSASIILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24203 (Experiment 1)	24203	48.97	430.763794	2+	2+	859.5127167003502	0	0.3695367948637887								99.72972972972973	Confident
3865	Q8IWS0	EKPSQGIYMVYCR	Phosphorylation of Y(8)	Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30374 (Experiment 1)	30374	56.163	855.872986	2+	2+	1709.7306641824803	0	0.4410024856364296	Phosphorylation of Y (8: Random)	Phosphorylation of Y (8: 0.0, 11: 0.0)	Phosphorylation of Y (8: 15.706806282722512)		0	Y8-{Y8 Y11}	1	100.0	Confident
3866	P07900	RAPFDLFENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40220 (Experiment 1)	40220	68.045	422.218994	3+	3+	1263.6360197205104	0	-0.6845739336769544								100.0	Confident
3867	Q14498	TGIDLGTTGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22188 (Experiment 1)	22188	46.469	495.764557	2+	2+	989.51417325233	0	0.3911273933664748								98.92183288409704	Confident
3868	P41250	LLEFNQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26742 (Experiment 1)	26742	51.926	474.761444	2+	2+	947.5076313199102	0	0.7411585295831066								99.45799457994579	Confident
3869	P06733, P13929	VNQIGSVTESIQACK		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31219 (Experiment 1)	31219	57.143	545.278931	3+	3+	1632.8141203051202	0	0.5155128445183557								100.0	Confident
3870	P30086	CDEPILSNR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19713 (Experiment 1)	19713	43.178	552.260925	2+	2+	1102.5077079729	0	-0.3720219489548126								99.72972972972973	Confident
3871	Q9UQ80	EGEFVAQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32194 (Experiment 1)	32194	58.277	527.764832	2+	2+	1053.5131106231704	0	1.8952067998106452								99.45799457994579	Confident
3872	P61254, Q9UNX3	IMSSPLSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20199 (Experiment 1)	20199	43.785	431.738617	2+	2+	861.4629896266101	0	-0.3573459862939612								99.7289972899729	Confident
3873	P38646	TTPSVVAFTADGER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32930 (Experiment 1)	32930	59.117	725.862671	2+	2+	1449.7099725064102	0	0.5624758356925317								100.0	Confident
3874	P04406	AGAHLQGGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4114 (Experiment 1)	4114	16.684	455.247894	2+	2+	908.4828135544001	0	-1.7336546838572942								100.0	Confident
3875	P49915	TLNMTTSPEEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17735 (Experiment 1)	17735	40.599	625.800415	2+	2+	1249.5860178632504	0	0.20709732130170788								99.45799457994579	Confident
3876	Q9Y277	VNNASLIGLGYTQTLRPGVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38285 (Experiment 1)	38285	65.483	701.064453	3+	3+	2100.16913751227	0	1.1373609582521174								100.0	Confident
3877	O95881	ILFLDPSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.21 min, Period: 1, Cycle(s): 43116 (Experiment 1)	43116	72.628	495.287231	2+	2+	988.5593325396003	0	0.5820128960448225								94.03794037940379	Confident
3878	Q9Y230	TEALTQAFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28181 (Experiment 1)	28181	53.621	518.773682	2+	2+	1035.5349086969102	0	-2.0217161801730965								99.73190348525469	Confident
3879	Q08211	LAAQSCALSLVR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 33956 (Experiment 1)	33956	60.3	644.856445	2+	2+	1287.69690572491	0	1.109815266215105								100.0	Confident
3880	Q14919	VAAAVPVIISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33127 (Experiment 1)	33127	59.341	548.348206	2+	2+	1094.6811790077802	0	0.6200977863374171								99.73474801061008	Confident
3881	P61086	NAVIVALSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29914 (Experiment 1)	29914	55.628	501.303497	2+	2+	1000.5916952970404	0	0.74383072818899								97.61273209549071	Confident
3882	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29234 (Experiment 1)	29234	54.843	609.259949	2+	2+	1216.5053215385904	0	0.019308495502044134	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 10.33452891645359)	Phosphorylation of Y (8: 0.0)		0	Y3-{Y3 Y6 Y8}	1	100.0	Confident
3883	Q9BUJ2	HLPSTEPDPHVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14310 (Experiment 1)	14310	35.751	495.259583	3+	3+	1482.7579257583402	0	-0.6771924120261774								100.0	Confident
3884	P52272	GGNRFEPYANPTKR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14248 (Experiment 1)	14248	35.669	562.93103	3+	3+	1685.7675180734002	0	2.216100053747756	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
3885	P14625	NLLHVTDTGVGMTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29833 (Experiment 1)	29833	55.534	505.265503	3+	3+	1512.7718615703202	0	1.8591113426098256								100.0	Confident
3886	P11216	HLEIIYAINQR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.17 min, Period: 1, Cycle(s): 41668 (Experiment 1)	41668	70.176	725.367188	2+	2+	1448.7177143466702	0	1.4535553894830846	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 95.81151832460732)	Y6	1		0	95.13513513513514	Confident
3887	Q15046	INMVEELEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36709 (Experiment 1)	36709	63.579	552.784058	2+	2+	1103.5532611829904	0	0.2730573209203748								92.99191374663073	Confident
3888	P48047	YATALYSAASK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21586 (Experiment 1)	21586	45.622	613.277405	2+	2+	1224.5427696764705	0	-2.0485060487677784	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 23.868167899130043)	Phosphorylation of Y (6: 100.0)		0	Y6-{Y1 Y6}	1	100.0	Confident
3889	O15347	MSAYAFFVQTCR	Phosphorylation of Y(4)	Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46079 (Experiment 1)	46079	78.891	780.823792	2+	2+	1559.6302218652202	0	1.798873342437147	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3890	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHRK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12538 (Experiment 1)	12538	33.01	575.592651	3+	3+	1723.7566786061805	0	-0.3214115844171545	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3891	P52272	MGANNLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12027 (Experiment 1)	12027	32.151	452.718933	2+	2+	903.4232500729502	0	0.06957233913845286								100.0	Confident
3892	Q96GX2	DFGIQPVEDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31476 (Experiment 1)	31476	57.444	574.283997	2+	2+	1146.5557037111403	0	-1.9699663571508383								97.56756756756756	Confident
3893	O00116	EYVDPNNIFGNR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 41967 (Experiment 1)	41967	70.646	506.552246	3+	3+	1516.6347725683504	0	0.08951444261097757	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	92.95774647887323	Doubtful
3894	P62424	AGVNTVTTLVENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31649 (Experiment 1)	31649	57.65	673.367554	2+	2+	1344.7248942945605	0	-3.2220250127027388								100.0	Confident
3895	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17299 (Experiment 1)	17299	40.013	514.762817	2+	2+	1027.5120650773501	0	-0.9557897357800081								100.0	Confident
3896	P52272	MGAGMGFGLER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36116 (Experiment 1)	36116	62.866	563.263245	2+	2+	1124.51068517836	0	1.1112827066854842								100.0	Confident
3897	Q96ST3	RLDDQESPVYAAQQR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20751 (Experiment 1)	20751	44.418	619.283142	3+	3+	1854.8261551483306	0	0.7758714627851115	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3898	P00338	VTLTSEEEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16127 (Experiment 1)	16127	38.504	567.785767	2+	2+	1133.5564319871305	0	0.4835270120194332								100.0	Confident
3899	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27739 (Experiment 1)	27739	53.101	523.252319	2+	2+	1044.4892775516303	0	0.7716309507702686	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.83844911147011)	Y7	1		0	100.0	Confident
3900	P23396	KFVADGIFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30304 (Experiment 1)	30304	56.083	512.795227	2+	2+	1023.5753169569102	0	0.5695351355191967								100.0	Confident
3901	Q06830	LVQAFQFTDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36878 (Experiment 1)	36878	63.782	598.819336	2+	2+	1195.6237237013104	0	0.3301205992060721								100.0	Confident
3902	Q9NWQ8	SPSSCNDLYATVK	Phosphorylation of Y(9)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23089 (Experiment 1)	23089	47.555	761.318542	2+	2+	1520.6218249261506	0	0.4637615621925855	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
3903	Q00610	IHEGCEEPATHNALAK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9764 (Experiment 1)	9764	28.151	592.950562	3+	3+	1775.8260819711506	0	2.1219511736194243								99.24812030075188	Confident
3904	Q99497	DGLILTSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29491 (Experiment 1)	29491	55.139	437.752777	2+	2+	873.4919812557703	0	-1.1195683366706743								92.43243243243244	Confident
3905	P62857	VEFMDDTSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 25148 (Experiment 1)	25148	50.08	550.240417	2+	2+	1098.4651744545802	0	1.0055721773950428								100.0	Confident
3906	P62280	EAIEGTYIDKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17052 (Experiment 1)	17052	39.657	422.890198	3+	3+	1265.6503323719703	0	-1.2357584990045651								99.28057553956835	Confident
3907	P23526	AGIPVYAWK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38236 (Experiment 1)	38236	65.422	502.781738	2+	2+	1003.5491022090703	0	-0.17815152052750727								94.08602150537635	Confident
3908	P62263	VKADRDESSPYAAMLAAQDVAQR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33363 (Experiment 1)	33363	59.614	643.803101	4+	4+	2571.1788660499706	0	1.7210581938835905	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Doubtful
3909	P10398	QQFYHSVQDLSGGSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25289 (Experiment 1)	25289	50.244	596.92865	3+	3+	1787.76282661578	0	0.7225792221259865	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	100.0	Confident
3910	P62805	DAVTYTEHAK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.48 min, Period: 1, Cycle(s): 10112 (Experiment 1)	10112	28.839	607.758301	2+	2+	1213.5016331404804	0	0.3421804663178763	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3911	P38159, Q96E39	YDDYSSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9697 (Experiment 1)	9697	28.03	496.701935	2+	2+	991.3883040328701	0	1.019761015233205								99.7289972899729	Confident
3912	Q13242	EAGDVCYADVQK	Phosphorylation of Y(7)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16758 (Experiment 1)	16758	39.276	717.785095	2+	2+	1433.5534110131603	0	1.5506428615115333	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3913	P17844	TGTAYTFFTPNNIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42699 (Experiment 1)	42699	71.89	827.880066	2+	2+	1653.7439886641603	0	0.9605278642637584	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3914	P07900, P08238, Q12931, Q58FF7	GVVDSEDIPLNLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40098 (Experiment 1)	40098	67.86	757.397583	2+	2+	1512.7783864194002	0	1.4699348787994662								100.0	Confident
3915	Q99623	VLSRPNAQELPSMYQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27763 (Experiment 1)	27763	53.131	630.328979	3+	3+	1887.9625158743102	0	1.370569386436773								100.0	Confident
3916	Q8IVF2	EKEDTDVADGCRETPTK		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29953 (Experiment 1)	29953	55.675	975.935425	2+	2+	1949.8636492483304	0	-3.7667216869799263								94.08602150537635	Confident
3917	P61247	LITEDVQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16912 (Experiment 1)	16912	39.472	501.775604	2+	2+	1001.5393253710104	0	-2.660848303250441								99.19354838709677	Confident
3918	P50990	TAEELMNFSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33495 (Experiment 1)	33495	59.767	585.277222	2+	2+	1168.5434247752803	0	-3.0188243313319365								100.0	Confident
3919	P46778	HGVVPLATYMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30441 (Experiment 1)	30441	56.239	415.225281	3+	3+	1242.6543126369404	0	-0.2400602904047778								100.0	Confident
3920	P30101	LNFAVASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26848 (Experiment 1)	26848	52.05	439.247711	2+	2+	876.4817509252402	0	-1.0038276317506378								100.0	Confident
3921	O75083	LYSILGTTLKDEGK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39176 (Experiment 1)	39176	66.583	809.409119	2+	2+	1616.8062545675505	0	-1.5872672025476702	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 95.15347334410339)	Y2	1		0	96.48648648648648	Confident
3922	P07737	CYEMASHLR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16884 (Experiment 1)	16884	39.436	389.507843	3+	3+	1165.50084877065	0	0.728123578409947								100.0	Confident
3923	P06748	SNQNGKDSKPSSTPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 3996 (Experiment 1)	3996	16.553	535.264038	3+	3+	1601.7757606504504	1	-5.502805301426082								100.0	Doubtful
3924	P51659	AYALAFAER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36613 (Experiment 1)	36613	63.461	546.249634	2+	2+	1090.4848608775303	0	-0.1334656591865691	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
3925	Q15019, Q9UHD8	VNIVPVIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33561 (Experiment 1)	33561	59.841	476.813324	2+	2+	951.6117024656303	0	0.4116924671667987								100.0	Confident
3926	P04406	LVINGNPITIFQERDPSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43940 (Experiment 1)	43940	74.034	681.041565	3+	3+	2040.1003892461104	0	1.212043719615201								94.73684210526316	Confident
3927	P50991	LVIEEAER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20928 (Experiment 1)	20928	44.624	479.763916	2+	2+	957.5131106231702	0	0.17554804545115546								99.73118279569893	Confident
3928	P11940, Q13310, Q4VXU2, Q9H361	GFGFVCFSSPEEATK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44584 (Experiment 1)	44584	75.632	831.877747	2+	2+	1661.7395583825303	0	0.8310626168690527								100.0	Confident
3929	P62701	LSNIFVIGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41156 (Experiment 1)	41156	69.406	495.802917	2+	2+	989.5909670210501	0	0.31670389041037916								99.45945945945947	Confident
3930	P37837	LLGELLQDNAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38433 (Experiment 1)	38433	65.672	607.342163	2+	2+	1212.6714021697203	0	-1.341172454938221								100.0	Confident
3931	P22314	DEFEGLFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44210 (Experiment 1)	44210	74.616	492.73703	2+	2+	983.4600124211502	0	-0.5128034673277186								99.45799457994579	Confident
3932	Q9UKK9	VYSYALALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35226 (Experiment 1)	35226	61.783	514.294189	2+	2+	1026.5749826037402	0	-1.125363737831194								99.45652173913044	Confident
3933	P13639	EDLYLKPIQR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30575 (Experiment 1)	30575	56.392	677.843994	2+	2+	1353.6693671719202	0	3.0006216015938096	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 84.64223385689354)	Y4	1		0	92.46753246753246	Confident
3934	P25205	VQVVGTYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17503 (Experiment 1)	17503	40.295	461.261749	2+	2+	920.5079656730802	0	1.0616470342339108								95.23809523809523	Confident
3935	P29401	IIALDGDTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23352 (Experiment 1)	23352	47.878	473.266205	2+	2+	944.5178616504402	0	-0.004843008017160273								100.0	Confident
3936	E9PAV3, Q13765	SPASDTYIVFGEAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38775 (Experiment 1)	38775	66.087	742.86731	2+	2+	1483.7194745609506	0	0.39879642938104093								99.75247524752476	Confident
3937	Q14240	GFKDQIYEIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46222 (Experiment 1)	46222	79.146	798.380249	2+	2+	1594.7432603881705	0	1.6813308712634327	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.30191972076788)	Y7	1		0	99.7340425531915	Confident
3938	P00491	VIMDYESLEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34593 (Experiment 1)	34593	61.05	613.802673	2+	2+	1225.5900406145304	0	0.6129431654809919								100.0	Confident
3939	P26599	GQPIYIQFSNHK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31836 (Experiment 1)	31836	57.869	756.355957	2+	2+	1510.6969789020904	0	0.25263526940913683	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
3940	A8MUU1, Q01469	TQTVCNFTDGALVQHQEWDGKESTITR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34325 (Experiment 1)	34325	60.739	781.121399	4+	4+	3120.457075880871	0	-0.18747022234059313								100.0	Doubtful
3941	P25205	ELISDNQYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 20999 (Experiment 1)	20999	44.722	569.281311	2+	2+	1136.5462016566003	0	1.6401494325051627								99.73045822102425	Confident
3942	P33993	SQLLSYIDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38105 (Experiment 1)	38105	65.265	547.796204	2+	2+	1093.57677350889	0	0.987190624551778								99.73262032085562	Confident
3943	A5A3E0, P0CG38, P0CG39, P60709, P63261, P68032, P68133, Q6S8J3, Q9BYX7	IWHHTFYNELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25316 (Experiment 1)	25316	50.276	505.921417	3+	3+	1514.7418817713801	0	0.3556734028970638								100.0	Confident
3944	ALDOA_RABIT, P04075	ALSDHHIYLEGTLLKPNMVTPGHACTQK	Phosphorylation of Y(8)	Carbamidomethylation of C(25)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34624 (Experiment 1)	34624	61.085	643.114441	5+	5+	3210.5355401332404	0	0.08786390312419277	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Doubtful
3945	P62249	VKGGGHVAQIYAIR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18217 (Experiment 1)	18217	41.291	516.940369	3+	3+	1547.7973616497004	0	1.235443741448371	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3946	P63104	YLAEVAAGDDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20266 (Experiment 1)	20266	43.86	576.282043	2+	2+	1150.5506183307002	0	-0.941607773106445								100.0	Confident
3947	Q08211	DFVNYLVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43870 (Experiment 1)	43870	73.907	513.274475	2+	2+	1024.5341804209202	0	0.21104254357778449								99.7289972899729	Confident
3948	P11142	LDKSQIHDIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29822 (Experiment 1)	29822	55.521	460.258057	4+	4+	1837.0057605852803	0	-1.4331355567582065								100.0	Doubtful
3949	P05387	KILDSVGIEADDDRLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27186 (Experiment 1)	27186	52.442	634.338196	3+	3+	1899.9901700907901	0	1.360216737776267								97.88732394366197	Confident
3950	P28065	EGGQVYGTLGGMLTR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42554 (Experiment 1)	42554	71.612	809.868774	2+	2+	1617.7222076737603	0	0.4861238163944062	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
3951	Q13263	DHQYQFLEDAVR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37331 (Experiment 1)	37331	64.321	800.843445	2+	2+	1599.6718863530605	0	0.28139922039410686	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
3952	P62910	SYCAEIAHNVSSK		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18877 (Experiment 1)	18877	42.143	489.229095	3+	3+	1464.6667277954405	0	-0.866802340524398								100.0	Confident
3953	P08238	YHTSQSGDEMTSLSEYVSR	Phosphorylation of Y(16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32772 (Experiment 1)	32772	58.941	753.309387	3+	3+	2255.9042073385003	1	-0.5447618542384427	Phosphorylation of Y (16: Doubtfull)	Phosphorylation of Y (16: 3.073660714785918)	Phosphorylation of Y (16: 97.20767888307155)		0	Y16-{Y1 Y16}	1	98.50746268656717	Confident
3954	P46782	GSSNSYAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11362 (Experiment 1)	11362	31.109	463.732239	2+	2+	925.4505103666102	0	-0.6310752364192135								100.0	Confident
3955	O00505	IEVLQQHENEDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24926 (Experiment 1)	24926	49.82	919.419739	2+	2+	1836.8295091932705	0	-2.4929394443812334	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 99.30191972076788)	Y13	1		0	99.7289972899729	Confident
3956	P30101	TADGIVSHLKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13621 (Experiment 1)	13621	34.68	390.22876	3+	3+	1167.6611718391903	0	2.800724338175165								96.71052631578947	Confident
3957	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17513 (Experiment 1)	17513	40.308	532.89447	3+	3+	1595.6617155921804	0	-0.0844398610369085	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3958	O15226	TNPEYIYAPLK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35684 (Experiment 1)	35684	62.315	694.830505	2+	2+	1387.6424837177403	0	2.8592296737682474	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 10.33452891645359)	Phosphorylation of Y (7: 3.664921465968586)		0	Y7-{Y5 Y7}	1	100.0	Confident
3959	O96011	AAQYACSLLGHALQR	Phosphorylation of Y(4)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37938 (Experiment 1)	37938	65.058	580.275452	3+	3+	1737.8021893299601	0	1.342622561873968	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 99.82547993019197)	Y4	1		0	99.28057553956835	Confident
3960	O43813	IDPHAPNEMLYGR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28259 (Experiment 1)	28259	53.714	531.569275	3+	3+	1591.68542824222	0	0.35577523145949314	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3961	P0C0S8, P20671, Q16777, Q6FI13, Q96KK5, Q99878, Q9BTM1	NDEELNKLLGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32617 (Experiment 1)	32617	58.764	636.843811	2+	2+	1271.67213044571	0	0.7369321497516047								100.0	Confident
3962	P15311, P26038, P35241	APDFVFYAPR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44767 (Experiment 1)	44767	76.044	631.784302	2+	2+	1261.5532747905202	0	0.6143523431900699	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
3963	O60678	DFIYQNPHIFK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37645 (Experiment 1)	37645	64.708	751.34845	2+	2+	1500.6802662087905	0	1.3847506218576773	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 92.89176090468497)	Y4	1		0	95.23809523809523	Confident
3964	P27797	AKIDDPTDSKPEDWDKPEHIPDPDAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24612 (Experiment 1)	24612	49.457	740.606995	4+	4+	2958.3883105313703	0	3.565872021575461								100.0	Doubtful
3965	Q00610	LLYNNVSNFGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35511 (Experiment 1)	35511	62.111	688.822266	2+	2+	1375.6285649891001	0	1.0264467316268877	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
3966	P0C0S5, Q71UI9	GDEELDSLIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37592 (Experiment 1)	37592	64.642	559.782166	2+	2+	1117.5502839775302	0	-0.4509887571916148								100.0	Confident
3967	P25705	TGTAEMSSILEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35949 (Experiment 1)	35949	62.648	712.34021	2+	2+	1422.6660590891004	0	-0.13478299836760155								100.0	Confident
3968	Q9Y3L3	EDSYANYFIR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40822 (Experiment 1)	40822	68.919	679.275452	2+	2+	1356.5387469251903	0	-1.7635368554927904	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 7: 0.0)	Phosphorylation of Y (4: 86.98711846617606)		0	Y4-{Y4 Y7}	1	99.46236559139786	Confident
3969	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	KESYSVYVYK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21102 (Experiment 1)	21102	44.856	673.306274	2+	2+	1344.6002845525904	0	-1.7001789604487576	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 9.94210316877388)	Phosphorylation of Y (4: 24.071082390953148)		0	Y4-{Y4 Y7 Y9}	1	96.7479674796748	Confident
3970	P13796	AACLPLPGYR		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34336 (Experiment 1)	34336	60.752	559.2948	2+	2+	1116.57499968708	0	0.04235628321560935								99.73333333333333	Confident
3971	P37108	KISTVVSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7680 (Experiment 1)	7680	23.828	474.789154	2+	2+	947.5651461960304	0	-1.4649951505441547								90.32258064516128	Doubtful
3972	Q99714	VCNFLASQVPFPSR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43719 (Experiment 1)	43719	73.621	811.412598	2+	2+	1620.8082470790403	0	1.4764318911372973								100.0	Confident
3973	Q00839	KAVVVCPK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 7069 (Experiment 1)	7069	22.462	450.770782	2+	2+	899.5262585895102	0	0.8346564639376128								97.90575916230367	Confident
3974	P20042	DYTYEELLNR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39084 (Experiment 1)	39084	66.465	698.295837	2+	2+	1394.5755263567303	0	1.1418594970958231	Phosphorylation of Y (4: Random)	Phosphorylation of Y (2: 0.0, 4: 0.0)	Phosphorylation of Y (4: 3.315881326352531)		0	Y4-{Y2 Y4}	1	100.0	Confident
3975	Q86UW6	ETEETPSELSFQDFEYPDYDDYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41319 (Experiment 1)	41319	69.632	959.072449	4+	3+	2874.1668095915707	0	9.977798328620155								92.41379310344827	Doubtful
3976	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34597 (Experiment 1)	34597	61.054	636.639771	3+	3+	1906.8978635366104	0	-0.19892828365357665	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 8.753958426695245)	Phosphorylation of Y (3: 0.0)		0	Y3-{Y3 Y5}	1	100.0	Confident
3977	P17987	QAGVFEPTIVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32536 (Experiment 1)	32536	58.672	594.835938	2+	2+	1187.6550238295904	0	1.932668390016839								100.0	Confident
3978	P37802	GPAYGLSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16345 (Experiment 1)	16345	38.775	410.719604	2+	2+	819.4239016959502	0	0.9171355706674496								100.0	Confident
3979	P26599	NNQFQALLQYADPVSAQHAK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.32 min, Period: 1, Cycle(s): 46232 (Experiment 1)	46232	79.163	775.034363	3+	3+	2322.07940970888	0	0.7956172628586575	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
3980	P00558	ALESPERPFLAILGGAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 46068 (Experiment 1)	46068	78.867	590.337952	3+	3+	1767.9883196159903	0	2.0931464315727877								100.0	Confident
3981	P62263	IEDVTPIPSDSTRR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20967 (Experiment 1)	20967	44.679	529.612366	3+	3+	1584.81074917684	1	0.7334431472171575								100.0	Confident
3982	P60842	GFKDQIYDIFQK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45406 (Experiment 1)	45406	77.447	791.370605	2+	2+	1580.7276103240304	0	-0.6022823405669057	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82758620689656)	Y7	1		0	99.45945945945947	Confident
3983	P04229, P13760, P13761, P79483, Q29974, Q30134, Q30154, Q9GIY3, Q9TQE0	FDSDVGEYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20488 (Experiment 1)	20488	44.116	584.220276	2+	2+	1166.4281338470503	0	-1.8270307123731537	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
3984	O75526, P38159	IVEVLLMK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 40777 (Experiment 1)	40777	68.861	472.795441	2+	2+	943.5776254560303	0	-1.3709817867563519								99.45799457994579	Confident
3985	P27348	KQTIDNSQGAYQEAFDISKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26710 (Experiment 1)	26710	51.888	568.537048	4+	4+	2270.1178897850505	0	0.5260643677121674								100.0	Doubtful
3986	P63244	DETNYGIPQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20201 (Experiment 1)	20201	43.787	636.768921	2+	2+	1271.5183458337801	0	3.881511502736185	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	100.0	Confident
3987	P27695	KNDKEAAGEGPALYEDPPDQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17197 (Experiment 1)	17197	39.862	568.774353	4+	4+	2271.0655198590202	0	1.224684766970977								71.42857142857143	Doubtful
3988	P13639	GVQYLNEIK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29417 (Experiment 1)	29417	55.054	572.276306	2+	2+	1142.5372903732102	0	0.6716106134272477	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 83.0715532286213)	Y4	1		0	93.4959349593496	Confident
3989	Q00839	GYFEYIEENK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38563 (Experiment 1)	38563	65.826	646.297913	2+	2+	1290.5768330785402	0	3.434950815636444								100.0	Confident
3990	Q96AE4	SCMLTGTPESVQSAK		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23391 (Experiment 1)	23391	47.927	798.377991	2+	2+	1594.7330931031006	0	5.22058904915169								93.10344827586206	Doubtful
3991	P61604	GGEIQPVSVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17578 (Experiment 1)	17578	40.393	507.285461	2+	2+	1012.5553097883203	0	1.044066155222986								99.7289972899729	Confident
3992	P23246, Q15233	AVVIVDDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19566 (Experiment 1)	19566	42.988	443.752991	2+	2+	885.49198125577	0	-0.6221806518274533								100.0	Confident
3993	P13796, P13797, Q14651	KLENCNYAVELGK	Phosphorylation of Y(7)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21314 (Experiment 1)	21314	45.171	539.916382	3+	3+	1616.7269587010303	0	0.22095928468819476	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.30191972076788)	Y7	1		0	99.24812030075188	Confident
3994	P63104	KGIVDQSQQAYQEAFEISK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33099 (Experiment 1)	33099	59.309	750.356323	3+	3+	2248.0412928646606	0	2.5973216145236178	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
3995	P43243	MDYEDDRLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18524 (Experiment 1)	18524	41.698	404.849487	3+	3+	1211.52408631303	0	2.0956692547392635								99.38271604938271	Confident
3996	CATA_HUMAN, P04040	LNVITVGPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29097 (Experiment 1)	29097	54.689	484.79776	2+	2+	967.5814649665101	0	-0.5135129733130245								99.74424552429667	Confident
3997	Q06830	HGEVCPAGWKPGSDTIKPDVQK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20308 (Experiment 1)	20308	43.906	482.042877	5+	5+	2405.17977884896	0	-0.7369393038288408								100.0	Doubtful
3998	Q01469	TTQFSCTLGEK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22260 (Experiment 1)	22260	46.558	636.30072	2+	2+	1270.5863522164202	0	0.4202809799931558								100.0	Confident
3999	P01911, P01912, Q5Y7A7, Q9GIY3	HNYGVVESFTVQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32307 (Experiment 1)	32307	58.406	808.36792	2+	2+	1614.7191708986504	0	1.3089154350497376	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4000	P04350, P07437, P68371, Q13509, Q13885, Q9BVA1	EIVHLQAGQCGNQIGAK		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20808 (Experiment 1)	20808	44.483	608.312317	3+	3+	1821.91556568189	0	-0.2433411290210343								100.0	Confident
4001	P14866	SKPGAAMVEMADGYAVDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33819 (Experiment 1)	33819	60.137	623.298157	3+	3+	1866.8604188745403	0	6.536628194007458								92.7536231884058	Doubtful
4002	P13639	VFSGLVSTGLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36430 (Experiment 1)	36430	63.253	554.323608	2+	2+	1106.6335601090204	0	-0.8091319815161115								100.0	Confident
4003	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19855 (Experiment 1)	19855	43.358	514.767944	2+	2+	1027.5120650773501	0	9.0041275899539								91.32791327913279	Doubtful
4004	P00558	GCITIIGGGDTATCCAK		Carbamidomethylation of C(2, 14, 15)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28799 (Experiment 1)	28799	54.348	877.900879	2+	2+	1753.77972602569	0	4.259633816740034								100.0	Confident
4005	P13639	KEDLYLKPIQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22881 (Experiment 1)	22881	47.302	494.928925	3+	3+	1481.7643301859202	0	0.41447964733949183	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 96.68411867364746)	Y5	1		0	96.7741935483871	Confident
4006	P29692	FYEQMNGPVAGASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25827 (Experiment 1)	25827	50.873	763.855347	2+	2+	1525.6983622768903	0	-1.4539449737055141								100.0	Confident
4007	P62995	RPHTPTPGIYMGRPTYGSSR	Phosphorylation of Y(10, 16)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21930 (Experiment 1)	21930	46.139	797.687012	3+	3+	2390.03921538055	0	-0.0036693532254834104	Phosphorylation of Y (10: Very Confident, 16: Very Confident)		Phosphorylation of Y (10: 99.82547993019197, 16: 99.82547993019197)	Y10, Y16	2		0	99.28057553956835	Confident
4008	Q9Y3U8	EVCGFAPYER		Carbamidomethylation of C(3)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28826 (Experiment 1)	28826	54.377	614.276978	2+	2+	1226.5390081011801	0	0.3214879743438711								100.0	Confident
4009	P13796	NWMNSLGVNPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40559 (Experiment 1)	40559	68.558	644.316895	2+	2+	1286.6189897573802	0	0.19191569020551777								100.0	Confident
4010	P38919	LDYGQHVVAGTPGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17760 (Experiment 1)	17760	40.629	517.243408	3+	3+	1548.7086062149504	0	-0.136373806525393	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	100.0	Confident
4011	O75431	ANAEYMSPSGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12365 (Experiment 1)	12365	32.743	617.74408	2+	2+	1233.4737041404803	0	-0.07857145044025697	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
4012	P23193	DTYVSSFPR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28273 (Experiment 1)	28273	53.731	576.241455	2+	2+	1150.4696047362102	0	-1.082591744149282	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82578397212544)	Y3	1		0	99.73614775725594	Confident
4013	P31483, Q01085	TLYVGNLSR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31370 (Experiment 1)	31370	57.319	551.768921	2+	2+	1101.5219746622402	0	1.1910834873032694	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 83.52180936995154)	Y3	1		0	92.66304347826086	Confident
4014	P07900, P08238, Q14568, Q58FF6, Q58FF7, Q58FF8	YESLTDPSK	Phosphorylation of Y(1)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16926 (Experiment 1)	16926	39.491	560.233582	2+	2+	1118.4532859657302	0	-0.6023371050710908	Phosphorylation of Y (1: Very Confident)	Phosphorylation of Y (1: 100.0)	Phosphorylation of Y (1: 96.33507853403141)	Y1	1		0	96.19565217391303	Confident
4015	Q14019	FTTGDAMSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14445 (Experiment 1)	14445	35.971	479.22052	2+	2+	956.4273323938803	0	-0.881980970490821								99.73045822102425	Confident
4016	P14868	LQSGICHLFR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30628 (Experiment 1)	30628	56.454	410.88562	3+	3+	1229.63391154553	0	0.907839875139076								100.0	Confident
4017	P78527	ATQQQHDFTLTQTADGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20386 (Experiment 1)	20386	43.993	639.973938	3+	3+	1916.8976666882804	0	1.207296081084699								100.0	Confident
4018	P68363, P68366, Q13748, Q6PEY2, Q71U36, Q9BQE3	IHFPLATYAPVISAEK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44661 (Experiment 1)	44661	75.805	612.982178	3+	3+	1835.9222873793005	0	1.314460967758614	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.83844911147011)	Y8	1		0	100.0	Confident
4019	P23528	MLPDKDCR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8300 (Experiment 1)	8300	25.096	517.74115	2+	2+	1033.46848601321	0	-0.7136252419367605								98.91598915989161	Confident
4020	O43933, P55072, Q8IYT4	GILLYGPPGTGK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38232 (Experiment 1)	38232	65.417	626.821289	2+	2+	1251.6264397307802	0	1.264585000682539	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.65095986038395)	Y5	1		0	100.0	Confident
4021	P28066	AIGSASEGAQSSLQEVYHK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25263 (Experiment 1)	25263	50.214	654.656433	3+	3+	1960.9490335548005	0	-0.7963230341821115								100.0	Confident
4022	Q15717	NVALLSQLYHSPAR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39753 (Experiment 1)	39753	67.402	550.279236	3+	3+	1647.8134056366603	0	1.4980071004547941	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
4023	O75368	VYIASSSGSTAIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19291 (Experiment 1)	19291	42.656	642.346985	2+	2+	1282.6768814729803	0	1.973698374309739								95.6639566395664	Confident
4024	P26641	ALIAAQYSGAQVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27358 (Experiment 1)	27358	52.645	674.373169	2+	2+	1346.7306483813402	0	0.8427722556355489								100.0	Confident
4025	Q08211	DVVQAYPEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25841 (Experiment 1)	25841	50.889	588.306885	2+	2+	1174.5982372294602	0	0.8327607210866758								100.0	Confident
4026	Q9UI12	QEYALAMIQCK	Phosphorylation of Y(3)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39425 (Experiment 1)	39425	66.932	717.812195	2+	2+	1433.6084237914802	0	0.9844331823553225	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4027	P26038	IQVWHEEHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13439 (Experiment 1)	13439	34.381	411.875854	3+	3+	1232.6050539454004	0	0.5492387489739611								99.24812030075188	Confident
4028	TRYP_PIG	VATVSLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22592 (Experiment 1)	22592	46.962	421.758575	2+	2+	841.5021520166501	0	0.527612225510443								100.0	Confident
4029	ALDOA_RABIT, P04075	GVVPLAGTNGETTTQGLDGLSER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40534 (Experiment 1)	40534	68.527	758.382568	3+	3+	2271.1342681251804	1	-5.166032107243167								100.0	Doubtful
4030	P51965, Q969T4, Q96LR5	GDNIYEWR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31751 (Experiment 1)	31751	57.77	566.727539	2+	2+	1131.4386389611002	0	1.664034553084291	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.03069466882067)	Y5	1		0	99.72826086956522	Confident
4031	P17987	EQLAIAEFAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39859 (Experiment 1)	39859	67.537	574.308655	2+	2+	1146.6033226099005	0	-0.4923687299196829								99.1869918699187	Confident
4032	Q9Y5S9	FAEYGEIK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22451 (Experiment 1)	22451	46.793	518.722961	2+	2+	1035.4314283223403	0	-0.057117156323169264	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 96.16055846422339)	Y4	1		0	96.24664879356568	Confident
4033	P40121	ANAQAAALYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14402 (Experiment 1)	14402	35.906	550.759644	2+	2+	1099.5063245981003	0	-1.4430336790441403	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 98.86914378029078)	Y9	1		0	99.73190348525469	Confident
4034	P68104, Q5VTE0	EVSTYIKK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10320 (Experiment 1)	10320	29.229	524.259705	2+	2+	1046.5049276157704	0	-0.06728477222516514	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 97.03315881326353)	Y5	1		0	96.52406417112299	Confident
4035	P78527	VTELALTASDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26098 (Experiment 1)	26098	51.186	588.31781	2+	2+	1174.6193665968601	0	1.4451984491764522								100.0	Confident
4036	Q02878	AIPQLQGYLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39612 (Experiment 1)	39612	67.205	579.834351	2+	2+	1157.65569253593	0	-1.3309555541889306								91.30434782608697	Confident
4037	P16401	ATGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 31998 (Experiment 1)	31998	58.054	606.845276	2+	2+	1211.6761531969903	0	-0.126993321808018								100.0	Confident
4038	P07900	LGIHEDSQNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9216 (Experiment 1)	9216	27.098	584.789978	2+	2+	1167.5632487030703	0	1.8420008507519126								99.73118279569893	Confident
4039	P54886	LNSLAIGLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34543 (Experiment 1)	34543	60.993	478.79834	2+	2+	955.5814649665101	0	0.6914187753356157								100.0	Confident
4040	Q9BTT0	IKDLSTVEALQNLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36070 (Experiment 1)	36070	62.803	524.637634	3+	3+	1570.8930222488204	0	-1.238726004933748								97.82608695652173	Confident
4041	P60709, P62736, P63261, P63267, P68032, P68133	DSYVGDEAQSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12316 (Experiment 1)	12316	32.661	599.764221	2+	2+	1197.5149610979704	0	-0.8937100604557575								100.0	Confident
4042	P46778	VYNVTQHAVGIVVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 28087 (Experiment 1)	28087	53.501	820.960144	2+	2+	1639.9045899920304	0	0.6973999605233303								99.72826086956522	Confident
4043	P25098, P35626	KKPHASVGTHGYMAPEVLQK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.61 min, Period: 1, Cycle(s): 14995 (Experiment 1)	14995	36.819	565.285156	4+	4+	2257.1078733861905	0	1.6119087851778686	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 99.03069466882067)	Y12	1		0	100.0	Doubtful
4044	Q9UN86	NSSYVHGGVDASGKPQEAVYGQNDIHHK	Phosphorylation of Y(20)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15200 (Experiment 1)	15200	37.176	615.680847	5+	5+	3073.36794013083	0	-0.028412411429819522	Phosphorylation of Y (20: Doubtfull)	Phosphorylation of Y (20: 6.852167603129168)	Phosphorylation of Y (20: 16.05584642233857)		0	Y20-{Y4 Y20}	1	100.0	Doubtful
4045	P13639	FSVSPVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27421 (Experiment 1)	27421	52.719	445.758026	2+	2+	889.5021520166501	0	-0.7324038579314754								100.0	Confident
4046	P10412, P16402, P16403	SGVSLAALK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29103 (Experiment 1)	29103	54.696	423.257996	2+	2+	844.5018176634801	0	-0.4472413259586369								99.72826086956522	Confident
4047	Q13151	EDIYSGGGGGGSR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.47 min, Period: 1, Cycle(s): 9683 (Experiment 1)	9683	28.006	646.251282	2+	2+	1290.48777398149	0	0.18343091606258902	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
4048	P22102	AVQEIMQEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18453 (Experiment 1)	18453	41.606	538.275696	2+	2+	1074.5379454720203	0	-1.0277303206195043								94.85094850948511	Confident
4049	Q00610	EAIDSYIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27083 (Experiment 1)	27083	52.322	469.744781	2+	2+	937.4756624852903	0	-0.6955036928558229								96.53333333333333	Confident
4050	P00491	ACVMMQGR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14614 (Experiment 1)	14614	36.211	476.71167	2+	2+	951.4088629621101	0	-0.07960338786095544								99.72826086956522	Confident
4051	P06576	VALVYGQMNEPPGAR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31427 (Experiment 1)	31427	57.386	841.395081	2+	2+	1680.76949221935	0	3.6349566324149145	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
4052	Q07955	TKDIEDVFYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30526 (Experiment 1)	30526	56.336	629.322266	2+	2+	1256.6288686514004	0	0.8822315808316625								99.74358974358975	Confident
4053	P60709, P63261	GYSFTTTAER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21283 (Experiment 1)	21283	45.127	606.750427	2+	2+	1211.4859830763403	0	0.26204358879054046	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
4054	P67809	RPQYSNPPVQGEVMEGADNQGAGEQGRPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20382 (Experiment 1)	20382	43.988	806.638794	4+	4+	3222.5224701020907	0	1.115751778990133								100.0	Doubtful
4055	P52597	DLSYCLSGMYDHR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37951 (Experiment 1)	37951	65.073	539.565735	3+	3+	1615.6759125801502	0	-0.3317361680537621								98.7012987012987	Confident
4056	P14618	ITLDNAYMEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30047 (Experiment 1)	30047	55.783	639.277466	2+	2+	1276.5410554243103	0	-0.529001578077058	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73333333333333	Confident
4057	O94760	DYAVSTVPVADGLHLK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39894 (Experiment 1)	39894	67.589	882.931335	2+	2+	1763.8495163618604	0	-0.79241404189577	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 95.79967689822294)	Y2	1		0	95.2127659574468	Confident
4058	P61604	VVLDDKDYFLFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44133 (Experiment 1)	44133	74.416	510.604889	3+	3+	1528.7925799315603	0	0.16821098048337493								100.0	Confident
4059	Q96PK6	ASYVAPLTAQPATYR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32200 (Experiment 1)	32200	58.284	844.90686	2+	2+	1687.7970868661803	0	1.23102489454065	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 2.609972437985359)	Phosphorylation of Y (3: 99.35379644588045)		0	Y3-{Y3 Y14}	1	99.73262032085562	Confident
4060	Q9Y676	DHGLLIYHIPQVEPR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40382 (Experiment 1)	40382	68.307	622.982483	3+	3+	1865.9189333343604	0	3.5775693574833825	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Confident
4061	P14618	NTGIICTIGPASR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29745 (Experiment 1)	29745	55.434	680.357422	2+	2+	1358.6976340009	0	1.9527020492651181								100.0	Confident
4062	P24539	HYLFDVQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29245 (Experiment 1)	29245	54.855	539.277283	2+	2+	1076.5403284305203	0	-0.2923950833172539								99.73333333333333	Confident
4063	Q15365	AITIAGVPQSVTECVK		Carbamidomethylation of C(14)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38683 (Experiment 1)	38683	65.968	836.950562	2+	2+	1671.8865569693905	0	0.008421635670721182								99.7289972899729	Confident
4064	P04075	PYQYPALTPEQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29280 (Experiment 1)	29280	54.896	757.852356	2+	2+	1513.6854111588805	0	3.1324850615800175	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.972715810322882)	Phosphorylation of Y (2: 18.163056441313046)		0	Y2-{Y2 Y4}	1	99.73262032085562	Confident
4065	Q15477	TIYTSPIK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21261 (Experiment 1)	21261	45.091	501.747314	2+	2+	1001.4834638952002	0	-3.3770159654077725	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 96.33507853403141)	Y3	1		0	96.19565217391303	Confident
4066	P28482	GQVFDVGPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26644 (Experiment 1)	26644	51.812	487.756287	2+	2+	973.4981292653699	0	-0.11091500484366275								99.45652173913044	Confident
4067	P62277	LTSDDVKEQIYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20702 (Experiment 1)	20702	44.359	759.857361	2+	2+	1517.7014551458406	0	-0.8462630240945492	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 96.33507853403141)	Y11	1		0	99.1869918699187	Confident
4068	Q9UI08	QVYGLNFASK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35321 (Experiment 1)	35321	61.892	603.78186	2+	2+	1205.5481894100803	0	0.809611179059852	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4069	Q16658	LVARPEPATGYTLEFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34233 (Experiment 1)	34233	60.632	607.328369	3+	3+	1818.9628331441406	0	0.24394026594087861								100.0	Confident
4070	Q9NUU7, Q9UMR2	HSMNILNR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17091 (Experiment 1)	17091	39.716	492.756134	2+	2+	983.4970837195501	0	0.6406284841611126								98.91598915989161	Confident
4071	O75832	DHYEATAMHR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8403 (Experiment 1)	8403	25.342	437.504272	3+	3+	1309.4910855401201	0	-0.07538253910984205	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4072	Q9NWQ8	ENDYESISDLQQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30233 (Experiment 1)	30233	56.0	867.355408	2+	2+	1732.6941379192701	0	1.2250743406946927	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
4073	P22090, P62701, Q8TD47	LTGVFAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27111 (Experiment 1)	27111	52.355	430.753265	2+	2+	859.4915873329501	0	0.45238612679414425								99.72826086956522	Confident
4074	O00571, O15523, P17844, Q92841, Q9NQI0	YLVLDEADR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31582 (Experiment 1)	31582	57.573	547.280518	2+	2+	1092.5451390274402	0	1.227926576854703								93.6	Confident
4075	O75390	IVPNVLLEQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35466 (Experiment 1)	35466	62.06	605.363831	2+	2+	1208.7128730588802	0	0.1949303291724756								99.72826086956522	Confident
4076	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35276 (Experiment 1)	35276	61.841	630.797974	2+	2+	1259.5798834611805	0	1.1981704671579947	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	100.0	Confident
4077	P09874	AEPVEVVAPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21430 (Experiment 1)	21430	45.34	533.798828	2+	2+	1065.5818588893303	0	1.1654001752776975								99.73544973544973	Confident
4078	P36578	NVTLPAVFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40489 (Experiment 1)	40489	68.458	494.795105	2+	2+	987.5753169569105	0	0.34368729504117634								100.0	Confident
4079	P06748	VDNDENEHQLSLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17122 (Experiment 1)	17122	39.756	523.58197	3+	3+	1567.7226624484301	0	0.9028528452551715								100.0	Confident
4080	P49588	NSSHAGAFVIVTEEAIAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39292 (Experiment 1)	39292	66.752	615.322998	3+	3+	1842.947577002821	0	-0.22340741701509953								100.0	Confident
4081	P55072	EVDIGIPDATGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34188 (Experiment 1)	34188	60.58	621.81958	2+	2+	1241.6251802532902	0	-0.4608946619221458								99.7289972899729	Confident
4082	Q02543	KSSGEIVYCGQVFEK	Phosphorylation of Y(8)	Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29249 (Experiment 1)	29249	54.861	905.908997	2+	2+	1809.8008519172806	0	1.4290358103242127	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.30191972076788)	Y8	1		0	99.7340425531915	Confident
4083	P31943	IQNGAQGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.45 min, Period: 1, Cycle(s): 9251 (Experiment 1)	9251	27.162	478.766937	2+	2+	955.5199273391102	0	-0.6331602115576053								92.8388746803069	Confident
4084	P10809	IGIEIIKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26267 (Experiment 1)	26267	51.382	471.311157	2+	2+	940.6069514383603	0	0.8589110390582481								100.0	Confident
4085	Q8TCJ2	ESDYFTPQGEFR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37916 (Experiment 1)	37916	65.03	778.308899	2+	2+	1554.6028037337305	0	0.2835203163018	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
4086	P31146	KLQATVQELQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16792 (Experiment 1)	16792	39.319	429.254333	3+	3+	1284.7401504358804	0	0.7914224052348164								100.0	Confident
4087	P61160	ILLTEPPMNPTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34406 (Experiment 1)	34406	60.833	677.377991	2+	2+	1352.73737355456	0	2.9935457085953034								92.22520107238606	Confident
4088	P62937, PPIA_HUMAN	KITIADCGQLE		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27731 (Experiment 1)	27731	53.091	624.318909	2+	2+	1246.62273772514	0	0.4223334027290332								99.73684210526315	Confident
4089	Q9Y277	GYGFGMVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31258 (Experiment 1)	31258	57.186	429.71225	2+	2+	857.4105601309302	0	-0.7133426110540393								92.40837696335078	Confident
4090	Q09028, Q16576	TVALWDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43648 (Experiment 1)	43648	73.51	487.277069	2+	2+	972.53926580136	0	0.32760121598452613								99.7289972899729	Confident
4091	Q9UQ80	AAHLCAEAALR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17077 (Experiment 1)	17077	39.699	394.873199	3+	3+	1181.5975260368102	0	0.2039159268619336								99.3975903614458	Confident
4092	P32969	FLDGIYVSEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38856 (Experiment 1)	38856	66.184	585.805481	2+	2+	1169.5968402471303	0	-0.36802369541069774								100.0	Confident
4093	P11310	IYQIYEGTSQIQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32346 (Experiment 1)	32346	58.45	839.896484	2+	2+	1677.7763514216003	0	1.2285128882048018	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 20.42149717361628)	Phosphorylation of Y (5: 15.18324607329843)		0	Y5-{Y2 Y5}	1	100.0	Confident
4094	Q06830	ADEGISFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23987 (Experiment 1)	23987	48.698	447.719818	2+	2+	893.4242956187702	0	0.8793985285578306								100.0	Confident
4095	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32797 (Experiment 1)	32797	58.967	630.797302	2+	2+	1259.5798834611805	0	0.13285188200473977	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4096	P62136	NVQLTENEIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 23116 (Experiment 1)	23116	47.586	608.320007	2+	2+	1214.6255146064602	0	-0.04400651083059111								98.91598915989161	Confident
4097	Q07955	EAGDVCYADVYR		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28442 (Experiment 1)	28442	53.928	709.306213	2+	2+	1416.59797952928	0	-0.0750472041554633								100.0	Confident
4098	P62241	NCIVLIDSTPYR		Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38700 (Experiment 1)	38700	65.988	725.872498	2+	2+	1449.7285997760102	0	1.2697083241435987								100.0	Confident
4099	P29144	VPITAVIAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31297 (Experiment 1)	31297	57.234	491.817841	2+	2+	981.6222671493304	0	-1.1570154055463737								92.85714285714286	Confident
4100	P06733	IGAEVYHNLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17781 (Experiment 1)	17781	40.657	572.312073	2+	2+	1142.6084079903403	0	1.035341834045637								100.0	Confident
4101	B2RPK0, P09429	IKGEHPGLSIGDVAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19791 (Experiment 1)	19791	43.279	507.619293	3+	3+	1519.8358417258703	0	0.13650237825518233								100.0	Confident
4102	P14550, Q96JD6	SPAQILLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30977 (Experiment 1)	30977	56.859	449.280151	2+	2+	896.5443511818	0	1.5556960925096066								99.7340425531915	Confident
4103	P23396	GGKPEPPAMPQPVPTA			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27752 (Experiment 1)	27752	53.117	787.406311	2+	2+	1572.7970136890003	0	0.6701610515309474								96.46739130434783	Confident
4104	Q9NSD9	TYTIANQFPLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37589 (Experiment 1)	37589	64.639	705.375488	2+	2+	1408.7350650554401	0	0.9626165539438805								97.289972899729	Confident
4105	P24752	DGLTDVYNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24725 (Experiment 1)	24725	49.591	512.751282	2+	2+	1023.4872897981502	0	0.7033319644165092								99.45652173913044	Confident
4106	Q8N163	TLAAEMQELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35691 (Experiment 1)	35691	62.323	581.298462	2+	2+	1160.5859582936002	0	-3.0855200817490114								99.72826086956522	Confident
4107	P29218	KIEFGVVYSCVEGK	Phosphorylation of Y(8)	Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37356 (Experiment 1)	37356	64.352	565.599915	3+	3+	1693.7786599207204	0	-0.4386615639693402	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
4108	P63241, Q6IS14, Q9GZV4	KYEDICPSTHNMDVPNIK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26432 (Experiment 1)	26432	51.572	541.007507	4+	4+	2159.9979749765102	0	1.361885101936965								100.0	Doubtful
4109	Q07955	SHEGETAYIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11270 (Experiment 1)	11270	30.978	388.187805	3+	3+	1161.54145062933	0	0.11589772443367119								100.0	Confident
4110	P46777	HIMGQNVADYMR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28319 (Experiment 1)	28319	53.783	478.891663	3+	3+	1433.6543892899301	0	-0.8559272786263593								100.0	Confident
4111	Q14204	TPVIDADKPVSSQLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23461 (Experiment 1)	23461	48.011	542.63446	3+	3+	1624.8784348138404	0	1.9139905509492696								92.14285714285715	Doubtful
4112	P35579	VIQYLAYVASSHK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34798 (Experiment 1)	34798	61.286	520.261108	3+	3+	1557.7592448054806	0	1.4414539749675617	Phosphorylation of Y (4: Doubtfull)	Phosphorylation of Y (4: 2.0781118667818306)	Phosphorylation of Y (4: 0.17452006980802792)		0	Y4-{Y4 Y7}	1	100.0	Confident
4113	P62316	SEMTPEELQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19604 (Experiment 1)	19604	43.035	596.780029	2+	2+	1190.5489040785403	1	-5.663304476431165								96.24664879356568	Doubtful
4114	Q13094	ESQVYLLGTGLR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.23 min, Period: 1, Cycle(s): 43831 (Experiment 1)	43831	73.838	708.351074	2+	2+	1414.68574551205	0	1.3055367658929231	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 98.60383944153578)	Y5	1		0	99.1869918699187	Confident
4115	P62750	NKLDHYAIIK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20526 (Experiment 1)	20526	44.16	647.831909	2+	2+	1293.6482378045202	0	0.7928466132859163	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4116	P22234	EVYELLDSPGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35222 (Experiment 1)	35222	61.779	665.304382	2+	2+	1328.59011379171	0	3.0792577001051944	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.20767888307155)	Y3	1		0	96.75675675675676	Confident
4117	P50402	DSAYQSITHYRPVSASR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23405 (Experiment 1)	23405	47.943	673.309387	3+	3+	2016.9054680981903	0	0.4274913136219447	Phosphorylation of Y (10: Doubtfull)	Phosphorylation of Y (10: 1.7473451480274487)	Phosphorylation of Y (10: 99.82547993019197)		0	Y10-{Y4 Y10}	1	100.0	Confident
4118	Q13547, Q92769	YGEYFPGTGDLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37112 (Experiment 1)	37112	64.062	687.818237	2+	2+	1373.6251802532902	0	-2.3692154535761745								93.78378378378378	Confident
4119	P29401	KAYGQALAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.40 min, Period: 1, Cycle(s): 7740 (Experiment 1)	7740	23.939	475.275574	2+	2+	948.5392658013602	0	-2.8096620427825996								100.0	Confident
4120	P15927	APTNIVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17605 (Experiment 1)	17605	40.429	493.240936	2+	2+	984.4681481842304	0	-0.8404788582543061	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 90.57591623036649)	Y7	1		0	92.3076923076923	Confident
4121	P52209	SFLEDIRK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28523 (Experiment 1)	28523	54.023	504.279694	2+	2+	1006.5447451046202	0	0.08919828118843191								99.73118279569893	Confident
4122	Q9NWQ8	SGQSLTVPESTYTSIQGDPQR	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31233 (Experiment 1)	31233	57.159	777.688232	3+	3+	2330.0427494166406	0	0.05022703792299972	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 96.33507853403141)	Y12	1		0	97.77777777777777	Confident
4123	P60174	VTNGAFTGEISPGMIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39648 (Experiment 1)	39648	67.254	811.910828	2+	2+	1620.8181430564	1	-8.870185977723754								99.19354838709677	Doubtful
4124	P04899	IAQSDYIPTQQDVLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35617 (Experiment 1)	35617	62.235	873.955811	2+	2+	1745.8948131539703	0	1.2906346572727356								96.19565217391303	Confident
4125	Q6P2Q9	TNHIYVSSDDIK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 21896 (Experiment 1)	21896	46.088	736.325623	2+	2+	1470.6391892424504	0	-1.6950190008090193	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
4126	O95433	ETFLTSPEELYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42286 (Experiment 1)	42286	71.176	742.866943	2+	2+	1483.7194745609504	0	-0.0952354674155909								96.53333333333333	Confident
4127	P11021	NELESYAYSLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37793 (Experiment 1)	37793	64.882	658.823059	2+	2+	1315.6295969273904	0	1.4936802061341405								100.0	Confident
4128	P40939	VIGMHYFSPVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32529 (Experiment 1)	32529	58.665	464.904663	3+	3+	1391.6907577153104	0	1.0051420390146735								99.37888198757764	Confident
4129	P07954	IYELAAGGTAVGTGLNTR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36219 (Experiment 1)	36219	63.001	922.451904	2+	2+	1842.88769277573	0	0.8468148648052588	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.83844911147011)	Y2	1		0	99.7340425531915	Confident
4130	P62820, Q9H0U4	YASENVNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6529 (Experiment 1)	6529	21.131	462.725464	2+	2+	923.4348603024703	0	1.636787364197296								94.08602150537635	Confident
4131	P68104, Q05639, Q5VTE0	STTTGHLIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 13956 (Experiment 1)	13956	35.209	600.786926	2+	2+	1199.5587540937802	0	0.45354918628356355	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
4132	Q99714	DLAPIGIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33140 (Experiment 1)	33140	59.358	427.75827	2+	2+	853.5021520166501	0	-0.19280777703464194								99.45799457994579	Confident
4133	Q9UL46	DEAAYGELR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19118 (Experiment 1)	19118	42.446	552.22406	2+	2+	1102.43321922749	0	0.314943716254065	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.83844911147011)	Y5	1		0	100.0	Confident
4134	P37837	LSFDKDAMVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26676 (Experiment 1)	26676	51.85	418.216156	3+	3+	1251.6281574587504	0	-1.210583989296256								100.0	Confident
4135	P55209, Q99733	FYEEVHDLER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 26027 (Experiment 1)	26027	51.104	708.794922	2+	2+	1415.5758607099003	0	-0.4018392893347479	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 96.33507853403141)	Y2	1		0	97.8319783197832	Confident
4136	P14314	SLEDQVEMLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39049 (Experiment 1)	39049	66.419	610.302917	2+	2+	1218.5914375968603	0	-0.12823997724127517								99.73045822102425	Confident
4137	P04229, P13760, P13761, P20039, P79483, Q29974, Q30134, Q30154, Q30167, Q9TQE0	HNYGVGESFTVQR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25351 (Experiment 1)	25351	50.315	525.231812	3+	3+	1572.6722207062305	0	0.8795446892009536	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4138	P40925	FVEGLPINDFSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43557 (Experiment 1)	43557	73.35	697.358643	2+	2+	1392.7037649271604	0	-0.739834539517428								99.72826086956522	Confident
4139	P51991	IETIEVMEDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32846 (Experiment 1)	32846	59.023	617.803772	2+	2+	1233.5911032436902	0	1.5278520911304883								100.0	Confident
4140	Q96AE4	IGGNEGIDVPIPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36722 (Experiment 1)	36722	63.595	668.864258	2+	2+	1335.71466396403	0	-0.523945837031761								100.0	Confident
4141	P00519	LKPAPPPPPAASAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.54 min, Period: 1, Cycle(s): 12252 (Experiment 1)	12252	32.544	466.941681	3+	3+	1397.8030850456103	0	0.09177017942623132								100.0	Confident
4142	O14745	LLVVDPETDEQLQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35353 (Experiment 1)	35353	61.93	813.934387	2+	2+	1625.8512170064905	0	1.845397784536459								100.0	Confident
4143	Q9NSD9	AAGASDVVLYK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24888 (Experiment 1)	24888	49.777	587.280823	2+	2+	1172.5478550569103	0	-0.6487441868947983	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
4144	P47914	AQAAAPASVPAQAPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.60 min, Period: 1, Cycle(s): 14631 (Experiment 1)	14631	36.239	689.378113	2+	2+	1376.7412130650405	0	0.3336351126755842								92.65822784810128	Confident
4145	P62805	KTVTAMDVVYALKR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42254 (Experiment 1)	42254	71.121	558.960693	3+	3+	1673.8575789477604	0	1.59263199861582	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
4146	P12956	ILELDQFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40125 (Experiment 1)	40125	67.893	503.28476	2+	2+	1004.5542471591602	0	0.7152091499224291								99.72972972972973	Confident
4147	Q9UPN3	DASSCQEQLDEFRK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36560 (Experiment 1)	36560	63.401	571.593079	3+	3+	1711.7471629441104	0	5.974364768256402								92.61744966442953	Doubtful
4148	A5A3E0, P0CG38, P0CG39, P60709, P63261, Q6S8J3, Q9BYX7	QEYDESGPSIVHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18090 (Experiment 1)	18090	41.122	758.854309	2+	2+	1515.6953850714303	0	-0.8697347375413539								100.0	Confident
4149	O15143	FAVGSGSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12403 (Experiment 1)	12403	32.796	390.703979	2+	2+	779.3926015676702	0	1.0282714987123562								98.6449864498645	Confident
4150	P63272	VSNFKPGVYAVSVTGR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29893 (Experiment 1)	29893	55.604	587.628357	3+	3+	1759.8658351323406	0	-1.471184368997482	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
4151	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33268 (Experiment 1)	33268	59.501	630.797485	2+	2+	1259.5798834611805	0	0.4229609611623073	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4152	O14744	YSQYQQAIYK	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21406 (Experiment 1)	21406	45.299	686.302551	2+	2+	1370.5907824980504	0	-0.1700646708574275	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 11.237190579900766)	Phosphorylation of Y (9: 5.410122164048866)		0	Y9-{Y1 Y4 Y9}	1	99.72826086956522	Confident
4153	P07737	CYEMASHLR	Phosphorylation of Y(2)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16260 (Experiment 1)	16260	38.671	623.741333	2+	2+	1245.4671792914	0	0.7485279758399663	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
4154	P13639	CLYASVLTAQPR	Phosphorylation of Y(3)	Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36162 (Experiment 1)	36162	62.932	729.844055	2+	2+	1457.6738009293601	0	-0.16706510234814229	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4155	P36873, P62136, P62140	IYGFYDECK		Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33865 (Experiment 1)	33865	60.19	597.760498	2+	2+	1193.5063109905702	0	0.11047553378688013								99.45799457994579	Confident
4156	P09651	NQGGYGGSSSSSSYGSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10553 (Experiment 1)	10553	29.689	847.854614	2+	2+	1693.6928188721301	0	1.0946430242091512								99.7289972899729	Confident
4157	P37802, Q9UI15	GASQAGMTGYGMPR	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22391 (Experiment 1)	22391	46.717	732.295105	2+	2+	1462.57343526509	0	1.5170145486948583	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
4158	P11940, Q9H361	IVATKPLYVALAQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36772 (Experiment 1)	36772	63.653	541.639038	3+	3+	1621.8956787086404	0	-0.24254097474466346	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
4159	P07737	TLVLLMGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40439 (Experiment 1)	40439	68.386	437.775177	2+	2+	873.5357606440502	0	0.04616790741010339								99.7289972899729	Confident
4160	P49588	ITCLCQVPQNAANR		Carbamidomethylation of C(3, 5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22416 (Experiment 1)	22416	46.749	822.900085	2+	2+	1643.78719436463	0	-0.958376825654924								96.48648648648648	Confident
4161	Q14103	KYHNVGLSK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.34 min, Period: 1, Cycle(s): 6300 (Experiment 1)	6300	20.687	563.280029	2+	2+	1124.5379590795503	0	6.698300119252516	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.03069466882067)	Y2	1		0	99.72826086956522	Doubtful
4162	Q86SX6	DYAAYNVLDDPELR	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45941 (Experiment 1)	45941	78.651	867.373413	2+	2+	1732.7345461792702	0	-1.3103410144064958	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 7.4692137759741675)	Phosphorylation of Y (2: 92.08400646203555)		0	Y2-{Y2 Y5}	1	92.7807486631016	Doubtful
4163	P62861	FVNVVPTFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 39986 (Experiment 1)	39986	67.72	554.31366	2+	2+	1106.61243074162	0	0.30337053020348465								100.0	Confident
4164	P14625, Q58FF3	GLFDEYGSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34808 (Experiment 1)	34808	61.297	508.240723	2+	2+	1014.4658260775802	0	1.049689514807535								100.0	Confident
4165	P84098	HMYHSLYLK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18432 (Experiment 1)	18432	41.578	636.286133	2+	2+	1270.5569802719701	0	0.5758374963610576	Phosphorylation of Y (3: Doubtfull)	Phosphorylation of Y (3: 35.337280524172684)	Phosphorylation of Y (3: 52.827140549273025)		0	Y3-{Y3 Y7}	1	100.0	Confident
4166	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31448 (Experiment 1)	31448	57.41	609.984253	3+	3+	1826.9315330158604	0	-0.32974408473564615								100.0	Confident
4167	P33993	RFELYFQGPSSNKPR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33204 (Experiment 1)	33204	59.429	635.971191	3+	3+	1904.8934468625102	0	-0.8927351058952244	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
4168	P62081	ELNITAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18770 (Experiment 1)	18770	42.012	430.248535	2+	2+	858.4810822189004	0	1.6674663032460038								99.45652173913044	Confident
4169	P15880	AEDKEWMPVTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22684 (Experiment 1)	22684	47.072	445.219971	3+	3+	1332.6383877892802	0	-0.2277448353064767								99.37888198757764	Confident
4170	O43809	LMTEILGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34635 (Experiment 1)	34635	61.098	466.765686	2+	2+	931.5160878286301	0	0.783303422567989								95.6639566395664	Confident
4171	P05455	IIEDQQESLNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.63 min, Period: 1, Cycle(s): 15521 (Experiment 1)	15521	37.644	658.837708	2+	2+	1315.6619596848302	0	-0.8322364736797345								97.289972899729	Confident
4172	P78527	HVMQPYYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13435 (Experiment 1)	13435	34.376	533.263733	2+	2+	1064.5113368013604	0	1.477943508612622								99.45799457994579	Confident
4173	O15143	NSVSQISVLSGGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 29230 (Experiment 1)	29230	54.839	638.34845	2+	2+	1274.6830294825802	0	-0.5345167201893425								100.0	Confident
4174	P12268	AMMYSGELK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25746 (Experiment 1)	25746	50.782	515.239258	2+	2+	1028.46708903088	0	-3.0334984894511523								99.45799457994579	Confident
4175	Q9H0U4	GAHGIIVVYDVTDQESYANVK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38627 (Experiment 1)	38627	65.901	760.052917	3+	3+	2277.1277261927603	0	4.032808629047319								100.0	Confident
4176	P11142	LDKSQIHDIVLVGGSTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29799 (Experiment 1)	29799	55.495	613.342102	3+	3+	1837.0057605852803	0	-0.6978078608943535								100.0	Confident
4177	P10809	LSDGVAVLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24676 (Experiment 1)	24676	49.532	451.271454	2+	2+	900.5280324113203	0	0.3574956584323021								100.0	Confident
4178	P14625	IYFMAGSSR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 30906 (Experiment 1)	30906	56.776	516.252808	2+	2+	1030.4906013567802	0	0.4471741314463298								99.74811083123426	Confident
4179	P51149	ATIGADFLTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36761 (Experiment 1)	36761	63.64	518.787476	2+	2+	1035.56006081559	0	0.32600140870309097								100.0	Confident
4180	Q09161	ANNYNEAVYLVR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38951 (Experiment 1)	38951	66.293	753.343018	2+	2+	1504.6711580770705	0	0.2156981400164951	Phosphorylation of Y (9: Doubtfull)	Phosphorylation of Y (9: 14.843030457417184)	Phosphorylation of Y (9: 99.82547993019197)		0	Y9-{Y4 Y9}	1	100.0	Confident
4181	Q15283	DAIYTIPVK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32553 (Experiment 1)	32553	58.691	550.275513	2+	2+	1098.5362277440504	0	0.22290868341689646	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 94.58987783595113)	Y4	1		0	99.01477832512316	Confident
4182	P29144	VNESSHYDLAFTDVHFKPGQIR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35701 (Experiment 1)	35701	62.335	660.812988	4+	4+	2639.216965810851	0	2.224659279289469	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 97.90575916230367)	Y7	1		0	100.0	Doubtful
4183	P14324	LKEVLEYNAIGGK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28604 (Experiment 1)	28604	54.115	757.387695	2+	2+	1512.7589104523101	0	1.2718826361119282	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 96.50959860383944)	Y7	1		0	98.68766404199475	Confident
4184	P04075	PYQYPALTPEQK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29505 (Experiment 1)	29505	55.155	757.850769	2+	2+	1513.6854111588805	0	1.0384030696701816	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 10.972715810322882)	Phosphorylation of Y (2: 0.0)		0	Y2-{Y2 Y4}	1	100.0	Confident
4185	P04908, P0C0S5, P0C0S8, P16104, P20671, Q16777, Q6FI13, Q71UI9, Q7L7L0, Q8IUE6, Q93077, Q96KK5, Q96QV6, Q99878, Q9BTM1	AGLQFPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.00 min, Period: 1, Cycle(s): 33696 (Experiment 1)	33696	59.995	472.769562	2+	2+	943.5239500903901	0	0.6567432039700222								99.72972972972973	Confident
4186	P10412, P16402, P16403	KASGPPVSELITK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23649 (Experiment 1)	23649	48.25	663.885071	2+	2+	1325.7554661468505	0	0.09257591576236822								100.0	Confident
4187	P62241	IIDVVYNASNNELVR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41298 (Experiment 1)	41298	69.599	899.940125	2+	2+	1797.8662290551604	0	-0.29556890095761423	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.47643979057592)	Y6	1		0	99.45945945945947	Confident
4188	O00629	IEQLQNHENEDIYK	Phosphorylation of Y(13)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18573 (Experiment 1)	18573	41.759	618.275574	3+	3+	1851.8040227214206	0	0.46898103256817697	Phosphorylation of Y (13: Very Confident)	Phosphorylation of Y (13: 100.0)	Phosphorylation of Y (13: 99.67689822294022)	Y13	1		0	100.0	Confident
4189	P26368	SIEIPRPVDGVEVPGCGK		Carbamidomethylation of C(16)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35402 (Experiment 1)	35402	61.988	636.997192	3+	3+	1907.9774972321102	0	-4.055800772942574								100.0	Confident
4190	P46777	EFNAEVHR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.53 min, Period: 1, Cycle(s): 11633 (Experiment 1)	11633	31.518	501.245209	2+	2+	1000.4726427935202	0	3.2142783165560704								99.72972972972973	Confident
4191	P09651	SSGPYGGGGQYFAKPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20463 (Experiment 1)	20463	44.088	543.599365	3+	3+	1627.7743040984703	0	1.2027874321517376								100.0	Confident
4192	P04406	VIISAPSADAPMFVMGVNHEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42740 (Experiment 1)	42740	71.974	738.37616	3+	3+	2212.10204612223	0	2.0786545549351074								100.0	Confident
4193	P07737	CYEMASHLR		Carbamidomethylation of C(1)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 16891 (Experiment 1)	16891	39.444	583.757141	2+	2+	1165.50084877065	0	-0.959048824902878								99.72826086956522	Confident
4194	P38919	LDYGQHVVAGTPGR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17757 (Experiment 1)	17757	40.626	775.360718	2+	2+	1548.7086062149504	0	-1.1111903271000907	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.83844911147011)	Y3	1		0	100.0	Confident
4195	P31939	NGNYCVLQMDQSYKPDENEVR	Phosphorylation of Y(4)	Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37638 (Experiment 1)	37638	64.699	880.69696	3+	3+	2638.0829170598004	1	-6.520490359070174	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 13: 0.0)	Phosphorylation of Y (4: 38.21989528795812)		0	Y4-{Y4 Y13}	1	100.0	Doubtful
4196	P04083	NALLSLAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32085 (Experiment 1)	32085	58.153	415.261871	2+	2+	828.5069030439204	0	2.752514627075214								99.19354838709677	Confident
4197	Q9NR30	EEYQLVQVEQK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26862 (Experiment 1)	26862	52.065	736.83728	2+	2+	1471.6595903338605	0	0.28278471004508154	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4198	P52907	DHYSNGFCTVYAK	Phosphorylation of Y(3)	Carbamidomethylation of C(8)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26552 (Experiment 1)	26552	51.708	547.884705	3+	3+	1640.6330583161905	0	-0.47012096760114824	Phosphorylation of Y (3: Random)	Phosphorylation of Y (3: 0.0, 11: 0.0)	Phosphorylation of Y (3: 99.82547993019197)		0	Y3-{Y3 Y11}	1	100.0	Confident
4199	P04632	THYSNIEANESEEVR	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16754 (Experiment 1)	16754	39.272	619.926758	3+	3+	1856.7578008049907	0	0.3461671279419694	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 100.0)	Y3	1		0	100.0	Confident
4200	Q8IXB1	ASNLLYGQLK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34759 (Experiment 1)	34759	61.239	593.797485	2+	2+	1185.5794895383603	0	0.7810143722835274	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 96.50959860383944)	Y6	1		0	96.22641509433963	Confident
4201	P62258	EAAENSLVAYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.79 min, Period: 1, Cycle(s): 22846 (Experiment 1)	22846	47.261	597.805176	2+	2+	1193.5928174958503	0	2.4937706133109625								100.0	Confident
4202	Q92841	SSQSSSQQFSGIGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19157 (Experiment 1)	19157	42.494	728.343018	2+	2+	1454.6749839800202	0	-2.4033354778670413								100.0	Confident
4203	P68104, Q05639, Q5VTE0	QTVAVGVIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.76 min, Period: 1, Cycle(s): 21459 (Experiment 1)	21459	45.381	457.787262	2+	2+	913.5596668927701	0	0.3322216805386323								99.73190348525469	Confident
4204	P15153, P60763, P63000	TVFDEAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30582 (Experiment 1)	30582	56.401	475.751099	2+	2+	949.4868958753302	0	0.7873777247756093								99.45945945945947	Confident
4205	P17980	AMEVDERPTEQYSDIGGLDK	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29660 (Experiment 1)	29660	55.335	778.673462	3+	3+	2331.9930223429	1	0.9333640263173671	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 92.32111692844677)	Y12	1		0	92.64705882352942	Doubtful
4206	P18124	SVNELIYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28393 (Experiment 1)	28393	53.869	523.251709	2+	2+	1044.4892775516303	0	-0.3941555132289358	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 95.63812600969305)	Y7	1		0	99.46808510638297	Confident
4207	P31146	DRPHEGTRPVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.28 min, Period: 1, Cycle(s): 4160 (Experiment 1)	4160	16.737	440.569916	3+	3+	1318.6854295244202	0	1.883227262969117								97.74436090225565	Confident
4208	P36578	SNYNLPMHK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16574 (Experiment 1)	16574	39.049	395.170441	3+	3+	1182.4892946349703	0	0.16783022076366355	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 97.38219895287958)	Y3	1		0	97.74436090225565	Confident
4209	Q16630	GAAPNVVYTYTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28407 (Experiment 1)	28407	53.886	670.84491	2+	2+	1339.6772158261504	0	-1.4524645822724733								99.73190348525469	Confident
4210	P35579	TDLLLEPYNK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37159 (Experiment 1)	37159	64.118	603.324158	2+	2+	1204.6339540318402	0	-0.15826105381665062								100.0	Confident
4211	P06576	AHGGYSVFAGVGER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.88 min, Period: 1, Cycle(s): 27626 (Experiment 1)	27626	52.969	469.565033	3+	3+	1405.6738617812105	0	-0.42037584839543174								100.0	Confident
4212	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31663 (Experiment 1)	31663	57.667	565.800415	2+	2+	1129.58800689893	0	-1.528657335553891								99.73614775725594	Confident
4213	A6NNZ2, P04350, P07437, P68371, Q13885, Q3ZCM7, Q9BVA1	TAVCDIPPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17482 (Experiment 1)	17482	40.269	514.764404	2+	2+	1027.5120650773501	0	2.1271805773883936								100.0	Confident
4214	Q14157	RYPSSISSSPQKDLTQAK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20565 (Experiment 1)	20565	44.204	691.671753	3+	3+	2071.9939487494203	0	-0.25019079953661766	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 99.82547993019197)	Y2	1		0	100.0	Confident
4215	P50991	TLSGMESYCVR		Carbamidomethylation of C(9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27840 (Experiment 1)	27840	53.219	651.795105	2+	2+	1301.5744076337303	0	0.9584559883757202								99.48849104859335	Confident
4216	P13639	EDLYLKPIQR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26340 (Experiment 1)	26340	51.466	637.857727	2+	2+	1273.7030366511701	0	-1.6740262984495393								99.72826086956522	Confident
4217	O00303	VIGLSSDLQQVGGASAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35917 (Experiment 1)	35917	62.605	829.448303	2+	2+	1656.8794974430002	0	1.540558527577971								100.0	Confident
4218	Q15363	HEQEYMEVR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.58 min, Period: 1, Cycle(s): 13861 (Experiment 1)	13861	35.036	650.754089	2+	2+	1299.4955022142203	0	-1.442284550165707	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 100.0)	Y5	1		0	100.0	Confident
4219	P07900, Q58FG0	HIYYITGETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19728 (Experiment 1)	19728	43.198	612.816956	2+	2+	1223.6186383208703	0	0.5880597153170535								100.0	Confident
4220	P83881	DSLYAQGK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.51 min, Period: 1, Cycle(s): 11214 (Experiment 1)	11214	30.888	481.204407	2+	2+	960.3953771667902	0	-1.1596933689523377	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 98.70759289176091)	Y4	1		0	99.7289972899729	Confident
4221	P82979	FGLNVSSISR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35864 (Experiment 1)	35864	62.543	540.295532	2+	2+	1078.57710786206	0	-0.5522860354300596								92.49329758713137	Confident
4222	Q16658	YLTAEAFGFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.22 min, Period: 1, Cycle(s): 43306 (Experiment 1)	43306	72.983	573.796204	2+	2+	1145.5757108797304	0	1.8684252672942256								100.0	Confident
4223	P01889, P03989, P10319, P18463, P18464, P18465, P30460, P30461, P30462, P30464, P30466, P30475, P30479, P30480, P30481, P30483, P30484, P30485, P30486, P30487, P30488, P30490, P30491, P30492, P30493, P30495, P30498, P30685, Q04826, Q29718, Q29836, Q29940, Q31610, Q95365	DGEDQTQDTELVETRPAGDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20597 (Experiment 1)	20597	44.241	744.672302	3+	3+	2230.9938114707406	0	0.5663025807518456								100.0	Confident
4224	Q15084	LAAVDATVNQVLASR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.20 min, Period: 1, Cycle(s): 42829 (Experiment 1)	42829	72.123	764.428284	2+	2+	1526.8416553823001	0	0.23526350855679165								98.91304347826086	Confident
4225	Q96EP5	IFVGGIPHNCGETELR		Carbamidomethylation of C(10)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29850 (Experiment 1)	29850	55.554	600.30188	3+	3+	1797.8832029244504	0	0.337427628065573								99.24812030075188	Confident
4226	Q00839	KAVVVCPK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.37 min, Period: 1, Cycle(s): 6981 (Experiment 1)	6981	22.205	450.770325	2+	2+	899.5262585895102	0	-0.17916341896033933								99.73045822102425	Confident
4227	O94905	VTKPNIPEAIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20646 (Experiment 1)	20646	44.296	413.246552	3+	3+	1236.7190210684803	0	-0.9634827438801828								100.0	Confident
4228	P42224	SLEDLQDEYDFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.15 min, Period: 1, Cycle(s): 41033 (Experiment 1)	41033	69.226	751.341064	2+	2+	1500.6620192544804	0	3.6972772439843853								92.22520107238606	Confident
4229	A6NNZ2, P04350, P07437, P68371, Q13509, Q13885, Q3ZCM7, Q9BUF5, Q9BVA1, Q9H4B7	FPGQLNADLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32123 (Experiment 1)	32123	58.197	565.80127	2+	2+	1129.58800689893	0	-0.017526077370984817								100.0	Confident
4230	P29144	VNESSHYDLAFTDVHFKPGQIR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.04 min, Period: 1, Cycle(s): 35709 (Experiment 1)	35709	62.346	661.060974	4+	4+	2639.216965810851	1	-2.092319727121608	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 100.0)	Y7	1		0	100.0	Doubtful
4231	Q00839	DIDIHEVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20043 (Experiment 1)	20043	43.601	498.758423	2+	2+	995.5036085686302	0	-1.3187752412650207								100.0	Confident
4232	O43143	IIPLYSTLPPQQQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.11 min, Period: 1, Cycle(s): 39214 (Experiment 1)	39214	66.639	931.483154	2+	2+	1860.9498991094704	0	0.9962384969106813	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.82547993019197)	Y5	1		0	99.72826086956522	Confident
4233	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32335 (Experiment 1)	32335	58.437	630.797852	2+	2+	1259.5798834611805	0	1.004764414626586	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4234	Q8WUM4	TPSNELYKPLR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18778 (Experiment 1)	18778	42.022	699.344055	2+	2+	1396.6751808283502	0	-1.1609164885680485	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82547993019197)	Y7	1		0	99.73045822102425	Confident
4235	O60814, P06899, P23527, P33778, P57053, P58876, P62807, Q16778, Q5QNW6, Q8N257, Q93079, Q96A08, Q99877, Q99879, Q99880	LLLPGELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37966 (Experiment 1)	37966	65.093	477.305725	2+	2+	952.5957180483204	0	1.2350779072489533								100.0	Confident
4236	Q16658	LINRPIIVFR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35102 (Experiment 1)	35102	61.639	414.267639	3+	3+	1239.7815617553902	0	-0.38152118803056473								100.0	Confident
4237	Q15056	GSNMDFREPTEEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.72 min, Period: 1, Cycle(s): 19932 (Experiment 1)	19932	43.466	566.245911	3+	3+	1695.7158628158304	0	0.024008258374415902								100.0	Confident
4238	Q92841	NFYVEHPEVAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.77 min, Period: 1, Cycle(s): 22018 (Experiment 1)	22018	46.255	454.226166	3+	3+	1359.6571490879105	0	-0.3526056791145114								99.24812030075188	Confident
4239	P31942	DGMDNQGGYGSVGR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.62 min, Period: 1, Cycle(s): 15243 (Experiment 1)	15243	37.24	746.779968	2+	2+	1491.54497158778	0	0.27550197305389823	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
4240	Q15819	YPEAPPSVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18986 (Experiment 1)	18986	42.274	508.2659	2+	2+	1014.5134449763402	0	3.7402708470899144								95.13513513513514	Confident
4241	Q13162	LVQAFQYTDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28403 (Experiment 1)	28403	53.882	606.81665	2+	2+	1211.6186383208703	0	0.08960327244624773								99.45799457994579	Confident
4242	Q9UQ80	MGVVECAK		Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.55 min, Period: 1, Cycle(s): 12654 (Experiment 1)	12654	33.189	447.214661	2+	2+	892.4146595352001	0	0.12245930071110575								99.72972972972973	Confident
4243	P50914	VAYVSFGPHAGK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.81 min, Period: 1, Cycle(s): 23863 (Experiment 1)	23863	48.542	656.807739	2+	2+	1311.6012876121004	0	-0.27599067654784815	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.19224555735056)	Y3	1		0	99.7340425531915	Confident
4244	P16949	SKESVPEFPLSPPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32596 (Experiment 1)	32596	58.74	514.612854	3+	3+	1540.8137092989602	0	1.9583048375302088								100.0	Confident
4245	P13639	EGALCEENMR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17088 (Experiment 1)	17088	39.713	604.755859	2+	2+	1207.4961573130304	0	0.8331909233298739								100.0	Confident
4246	P68363, Q13748, Q6PEY2, Q71U36, Q9BQE3	TIGGGDDSFNTFFSETGAGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.29 min, Period: 1, Cycle(s): 45452 (Experiment 1)	45452	77.555	669.971069	3+	3+	2006.8857645919009	0	2.7926695138717657								100.0	Confident
4247	Q07955	EAGDVCYADVYR	Phosphorylation of Y(7)	Carbamidomethylation of C(6)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26947 (Experiment 1)	26947	52.163	749.289917	2+	2+	1496.5643100500301	0	0.64795812191609	Phosphorylation of Y (7: Doubtfull)	Phosphorylation of Y (7: 28.74570798076519)	Phosphorylation of Y (7: 0.0)		0	Y7-{Y7 Y11}	1	100.0	Confident
4248	P63104	GIVDQSQQAYQEAFEISKK	Phosphorylation of Y(10)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.02 min, Period: 1, Cycle(s): 34882 (Experiment 1)	34882	61.384	750.354126	3+	3+	2248.0412928646606	0	-0.33062826608177354	Phosphorylation of Y (10: Very Confident)	Phosphorylation of Y (10: 100.0)	Phosphorylation of Y (10: 100.0)	Y10	1		0	100.0	Confident
4249	O43175	VTADVINAAEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20907 (Experiment 1)	20907	44.6	565.806885	2+	2+	1129.5979028762904	0	1.1613428949530702								100.0	Confident
4250	P62318	VLHEAEGHIVTCETNTGEVYR		Carbamidomethylation of C(12)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20300 (Experiment 1)	20300	43.898	805.38501	3+	3+	2413.1332225793603	0	-0.009097014086420802								100.0	Confident
4251	P14618	LDIDSPPITAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32042 (Experiment 1)	32042	58.106	599.326599	2+	2+	1196.64010204144	0	-1.2155086189189261								100.0	Confident
4252	O75367	SIAFPSIGSGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37028 (Experiment 1)	37028	63.962	546.295471	2+	2+	1090.57710786206	0	-0.6578813567509015								99.45945945945947	Confident
4253	P63244	IIVDELKQEVISTSSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.09 min, Period: 1, Cycle(s): 38341 (Experiment 1)	38341	65.56	597.003845	3+	3+	1787.9880448324705	0	0.9272796969573605								100.0	Confident
4254	P25205	YVLCTAPR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20642 (Experiment 1)	20642	44.292	490.255249	2+	2+	978.49568673722	0	0.2634640063940392								99.73190348525469	Confident
4255	P53621	DMSGHYQNALYLGDVSER	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.08 min, Period: 1, Cycle(s): 37962 (Experiment 1)	37962	65.089	712.301575	3+	3+	2133.88268404828	0	0.09899894085592405	Phosphorylation of Y (6: Doubtfull)	Phosphorylation of Y (6: 17.968109570903945)	Phosphorylation of Y (6: 54.17903672815749)		0	Y6-{Y6 Y11}	1	100.0	Confident
4256	P50990	LVPGGGATEIELAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31226 (Experiment 1)	31226	57.15	677.882324	2+	2+	1353.7503807664104	0	-0.21072977137011534								92.11956521739131	Confident
4257	P30086	LYEQLSGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18344 (Experiment 1)	18344	41.465	469.252869	2+	2+	936.4916469026002	0	-0.49209714786170966								95.13513513513514	Confident
4258	P15153, P60763, P63000	YLECSALTQR		Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24497 (Experiment 1)	24497	49.326	620.802734	2+	2+	1239.5917719500303	0	-0.6901411802638161								99.72972972972973	Confident
4259	P54819	APSVPAAEPEYPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22487 (Experiment 1)	22487	46.839	678.347229	2+	2+	1354.6768814729803	0	2.228652233516327								100.0	Confident
4260	Q15717	DANLYISGLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.13 min, Period: 1, Cycle(s): 40132 (Experiment 1)	40132	67.904	609.827209	2+	2+	1217.64043639461	0	-0.4684343024642813								99.7340425531915	Confident
4261	Q13263	TVYCNVHK	Phosphorylation of Y(3)	Carbamidomethylation of C(4)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6536 (Experiment 1)	6536	21.145	550.734009	2+	2+	1099.4521808502602	0	1.165914572156354	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.82547993019197)	Y3	1		0	99.7340425531915	Confident
4262	O95861	LVASAYSIAQK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.80 min, Period: 1, Cycle(s): 23349 (Experiment 1)	23349	47.875	615.808533	2+	2+	1229.6057042862003	0	-2.591074485599626	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 96.33507853403141)	Y6	1		0	99.21671018276761	Confident
4263	P29692	SLAGSSGPGASSGTSGDHGELVVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20287 (Experiment 1)	20287	43.883	729.021118	3+	3+	2184.0407020935104	0	0.3760779773957481								100.0	Confident
4264	P78527	DQNILLGTTYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.07 min, Period: 1, Cycle(s): 37187 (Experiment 1)	37187	64.15	647.343994	2+	2+	1292.6724647988801	0	0.7494224336402728								99.73262032085562	Confident
4265	Q07020	TAVVVGTITDDVR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32902 (Experiment 1)	32902	59.085	673.370483	2+	2+	1344.7248942945603	0	1.1277399045374739								100.0	Confident
4266	P09429	KHPDASVNFSEFSKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19365 (Experiment 1)	19365	42.743	430.972534	4+	4+	1719.8580337224305	0	1.7381708190844383								100.0	Doubtful
4267	P63104	SVTEQGAELSNEER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17270 (Experiment 1)	17270	39.973	774.860657	2+	2+	1547.7063436779504	0	0.26933135268975494								95.13513513513514	Confident
4268	Q15366	IANPVEGSTDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.64 min, Period: 1, Cycle(s): 16063 (Experiment 1)	16063	38.425	579.791199	2+	2+	1157.5676653771702	0	0.15496029760923								92.40837696335078	Confident
4269	Q9UL46	ALVHERDEAAYGELR	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17877 (Experiment 1)	17877	40.783	603.615967	3+	3+	1807.8254268723404	0	0.35603622635577625	Phosphorylation of Y (11: Very Confident)	Phosphorylation of Y (11: 100.0)	Phosphorylation of Y (11: 100.0)	Y11	1		0	100.0	Confident
4270	P68104, Q05639, Q5VTE0	IGGIGTVPVGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 26731 (Experiment 1)	26731	51.913	513.308167	2+	2+	1024.60292868708	0	-1.1178659283571768								100.0	Confident
4271	P49321	KPTDGASSSNCVTDISHLVR		Carbamidomethylation of C(11)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.90 min, Period: 1, Cycle(s): 28594 (Experiment 1)	28594	54.104	536.764893	4+	4+	2143.0327802621005	0	-1.0778121318175518								100.0	Doubtful
4272	P62826	NLQYYDISAK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30808 (Experiment 1)	30808	56.661	647.788635	2+	2+	1293.5642333970404	0	-1.1703886174814155	Phosphorylation of Y (4: Random)	Phosphorylation of Y (4: 0.0, 5: 0.0)	Phosphorylation of Y (4: 0.3484331132862888)		0	Y4-{Y4 Y5}	1	100.0	Confident
4273	Q9NWQ8	ENDYESISDLQQGR	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30462 (Experiment 1)	30462	56.261	867.354919	2+	2+	1732.6941379192701	0	0.661290919772849	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 100.0)	Y4	1		0	100.0	Confident
4274	Q9UN86	NSSYVHGGVDASGKPQEAVYGQNDIHHK	Phosphorylation of Y(20)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17355 (Experiment 1)	17355	40.085	769.597473	4+	4+	3073.36794013083	1	-3.4148456377745484	Phosphorylation of Y (20: Doubtfull)	Phosphorylation of Y (20: 11.191516047985935)	Phosphorylation of Y (20: 15.10956321165745)		0	Y20-{Y4 Y20}	1	100.0	Doubtful
4275	O43242	ISLADIAQK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.01 min, Period: 1, Cycle(s): 34205 (Experiment 1)	34205	60.6	479.782166	2+	2+	957.5494961318902	0	0.2948573220897079								100.0	Confident
4276	P26640	DPGVITYDLPTPPGEK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41420 (Experiment 1)	41420	69.787	889.912048	2+	2+	1777.8175475272403	0	-4.4973123376864175	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 98.86914378029078)	Y7	1		0	99.73045822102425	Doubtful
4277	O60814, P57053, P58876, P62807, Q5QNW6, Q93079, Q99877, Q99879, Q99880	ESYSVYVYK	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 29907 (Experiment 1)	29907	55.621	609.260986	2+	2+	1216.5053215385904	0	1.7213734707586628	Phosphorylation of Y (8: Doubtfull)	Phosphorylation of Y (8: 16.606058476426963)	Phosphorylation of Y (8: 1.3122566787488257)		0	Y8-{Y3 Y6 Y8}	1	97.289972899729	Confident
4278	Q06830	KQGGLGPMNIPLVSDPK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.10 min, Period: 1, Cycle(s): 38743 (Experiment 1)	38743	66.045	584.322205	3+	3+	1749.9447405518504	0	0.025697988018301636								100.0	Confident
4279	Q5H9M0	EKQMLVDK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.97 min, Period: 1, Cycle(s): 32286 (Experiment 1)	32286	58.382	495.767609	2+	2+	989.5215671318904	0	-0.9097656616390101								91.35135135135135	Confident
4280	GSTP1_HUMAN, P09211	FQDGDLTLYQSNTILR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.25 min, Period: 1, Cycle(s): 44436 (Experiment 1)	44436	75.252	982.461792	2+	2+	1962.9088221431302	0	0.10632640853029678	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 99.82547993019197)	Y9	1		0	100.0	Confident
4281	Q14697	VVIIGAGKPAAVVLQTK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 32916 (Experiment 1)	32916	59.1	555.353271	3+	3+	1663.0396269128607	0	-0.9863461462004329								97.76119402985076	Confident
4282	P52272	MGLAMGGGGGASFDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33236 (Experiment 1)	33236	59.466	692.310364	2+	2+	1382.60710474434	0	-0.6714310431590624								100.0	Confident
4283	Q02790	VGEVCHITCKPEYAYGSAGSPPK	Phosphorylation of Y(13)	Carbamidomethylation of C(5, 9)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21117 (Experiment 1)	21117	44.878	863.051086	3+	3+	2586.1284107002402	0	1.1655945170171456	Phosphorylation of Y (13: Doubtfull)	Phosphorylation of Y (13: 4.891373200721844)	Phosphorylation of Y (13: 0.0)		0	Y13-{Y13 Y15}	1	100.0	Confident
4284	Q9NZ08	VSVYAVPDK	Phosphorylation of Y(4)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21237 (Experiment 1)	21237	45.055	529.25177	2+	2+	1056.4892775516303	0	-0.27443004561300555	Phosphorylation of Y (4: Very Confident)	Phosphorylation of Y (4: 100.0)	Phosphorylation of Y (4: 95.47657512116317)	Y4	1		0	99.46091644204851	Confident
4285	P08238	HLEINPDHPIVETLR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.93 min, Period: 1, Cycle(s): 30191 (Experiment 1)	30191	55.954	594.988464	3+	3+	1781.94243205273	0	0.6333722520657016								100.0	Confident
4286	Q14974	VAAGLQIK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19249 (Experiment 1)	19249	42.607	400.255005	2+	2+	798.4963383602203	0	-1.100914245944141								99.73262032085562	Confident
4287	P63220	RMGESDDSILR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18823 (Experiment 1)	18823	42.077	426.874481	3+	3+	1277.60339926289	0	-1.3943683803769908								100.0	Confident
4288	ALDOA_RABIT, P04075	AAQEEYVKR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.35 min, Period: 1, Cycle(s): 6399 (Experiment 1)	6399	20.871	587.269958	2+	2+	1172.5227029382304	0	2.2648307936670107	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.82547993019197)	Y6	1		0	99.73474801061008	Confident
4289	P31948	TLLSDPTYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.87 min, Period: 1, Cycle(s): 27100 (Experiment 1)	27100	52.342	533.281677	2+	2+	1064.5502244078803	0	-1.3345101345398866								99.72972972972973	Confident
4290	P62333	GCLLYGPPGTGK	Phosphorylation of Y(5)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.94 min, Period: 1, Cycle(s): 30678 (Experiment 1)	30678	56.511	650.294556	2+	2+	1298.5730242589302	0	1.1800877329893373	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.67689822294022)	Y5	1		0	99.74293059125964	Confident
4291	Q15233	AAPGAEFAPNKR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13347 (Experiment 1)	13347	34.236	410.219574	3+	3+	1227.6360197205101	0	0.7092784193508755								100.0	Confident
4292	Q8N183	YYYIPQYK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36423 (Experiment 1)	36423	63.245	609.268677	2+	2+	1216.5205776799103	0	1.8246387894541454	Phosphorylation of Y (2: Random)	Phosphorylation of Y (1: 0.0, 2: 0.0)	Phosphorylation of Y (2: 0.16155088852988692)		0	Y2-{Y1 Y2 Y3 Y7}	1	100.0	Confident
4293	P52758	AAYQVAALPK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24507 (Experiment 1)	24507	49.337	556.280701	2+	2+	1110.5474611340903	0	-0.5501425598653138	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 92.08400646203555)	Y3	1		0	99.19137466307278	Confident
4294	P62158	VFDKDGNGYISAAELR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.99 min, Period: 1, Cycle(s): 33409 (Experiment 1)	33409	59.664	585.957947	3+	3+	1753.8635130256903	1	-8.456023604682699								99.24812030075188	Doubtful
4295	Q01844	QDHPSSMGVYGQESGGFSGPGENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25231 (Experiment 1)	25231	50.177	827.351563	3+	3+	2479.04586412694	0	-5.239392708843929								97.74436090225565	Doubtful
4296	P25685	DGSDVIYPAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.78 min, Period: 1, Cycle(s): 22483 (Experiment 1)	22483	46.834	546.769775	2+	2+	1091.5247379360303	0	0.23696482392129795								92.7807486631016	Confident
4297	Q969X5	EYVAYSHTGR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.49 min, Period: 1, Cycle(s): 10472 (Experiment 1)	10472	29.544	631.763916	2+	2+	1261.5128665305203	0	0.32649537251664257	Phosphorylation of Y (5: Doubtfull)	Phosphorylation of Y (5: 19.70223358679372)	Phosphorylation of Y (5: 98.42931937172776)		0	Y5-{Y2 Y5}	1	99.50124688279301	Confident
4298	P53621	VLTIDPTEFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40523 (Experiment 1)	40523	68.513	581.820923	2+	2+	1161.6281403754103	0	-0.7281522406919696								100.0	Confident
4299	P62241	ISSLLEEQFQQGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36818 (Experiment 1)	36818	63.71	753.894165	2+	2+	1505.7725727629704	0	0.7987224356841397								100.0	Confident
4300	P63244	LTRDETNYGIPQR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.66 min, Period: 1, Cycle(s): 17080 (Experiment 1)	17080	39.702	821.883484	2+	2+	1641.7511993029202	0	0.7396208698798251	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 100.0)	Y8	1		0	100.0	Confident
4301	P29401	ILATPPQEDAPSVDIANIR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.14 min, Period: 1, Cycle(s): 40358 (Experiment 1)	40358	68.27	1010.535034	2+	2+	2019.0636693842202	0	-4.034637429841351								99.72826086956522	Confident
4302	P00492	VIGGDDLSTLTGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35092 (Experiment 1)	35092	61.627	638.343323	2+	2+	1274.6717960925405	0	0.23261299511937872								100.0	Confident
4303	P62942	GVQVETISPGDGR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21276 (Experiment 1)	21276	45.118	657.834961	2+	2+	1313.65754301073	0	-1.6523451100222921								100.0	Confident
4304	P07900	ELHINLIPNKQDR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.89 min, Period: 1, Cycle(s): 27795 (Experiment 1)	27795	53.168	398.224548	4+	4+	1588.86853883648	0	0.34358533576117506								100.0	Doubtful
4305	P40227	IITEGFEAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.85 min, Period: 1, Cycle(s): 25993 (Experiment 1)	25993	51.063	539.793823	2+	2+	1077.5706254992904	0	2.285662247618102								100.0	Confident
4306	P51531, P51532	LTQVLNTHYVAPR	Phosphorylation of Y(9)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26295 (Experiment 1)	26295	51.414	531.27063	3+	3+	1590.7919419160903	0	-1.1803866676323915	Phosphorylation of Y (9: Very Confident)	Phosphorylation of Y (9: 100.0)	Phosphorylation of Y (9: 100.0)	Y9	1		0	100.0	Confident
4307	E9PAV3, Q13765, Q9BZK3	NILFVITKPDVYK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.19 min, Period: 1, Cycle(s): 42511 (Experiment 1)	42511	71.524	517.304565	3+	3+	1548.8915656968402	0	0.1932470748411658								92.14285714285715	Doubtful
4308	Q14160	HCSLQAVPEEIYR	Phosphorylation of Y(12)	Carbamidomethylation of C(2)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29371 (Experiment 1)	29371	55.002	561.250793	3+	3+	1680.7331067106304	0	-1.518695512950693	Phosphorylation of Y (12: Very Confident)	Phosphorylation of Y (12: 100.0)	Phosphorylation of Y (12: 99.82547993019197)	Y12	1		0	100.0	Confident
4309	P23528	AVLFCLSEDKK		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31367 (Experiment 1)	31367	57.316	655.34436	2+	2+	1308.6747732980004	0	-0.4625288482594886								100.0	Confident
4310	P22695	VTSEELHYFVQNHFTSAR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41304 (Experiment 1)	41304	69.606	749.007507	3+	3+	2244.000096759021	0	0.26472396029301515	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
4311	P01903, P01906	VEHWGLDEPLLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.12 min, Period: 1, Cycle(s): 39609 (Experiment 1)	39609	67.201	479.258026	3+	3+	1434.75071511958	0	1.0665664675096567								99.41176470588235	Confident
4312	P13796	VYALPEDLVEVNPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44964 (Experiment 1)	44964	76.473	833.410767	2+	2+	1664.8062545675507	0	0.43585898485228547	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
4313	P53396	FGGALDAAAK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.73 min, Period: 1, Cycle(s): 20375 (Experiment 1)	20375	43.981	460.745667	2+	2+	919.4763311916304	0	0.48820314286852123								100.0	Confident
4314	P13639	VFDAIMNFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.24 min, Period: 1, Cycle(s): 44073 (Experiment 1)	44073	74.275	542.778259	2+	2+	1083.5423025764703	0	-0.3109096429684105								100.0	Confident
4315	Q8WXX5	ELGLDEGVDSLK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36645 (Experiment 1)	36645	63.501	637.826599	2+	2+	1273.6401616110902	0	-1.1888363654254928								99.73045822102425	Confident
4316	Q7L5N7	HLDEYASIASSSK	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.69 min, Period: 1, Cycle(s): 18291 (Experiment 1)	18291	41.394	744.32373	2+	2+	1486.6341038620105	0	-0.8039476805393923	Phosphorylation of Y (5: Very Confident)	Phosphorylation of Y (5: 100.0)	Phosphorylation of Y (5: 99.47643979057592)	Y5	1		0	99.72826086956522	Confident
4317	O14818, Q8TAA3	LYQTDPSGTYHAWK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.82 min, Period: 1, Cycle(s): 24330 (Experiment 1)	24330	49.129	582.924377	3+	3+	1745.7450512933203	0	3.574122035901252	Phosphorylation of Y (2: Doubtfull)	Phosphorylation of Y (2: 7.894767180625688)	Phosphorylation of Y (10: 99.47643979057592)		0	Y2-{Y2 Y10}	1	99.24812030075188	Confident
4318	O14672	AIDTIYQTTDFSGIR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.18 min, Period: 1, Cycle(s): 42156 (Experiment 1)	42156	70.972	890.905701	2+	2+	1779.8080454727003	0	-6.283681851622055	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.65095986038395)	Y6	1		0	99.73262032085562	Doubtful
4319	P00519	NKPTVYGVSPNYDKWEMER	Phosphorylation of Y(12)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31106 (Experiment 1)	31106	57.011	798.360107	3+	3+	2392.05589738298	0	1.0831450497736586	Phosphorylation of Y (12: Doubtfull)	Phosphorylation of Y (12: 5.76319562311595)	Phosphorylation of Y (6: 1.3961605584642234)		0	Y12-{Y6 Y12}	1	100.0	Confident
4320	P42704	ALYEHLTAK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.67 min, Period: 1, Cycle(s): 17404 (Experiment 1)	17404	40.16	563.271606	2+	2+	1124.5267256895102	0	1.716205968146255	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 99.47643979057592)	Y3	1		0	99.45652173913044	Confident
4321	Q14978	NKPGPYSSVPPPSAPPPKK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.52 min, Period: 1, Cycle(s): 11612 (Experiment 1)	11612	31.475	675.679138	3+	3+	2024.0132276420204	0	1.1627611152666655	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4322	P09874	GIYFADMVSK	Phosphorylation of Y(3)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.26 min, Period: 1, Cycle(s): 44703 (Experiment 1)	44703	75.897	605.764099	2+	2+	1209.5141124004804	0	-0.3857392052815592	Phosphorylation of Y (3: Very Confident)	Phosphorylation of Y (3: 100.0)	Phosphorylation of Y (3: 90.95315024232633)	Y3	1		0	97.8319783197832	Confident
4323	P38919, P60842, Q14240	GIYAYGFEKPSAIQQR	Phosphorylation of Y(5)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32521 (Experiment 1)	32521	58.655	636.640076	3+	3+	1906.8978635366104	0	0.28014945111243184	Phosphorylation of Y (5: Random)	Phosphorylation of Y (3: 0.0, 5: 0.0)	Phosphorylation of Y (5: 27.675950908829478)		0	Y5-{Y3 Y5}	1	97.74436090225565	Confident
4324	P26640	LHEEGIIYR	Phosphorylation of Y(8)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.74 min, Period: 1, Cycle(s): 20850 (Experiment 1)	20850	44.531	605.287354	2+	2+	1208.55908844695	0	0.8810859492523281	Phosphorylation of Y (8: Very Confident)	Phosphorylation of Y (8: 100.0)	Phosphorylation of Y (8: 99.82547993019197)	Y8	1		0	100.0	Confident
4325	Q9UMS4	ATVLTTER			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.57 min, Period: 1, Cycle(s): 13308 (Experiment 1)	13308	34.169	445.750549	2+	2+	889.4868958753302	0	-0.39350351550154905								99.1891891891892	Confident
4326	P19338	ALVATPGKK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.42 min, Period: 1, Cycle(s): 8223 (Experiment 1)	8223	24.921	442.781219	2+	2+	883.5491022090703	0	-1.3744271087422228								99.72972972972973	Confident
4327	P60660	HVLVTLGEK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.70 min, Period: 1, Cycle(s): 18982 (Experiment 1)	18982	42.269	498.298279	4+	2+	994.5811306133403	0	0.8774401195846122								100.0	Confident
4328	P23528	HELQANCYEEVKDR		Carbamidomethylation of C(7)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.59 min, Period: 1, Cycle(s): 14036 (Experiment 1)	14036	35.339	597.609741	3+	3+	1789.8053465265702	0	1.1418127866453662								96.71052631578947	Confident
4329	P68104, Q05639, Q5VTE0	LPLQDVYK	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.91 min, Period: 1, Cycle(s): 28784 (Experiment 1)	28784	54.33	528.26239	2+	2+	1054.5100129962104	0	0.20261730989276847	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.82517482517483)	Y7	1		0	100.0	Confident
4330	Q14566	IQETQAELPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.71 min, Period: 1, Cycle(s): 19072 (Experiment 1)	19072	42.379	592.818787	2+	2+	1183.6197009500302	0	2.800287133153219								99.18478260869566	Confident
4331	Q9UHX1	SVFEAFGK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.05 min, Period: 1, Cycle(s): 36042 (Experiment 1)	36042	62.769	442.728973	2+	2+	883.4439684341903	0	-0.6497964617774583								99.73045822102425	Confident
4332	P09874	GIYFADMVSK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.16 min, Period: 1, Cycle(s): 41082 (Experiment 1)	41082	69.305	565.78125	2+	2+	1129.5477818797303	0	0.14598103916645955								96.19565217391303	Confident
4333	A5A3E0, P0CG38, P60709, P62736, P63261, P63267, P68032, P68133, Q6S8J3, Q9BYX7	AVFPSIVGRPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.92 min, Period: 1, Cycle(s): 29420 (Experiment 1)	29420	55.057	400.240051	3+	3+	1197.69822605425	0	0.08123901456768667								100.0	Confident
4334	O14929	LLVTDMSDAEQYR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.06 min, Period: 1, Cycle(s): 36853 (Experiment 1)	36853	63.753	770.869873	2+	2+	1539.7239083183904	0	0.8333112377529254								100.0	Confident
4335	P62805	ISGLIYEETR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31092 (Experiment 1)	31092	56.994	630.796997	2+	2+	1259.5798834611805	0	-0.3506632495040093	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 99.83844911147011)	Y6	1		0	100.0	Confident
4336	P31943, P55795	DLNYCFSGMSDHR		Carbamidomethylation of C(5)	ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.98 min, Period: 1, Cycle(s): 32645 (Experiment 1)	32645	58.795	534.555237	3+	3+	1600.6398614246002	0	2.5068722329559567								100.0	Confident
4337	O94903	APLEVAQEH			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.65 min, Period: 1, Cycle(s): 16493 (Experiment 1)	16493	38.949	497.254395	2+	2+	992.4927095317603	0	1.5359713030031372								100.0	Confident
4338	P27708	VLGTSPEAIDSAENR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.83 min, Period: 1, Cycle(s): 24768 (Experiment 1)	24768	49.639	779.889648	2+	2+	1557.7634646312504	0	0.8196263256805784								91.32791327913279	Confident
4339	P22090, P62701, Q8TD47	GNKPWISLPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.96 min, Period: 1, Cycle(s): 31699 (Experiment 1)	31699	57.708	389.892456	3+	3+	1166.6560268891	0	-0.41745642485783885								98.51851851851852	Confident
4340	P60709, P63261	GYSFTTTAER	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.75 min, Period: 1, Cycle(s): 21113 (Experiment 1)	21113	44.872	606.750366	2+	2+	1211.4859830763403	0	0.16150799255545856	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
4341	P20290	VQASLAANTFTITGHAETK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.95 min, Period: 1, Cycle(s): 31265 (Experiment 1)	31265	57.195	654.009827	3+	3+	1959.0061545081005	0	0.7630326762984392								100.0	Confident
4342	P53621	TLDLPIYVTR	Phosphorylation of Y(7)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.31 min, Period: 1, Cycle(s): 45860 (Experiment 1)	45860	78.479	635.827393	2+	2+	1269.63700441448	0	2.5389438460307914	Phosphorylation of Y (7: Very Confident)	Phosphorylation of Y (7: 100.0)	Phosphorylation of Y (7: 99.03069466882067)	Y7	1		0	99.7289972899729	Confident
4343	P31948	EGLQNMEAR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 17669 (Experiment 1)	17669	40.518	524.248535	2+	2+	1046.4814932250601	0	0.9764856237191194								99.45945945945947	Confident
4344	P13796	VYALPEDLVEVNPK	Phosphorylation of Y(2)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.27 min, Period: 1, Cycle(s): 44840 (Experiment 1)	44840	76.211	833.912842	2+	2+	1664.8062545675507	1	0.9129121847609198	Phosphorylation of Y (2: Very Confident)	Phosphorylation of Y (2: 100.0)	Phosphorylation of Y (2: 100.0)	Y2	1		0	100.0	Confident
4345	P61978	DYDDMSPR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.68 min, Period: 1, Cycle(s): 18030 (Experiment 1)	18030	41.017	499.698334	2+	2+	997.3811104774502	0	1.0051964028315887								100.0	Confident
4346	P31930	ADLTEYLSTHYK	Phosphorylation of Y(11)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35096 (Experiment 1)	35096	61.632	507.561005	3+	3+	1519.6595903338603	0	1.0476687264289857	Phosphorylation of Y (11: Doubtfull)	Phosphorylation of Y (11: 5.275914931706089)	Phosphorylation of Y (6: 98.08027923211169)		0	Y11-{Y6 Y11}	1	99.25925925925925	Confident
4347	P53396	EILIPVFK			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.30 min, Period: 1, Cycle(s): 45554 (Experiment 1)	45554	77.784	479.802368	2+	2+	957.5899043918903	0	0.29040557666356864								96.22641509433963	Confident
4348	P25789	VEIATLTR			ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.84 min, Period: 1, Cycle(s): 25563 (Experiment 1)	25563	50.57	451.768829	2+	2+	901.5232813840503	0	-0.195141440164142								99.7289972899729	Confident
4349	Q9H6Z4	DTGQLYAALHHR	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 0.86 min, Period: 1, Cycle(s): 26291 (Experiment 1)	26291	51.409	731.333557	2+	2+	1460.6561767192704	0	-2.471952724010381	Phosphorylation of Y (6: Very Confident)	Phosphorylation of Y (6: 100.0)	Phosphorylation of Y (6: 100.0)	Y6	1		0	100.0	Confident
4350	P06899, P23527, P33778, Q16778, Q6DN03, Q6DRA6, Q8N257	ESYSIYVYK	Phosphorylation of Y(6)		ProteinPilot formatted MGF of data 42.mgf	File: llparker_perez512_20180218_16704_ABL_PME_TR3_PLUS, Sample: Sample001 (sample number 1), Elution: 1.03 min, Period: 1, Cycle(s): 35269 (Experiment 1)	35269	61.833	616.267639	2+	2+	1230.5209716027305	0	-0.2000237312796789	Phosphorylation of Y (6: Random)	Phosphorylation of Y (6: 0.0, 8: 0.0)	Phosphorylation of Y (6: 26.201045899998782)		0	Y6-{Y3 Y6 Y8}	1	99.72972972972973	Confident