Mercurial > repos > jjohnson > find_in_reference
view test-data/found_peptides.tabular @ 2:c4fd2ea4f988
Add the option to test the reversed sequence and the DNA reverse complement of the sequence (ignored if the sequence cannot be interpreted as DNA)
author | Jim Johnson <jj@umn.edu> |
---|---|
date | Thu, 13 Nov 2014 14:09:50 -0600 |
parents | e7e56b51d156 |
children |
line wrap: on
line source
pep_1|sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 MHPAVFLSLPDLRCSLLLL pep_2|sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 NENQVVFARVDCDQHSDIAQRYRISKY pep_3|sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 FQKLAPSEYRYTLLRDRDEL pep_5|sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 INGQFVERCWT pep_7|sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1 MNGTEGPNFYVPFSNA pep_8|sp|P08100|OPSD_HUMAN Rhodopsin OS=Homo sapiens GN=RHO PE=1 SV=1 YNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA