Mercurial > repos > matteoc > agame_custom_tools

diff pfam_search/lipase @ 0:68a3648c7d91 draft default tip

Find changesets by keywords (author, files, the commit message), revision number or hash, or revset expression.
Uploaded
author matteoc
date Thu, 22 Dec 2016 04:45:31 -0500
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/pfam_search/lipase	Thu Dec 22 04:45:31 2016 -0500
@@ -0,0 +1,162 @@
+<html>
+<head></head>
+<body>
+Proteins with PFAM domains:
+<br><br>
+<div>
+<table cellpadding="0" width=650>
+<td>
+<HR SIZE=3 WIDTH=80%>
+<center><b>15FR_NODE_1#PROKKA_00113</b><br>
+</center>
+</td
+<tr></tr>
+<td bgcolor="#czb9dz">
+<pre> 
+VLAGIAEWYGEDEAVPFRVISGTSAGAMNAAYLSANMENFAHGTQRLAQVWSQLEAQQVYRPEYRKVFGALLHWAWSLLSGGLGDSNPRS
+LLDNSPLRALLAENIDFDAIARNIERGLLRGVSVTVAGYSTERSLSYFQAETGVQSWWRQRREGRPVQMTLDHVMASLGLPIIFPAVKVA
+GEWCGDGSTREFAPLSPAIHLGAKRVLVIDTQYPAPQHVLGQDQAYPSLSKIMGYLFDSVFSDSLYADLERTKRINRTLDYIKRQSGHEP
+PELGLSHIDTLVIAPSRRPLEIASRYESHLPKSMRWILRSLGGDVSSGDQLLSYMLFQSGYCSEMVALGRHDAHARREEIGQFLGLSKIK
+V
+
+ </pre>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<p align="left">
+<a href=http://pfam.xfam.org/family/PF01734> PF01734</a>
+<p align="justify">Patatin-like phospholipase<br>Pfam-B_2206 (release 4.1) This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of  the total soluble protein in potato tubers  . Patatin is a storage protein but it also has the enzymatic activity of lipid acyl hydrolase, catalysing the cleavage of fatty acids from membrane lipids  . Members of this family have been found also in vertebrates. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td bgcolor="#czb9dz">
+<p align="left">
+<a href=http://pfam.xfam.org/clan/CL0323> CL0323</a>
+ <p align="justify">Patatin/FabD/lysophospholipase-like superfamily This superfamily of enzymes contains a Ser/Asp catalytic dyad. Members of this superfamily are all serine acylhydrolase enzymes. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<HR SIZE=3 WIDTH=80%>
+<center><b>16FR_NODE_10#PROKKA_00133</b><br>
+</center>
+</td
+<tr></tr>
+<td bgcolor="#czb9dz">
+<pre> 
+MNPIEAISHTGRSVRSRLKGFPRKKVLVLEGGGMRGIFTVGVLQAFSERGYAPWKTIIGASAGALSGVVYAAGQIHMARDAFFTELISGR
+FIRMSNIFRPEKHILNLDWLVDHIIGGDEPLNIRRLRTTACPVLITVTRFSRDFPPDTLYLSTKTDSVPQALKATAAIPFFYRGFVHYRN
+DLLLDGGVLDSVPFKKALSMGFPERDILVVLTRPKGYRKERDSFWIKTLYESYYKDSQYRYLVNSLEHHFGNYNRMLDDLETNYDFDIIY
+PPDNFKVNRLTRSEDKIVDGFEQGVAAAKAYLKPK
+
+ </pre>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<p align="left">
+<a href=http://pfam.xfam.org/family/PF01734> PF01734</a>
+<p align="justify">Patatin-like phospholipase<br>Pfam-B_2206 (release 4.1) This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of  the total soluble protein in potato tubers  . Patatin is a storage protein but it also has the enzymatic activity of lipid acyl hydrolase, catalysing the cleavage of fatty acids from membrane lipids  . Members of this family have been found also in vertebrates. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td bgcolor="#czb9dz">
+<p align="left">
+<a href=http://pfam.xfam.org/clan/CL0323> CL0323</a>
+ <p align="justify">Patatin/FabD/lysophospholipase-like superfamily This superfamily of enzymes contains a Ser/Asp catalytic dyad. Members of this superfamily are all serine acylhydrolase enzymes. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<HR SIZE=3 WIDTH=80%>
+<center><b>16FR_NODE_10#PROKKA_00142</b><br>
+</center>
+</td
+<tr></tr>
+<td bgcolor="#czb9dz">
+<pre> 
+MGKTIRRALVLSGGGARGAFEVGVMRYLNEVNWQPDLICGTSIGAINGAAFGSGMSVDELAHLWKTYHRKQMYKITFPAFFRTLLSGRKF
+SPLSDNRPTRSLLEKTIDIDALRNSTTEIIISVLNMRTSQVRYFTHKAIGIEHLMAAGGIPMMFPWQYIDGDPYWDAGVMVNTPIMPAFE
+RGATEIIVVLLSPLGAIPQRLPSTHREVSELVFEQFLIGSYTACLPNAGWRTNPEADVYDTPLPDSPQLQLSMKGVRMATVYPTRMLGFR
+SLLDFSPRQAKTLLRDGYVNARMQLKSFF
+
+ </pre>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<p align="left">
+<a href=http://pfam.xfam.org/family/PF01734> PF01734</a>
+<p align="justify">Patatin-like phospholipase<br>Pfam-B_2206 (release 4.1) This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of  the total soluble protein in potato tubers  . Patatin is a storage protein but it also has the enzymatic activity of lipid acyl hydrolase, catalysing the cleavage of fatty acids from membrane lipids  . Members of this family have been found also in vertebrates. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td bgcolor="#czb9dz">
+<p align="left">
+<a href=http://pfam.xfam.org/clan/CL0323> CL0323</a>
+ <p align="justify">Patatin/FabD/lysophospholipase-like superfamily This superfamily of enzymes contains a Ser/Asp catalytic dyad. Members of this superfamily are all serine acylhydrolase enzymes. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<HR SIZE=3 WIDTH=80%>
+<center><b>8FR_NODE_2#PROKKA_00232</b><br>
+</center>
+</td
+<tr></tr>
+<td bgcolor="#czb9dz">
+<pre> 
+MGLSYRINFKLGANAMVISDPSMPVPASLQFRQLKSDEYVMLDIPTDSLEVAYWGTKKPVPAQYVLTEAQTAKVESAITSYNAEIKSLAK
+KYNLAFVDFNSIMKSIEHGGLTVDGIHFTTAFITGNLFSLDGVHLTPQGNAVVANYFIQAINKQYGSHIPSVMVSDYPSVVF
+
+ </pre>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td>
+<p align="left">
+<a href=http://pfam.xfam.org/family/PF00657> PF00657</a>
+<p align="justify">GDSL-like Lipase/Acylhydrolase<br>Prosite & Pfam-B_543 (Release 7.5) </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+<td bgcolor="#czb9dz">
+<p align="left">
+<a href=http://pfam.xfam.org/clan/CL0264> CL0264</a>
+ <p align="justify">This superfamily contains a diversity of hydrolytic enzyme activities. </p>
+
+</p>
+</td>
+<tr></tr>
+<td></td>
+<tr></tr>
+</table>
+</div>
+</body>
+</html>