changeset 0:fe8e43a26870 draft

Uploaded
author mkh
date Thu, 28 Jan 2016 19:34:51 -0500
parents
children e2d4343d73ad
files interproscan5/create_index.py interproscan5/data/__base__.gff3 interproscan5/data/__base__.html.tar.gz interproscan5/data/__base__.svg.tar.gz interproscan5/data/__base__.tsv interproscan5/data/__base__.xml interproscan5/data/input.fasta interproscan5/fake_ips.py interproscan5/interproscan.xml interproscan5/ips5.xml interproscan5/ipsfaux.xml interproscan5/readme.rst interproscan5/static/images/P51587.svg.png interproscan5/static/images/example_xml_output.png interproscan5/tool_dependencies.xml
diffstat 15 files changed, 3724 insertions(+), 0 deletions(-) [+]
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/create_index.py	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,14 @@
+#!/usr/bin/env python
+
+import os
+import sys
+
+o = open(sys.argv[1], 'w+')
+
+o.write('<html> <body> <h1> InterProScan result summary page </h1> <ul>')
+
+for filename in [f for f in os.listdir(sys.argv[2]) if os.path.isfile(os.path.join(sys.argv[2], f))]:
+    o.write('<li><a href="%s"> %s </a></li>' % (filename, os.path.splitext(filename)[0]))
+
+o.write('</ul></body></html>')
+o.close()
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/data/__base__.gff3	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,377 @@
+##gff-version 3
+##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
+##sequence-region P00363 1 602
+P00363	.	polypeptide	1	602	.	+	.	md5=0d2c0f1acdd08ab0157f2308531a58e4;ID=P00363
+P00363	SUPERFAMILY	protein_match	361	415	2.27E-71	+	.	Name=SSF51905;Target=P00363 361 415;status=T;ID=match$1_361_415;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR023753"
+P00363	SUPERFAMILY	protein_match	2	250	2.27E-71	+	.	Name=SSF51905;Target=P00363 2 250;status=T;ID=match$1_2_250;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR023753"
+P00363	TIGRFAM	protein_match	7	581	4.7E-250	+	.	Name=TIGR01812;signature_desc=sdhA_frdA_Gneg: succinate dehydrogenase or fumarate reductase, flavoprotein subunit;Target=P00363 7 581;status=T;ID=match$2_7_581;Ontology_term="GO:0016627","GO:0022900","GO:0050660","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR014006"
+P00363	Gene3D	protein_match	234	352	3.6E-37	+	.	Name=G3DSA:3.90.700.10;Target=P00363 234 352;status=T;ID=match$3_234_352;date=24-01-2016;Dbxref="InterPro:IPR027477"
+P00363	PRINTS	protein_match	375	382	2.5E-5	+	.	Name=PR00411;signature_desc=Pyridine nucleotide disulphide reductase class-I signature;Target=P00363 375 382;status=T;ID=match$4_375_382;date=24-01-2016
+P00363	PRINTS	protein_match	7	29	2.5E-5	+	.	Name=PR00411;signature_desc=Pyridine nucleotide disulphide reductase class-I signature;Target=P00363 7 29;status=T;ID=match$4_7_29;date=24-01-2016
+P00363	Gene3D	protein_match	426	537	1.5E-38	+	.	Name=G3DSA:1.20.58.100;Target=P00363 426 537;status=T;ID=match$5_426_537;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR015939"
+P00363	Coils	protein_match	423	443	.	+	.	Name=Coil;Target=P00363 423 443;status=T;ID=match$6_423_443;date=24-01-2016
+P00363	Gene3D	protein_match	353	416	5.9E-106	+	.	Name=G3DSA:3.50.50.60;Target=P00363 353 416;status=T;ID=match$7_353_416;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR023753"
+P00363	Gene3D	protein_match	2	233	5.9E-106	+	.	Name=G3DSA:3.50.50.60;Target=P00363 2 233;status=T;ID=match$7_2_233;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR023753"
+P00363	PANTHER	protein_match	1	584	0.0	+	.	Name=PTHR11632;Target=P00363 1 584;status=T;ID=match$8_1_584;date=24-01-2016
+P00363	SUPERFAMILY	protein_match	444	590	3.01E-46	+	.	Name=SSF46977;Target=P00363 444 590;status=T;ID=match$9_444_590;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR015939"
+P00363	PANTHER	protein_match	1	584	0.0	+	.	Name=PTHR11632:SF50;Target=P00363 1 584;status=T;ID=match$10_1_584;date=24-01-2016
+P00363	PIRSF	protein_match	1	575	2.0E-42	+	.	Name=PIRSF000171;Target=P00363 1 575;status=T;ID=match$11_1_575;date=24-01-2016;Dbxref="InterPro:IPR030664"
+P00363	TIGRFAM	protein_match	3	582	0.0	+	.	Name=TIGR01176;signature_desc=fum_red_Fp: fumarate reductase (quinol), flavoprotein subunit;Target=P00363 3 582;status=T;ID=match$12_3_582;Ontology_term="GO:0009061","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR005884"
+P00363	Pfam	protein_match	453	581	7.0E-39	+	.	Name=PF02910;signature_desc=Fumarate reductase flavoprotein C-term;Target=P00363 453 581;status=T;ID=match$13_453_581;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR015939"
+P00363	Coils	protein_match	473	493	.	+	.	Name=Coil;Target=P00363 473 493;status=T;ID=match$14_473_493;date=24-01-2016
+P00363	ProSitePatterns	protein_match	43	52	.	+	.	Name=PS00504;signature_desc=Fumarate reductase / succinate dehydrogenase FAD-binding site.;Target=P00363 43 52;status=T;ID=match$15_43_52;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR003952"
+P00363	Gene3D	protein_match	543	577	5.5E-18	+	.	Name=G3DSA:4.10.80.40;Target=P00363 543 577;status=T;ID=match$16_543_577;date=24-01-2016
+P00363	SUPERFAMILY	protein_match	227	358	6.88E-43	+	.	Name=SSF56425;Target=P00363 227 358;status=T;ID=match$17_227_358;date=24-01-2016;Dbxref="InterPro:IPR027477"
+P00363	Pfam	protein_match	7	397	1.1E-115	+	.	Name=PF00890;signature_desc=FAD binding domain;Target=P00363 7 397;status=T;ID=match$18_7_397;date=24-01-2016;Dbxref="InterPro:IPR003953"
+P00363	PRINTS	protein_match	8	27	3.0E-10	+	.	Name=PR00368;signature_desc=FAD-dependent pyridine nucleotide reductase signature;Target=P00363 8 27;status=T;ID=match$19_8_27;date=24-01-2016
+P00363	PRINTS	protein_match	360	382	3.0E-10	+	.	Name=PR00368;signature_desc=FAD-dependent pyridine nucleotide reductase signature;Target=P00363 360 382;status=T;ID=match$19_360_382;date=24-01-2016
+##sequence-region P00350 1 468
+P00350	.	polypeptide	1	468	.	+	.	md5=1776f92beb74ff0ccd9ac47a65663644;ID=P00350
+P00350	SUPERFAMILY	protein_match	4	173	4.86E-50	+	.	Name=SSF51735;Target=P00350 4 173;status=T;ID=match$20_4_173;date=24-01-2016;Dbxref="InterPro:IPR016040"
+P00350	TIGRFAM	protein_match	5	467	1.1E-232	+	.	Name=TIGR00873;signature_desc=gnd: 6-phosphogluconate dehydrogenase (decarboxylating);Target=P00350 5 467;status=T;ID=match$21_5_467;Ontology_term="GO:0004616","GO:0006098","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006113"
+P00350	Gene3D	protein_match	1	180	1.9E-61	+	.	Name=G3DSA:3.40.50.720;Target=P00350 1 180;status=T;ID=match$22_1_180;date=24-01-2016;Dbxref="InterPro:IPR016040"
+P00350	Pfam	protein_match	3	174	1.8E-52	+	.	Name=PF03446;signature_desc=NAD binding domain of 6-phosphogluconate dehydrogenase;Target=P00350 3 174;status=T;ID=match$23_3_174;Ontology_term="GO:0004616","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006115"
+P00350	PIRSF	protein_match	1	468	1.9E-243	+	.	Name=PIRSF000109;Target=P00350 1 468;status=T;ID=match$24_1_468;Ontology_term="GO:0004616","GO:0006098","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006113"
+P00350	ProSitePatterns	protein_match	253	265	.	+	.	Name=PS00461;signature_desc=6-phosphogluconate dehydrogenase signature.;Target=P00350 253 265;status=T;ID=match$25_253_265;Ontology_term="GO:0004616","GO:0006098","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006184"
+P00350	Gene3D	protein_match	181	433	1.0E-119	+	.	Name=G3DSA:1.10.1040.10;Target=P00350 181 433;status=T;ID=match$26_181_433;Ontology_term="GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR013328"
+P00350	Gene3D	protein_match	436	467	1.4E-22	+	.	Name=G3DSA:1.20.5.320;Target=P00350 436 467;status=T;ID=match$27_436_467;date=24-01-2016;Dbxref="InterPro:IPR012284"
+P00350	PRINTS	protein_match	249	276	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 249 276;status=T;ID=match$28_249_276;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PRINTS	protein_match	168	196	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 168 196;status=T;ID=match$28_168_196;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PRINTS	protein_match	66	95	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 66 95;status=T;ID=match$28_66_95;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PRINTS	protein_match	119	144	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 119 144;status=T;ID=match$28_119_144;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PRINTS	protein_match	4	27	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 4 27;status=T;ID=match$28_4_27;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PRINTS	protein_match	356	378	1.521867E-89	+	.	Name=PR00076;signature_desc=6-phosphogluconate dehydrogenase signature;Target=P00350 356 378;status=T;ID=match$28_356_378;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006183"
+P00350	PANTHER	protein_match	1	466	7.6E-305	+	.	Name=PTHR11811:SF25;Target=P00350 1 466;status=T;ID=match$29_1_466;date=24-01-2016
+P00350	PANTHER	protein_match	1	466	7.6E-305	+	.	Name=PTHR11811;Target=P00350 1 466;status=T;ID=match$30_1_466;date=24-01-2016
+P00350	Pfam	protein_match	179	466	2.0E-132	+	.	Name=PF00393;signature_desc=6-phosphogluconate dehydrogenase, C-terminal domain;Target=P00350 179 466;status=T;ID=match$31_179_466;Ontology_term="GO:0004616","GO:0006098","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006114"
+P00350	SUPERFAMILY	protein_match	177	467	6.8E-132	+	.	Name=SSF48179;Target=P00350 177 467;status=T;ID=match$32_177_467;Ontology_term="GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR008927"
+##sequence-region P00370 1 447
+P00370	.	polypeptide	1	447	.	+	.	md5=9ec8e26fcf5c160f533bf9a69dec0212;ID=P00370
+P00370	PRINTS	protein_match	372	383	2.5E-33	+	.	Name=PR00082;signature_desc=Glutamate/leucine/phenylalanine/valine dehydrogenase signature;Target=P00370 372 383;status=T;ID=match$33_372_383;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006095"
+P00370	PRINTS	protein_match	114	128	2.5E-33	+	.	Name=PR00082;signature_desc=Glutamate/leucine/phenylalanine/valine dehydrogenase signature;Target=P00370 114 128;status=T;ID=match$33_114_128;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006095"
+P00370	PRINTS	protein_match	235	255	2.5E-33	+	.	Name=PR00082;signature_desc=Glutamate/leucine/phenylalanine/valine dehydrogenase signature;Target=P00370 235 255;status=T;ID=match$33_235_255;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006095"
+P00370	PRINTS	protein_match	193	215	2.5E-33	+	.	Name=PR00082;signature_desc=Glutamate/leucine/phenylalanine/valine dehydrogenase signature;Target=P00370 193 215;status=T;ID=match$33_193_215;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006095"
+P00370	SUPERFAMILY	protein_match	6	196	6.72E-74	+	.	Name=SSF53223;Target=P00370 6 196;status=T;ID=match$34_6_196;date=24-01-2016
+P00370	Gene3D	protein_match	68	188	1.0E-60	+	.	Name=G3DSA:3.40.192.10;Target=P00370 68 188;status=T;ID=match$35_68_188;date=24-01-2016
+P00370	Pfam	protein_match	202	445	1.3E-87	+	.	Name=PF00208;signature_desc=Glutamate/Leucine/Phenylalanine/Valine dehydrogenase;Target=P00370 202 445;status=T;ID=match$36_202_445;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006096"
+P00370	PIRSF	protein_match	22	447	1.8E-114	+	.	Name=PIRSF000185;Target=P00370 22 447;status=T;ID=match$37_22_447;Ontology_term="GO:0016639","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR014362"
+P00370	SMART	protein_match	204	445	2.0E-93	+	.	Name=SM00839;signature_desc=Glutamate/Leucine/Phenylalanine/Valine dehydrogenase;Target=P00370 204 445;status=T;ID=match$38_204_445;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006096"
+P00370	Gene3D	protein_match	209	372	1.6E-63	+	.	Name=G3DSA:3.40.50.720;Target=P00370 209 372;status=T;ID=match$39_209_372;date=24-01-2016;Dbxref="InterPro:IPR016040"
+P00370	SUPERFAMILY	protein_match	202	446	4.96E-77	+	.	Name=SSF51735;Target=P00370 202 446;status=T;ID=match$40_202_446;date=24-01-2016;Dbxref="InterPro:IPR016040"
+P00370	Gene3D	protein_match	7	67	8.2E-28	+	.	Name=G3DSA:1.10.285.10;Target=P00370 7 67;status=T;ID=match$41_7_67;date=24-01-2016
+P00370	Gene3D	protein_match	373	446	2.0E-26	+	.	Name=G3DSA:1.10.285.10;Target=P00370 373 446;status=T;ID=match$41_373_446;date=24-01-2016
+P00370	ProSitePatterns	protein_match	122	135	.	+	.	Name=PS00074;signature_desc=Glu / Leu / Phe / Val dehydrogenases active site.;Target=P00370 122 135;status=T;ID=match$42_122_135;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006095"
+P00370	Pfam	protein_match	57	184	6.3E-49	+	.	Name=PF02812;signature_desc=Glu/Leu/Phe/Val dehydrogenase, dimerisation domain;Target=P00370 57 184;status=T;ID=match$43_57_184;Ontology_term="GO:0006520","GO:0016491","GO:0055114";date=24-01-2016;Dbxref="InterPro:IPR006097"
+P00370	PANTHER	protein_match	1	447	3.2E-250	+	.	Name=PTHR11606;Target=P00370 1 447;status=T;ID=match$44_1_447;date=24-01-2016
+P00370	PANTHER	protein_match	1	447	3.2E-250	+	.	Name=PTHR11606:SF4;Target=P00370 1 447;status=T;ID=match$45_1_447;date=24-01-2016
+##sequence-region C1P5Z7 1 43
+C1P5Z7	.	polypeptide	1	43	.	+	.	md5=abfa044baa298f169ea62ac6b48e1185;ID=C1P5Z7
+C1P5Z7	Pfam	protein_match	2	37	1.0E-11	+	.	Name=PF15894;signature_desc=Inhibitor of glucose uptake transporter SgrT;Target=C1P5Z7 2 37;status=T;ID=match$46_2_37;Ontology_term="GO:0046325";date=24-01-2016;Dbxref="InterPro:IPR031767"
+##FASTA
+>C1P5Z7
+MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES
+>P00350
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
+>P00363
+MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
+DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
+KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
+LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
+GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
+KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
+GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
+AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
+TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGEADAADKAEAANKKEKA
+NG
+>P00370
+MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
+IQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
+TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
+GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
+GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
+GLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
+QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
+EQTNYVQGANIAGFVKVADAMLAQGVI
+>match$1_2_250
+QTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHD
+SFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMK
+IERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTL
+VQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSG
+ILMTEGCRG
+>match$1_361_415
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERA
+>match$2_7_581
+DLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYH
+FHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTW
+FAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRA
+NAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTE
+GCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTIS
+TPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQ
+NCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAI
+EAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQER
+FKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDV
+NFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVY
+>match$3_234_352
+PTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQ
+AFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVR
+>match$4_7_29
+DLAIVGAGGAGLRAAIAAAQANP
+>match$4_375_382
+LFAVGECS
+>match$5_426_537
+IEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQE
+RFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLD
+>match$6_423_443
+EAAIEAQAAGVEQRLKDLVNQ
+>match$7_2_233
+QTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHD
+SFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMK
+IERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTL
+VQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYH
+>match$7_353_416
+PTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQAT
+ERAA
+>match$8_1_584
+MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
+DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
+KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
+LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
+GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
+KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
+GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
+AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
+TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGE
+>match$9_444_590
+DGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDL
+LYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTR
+LEYSDVKITTLPPAKRVYGGEADAADK
+>match$10_1_584
+MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
+DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
+KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
+LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
+GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
+KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
+GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
+AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
+TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGE
+>match$11_1_575
+MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
+DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
+KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
+LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
+GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
+KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
+GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
+AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
+TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLP
+>match$12_3_582
+TFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDS
+FEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKI
+ERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLV
+QIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGI
+LMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKG
+NTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGI
+ETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGN
+EAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAE
+LQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTE
+RDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYG
+>match$13_453_581
+RDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHG
+LNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKIT
+TLPPAKRVY
+>match$14_473_493
+MQKTIDKLAELQERFKRVRIT
+>match$15_43_52
+RSHTVAAEGG
+>match$16_543_577
+RDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPA
+>match$17_227_358
+MEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELG
+PRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVK
+EPIPVRPTAHYT
+>match$18_7_397
+DLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYH
+FHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTW
+FAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRA
+NAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTE
+GCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTIS
+TPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQ
+NCETRIKGLFAVGECSSVGLHGANRLGSNSL
+>match$19_8_27
+LAIVGAGGAGLRAAIAAAQA
+>match$19_360_382
+GGIETDQNCETRIKGLFAVGECS
+>match$20_4_173
+QQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVES
+LETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFI
+GTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYI
+>match$21_5_467
+QIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESL
+ETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIG
+TGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKM
+VHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDE
+DGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLS
+GPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGC
+IIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAA
+VAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWL
+>match$22_1_180
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+>match$23_3_174
+KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVE
+SLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNF
+IGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIG
+>match$24_1_468
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
+>match$25_253_265
+ILDEAANKGTGKW
+>match$26_181_433
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRA
+>match$27_436_467
+LPANLIQAQRDYFGAHTYKRIDKEGVFHTEWL
+>match$28_4_27
+QQIGVVGMAVMGRNLALNIESRGY
+>match$28_66_95
+TPRRILLMVKAGAGTDAAIDSLKPYLDKGD
+>match$28_119_144
+GFNFIGTGVSGGEEGALKGPSIMPGG
+>match$28_168_196
+PCVTYIGADGAGHYVKMVHNGIEYGDMQL
+>match$28_249_276
+LVDVILDEAANKGTGKWTSQSALDLGEP
+>match$28_356_378
+IAKIFRAGCIIRAQFLQKITDAY
+>match$29_1_466
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
+>match$30_1_466
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
+>match$31_179_466
+GHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDI
+FTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVA
+ASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAK
+IFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPV
+PTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
+>match$32_177_467
+GAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITK
+DIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQR
+VAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEI
+AKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGI
+PVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWL
+>match$33_114_128
+TFKNALTTLPMGGGK
+>match$33_193_215
+VFTGKGLSFGGSLIRPEATGYGL
+>match$33_235_255
+VSVSGSGNVAQYAIEKAMEFG
+>match$33_372_383
+ANAGGVATSGLE
+>match$34_6_196
+SLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRV
+VWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMG
+GGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMKK
+LSNNTACVFTG
+>match$35_68_188
+VDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGG
+KGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMKKLS
+N
+>match$36_202_445
+GGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITA
+SDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPC
+ATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSG
+LEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAM
+LAQG
+>match$37_22_447
+TEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVVWVDDRNQIQVNRAWR
+VQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEG
+EVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSF
+GGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITA
+SDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPC
+ATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSG
+LEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAM
+LAQGVI
+>match$38_204_445
+SLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASD
+SSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPCAT
+QNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLE
+MAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAMLA
+QG
+>match$39_209_372
+EATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTV
+VDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPCATQNELD
+VDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAA
+>match$40_202_446
+GGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITA
+SDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPC
+ATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSG
+LEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAM
+LAQGV
+>match$41_7_67
+LESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVV
+W
+>match$41_373_446
+NAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIA
+GFVKVADAMLAQGV
+>match$42_122_135
+LPMGGGKGGSDFDP
+>match$43_57_184
+PERVIQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFK
+NALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREV
+GFMAGMMK
+>match$44_1_447
+MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
+IQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
+TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
+GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
+GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
+GLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
+QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
+EQTNYVQGANIAGFVKVADAMLAQGVI
+>match$45_1_447
+MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
+IQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
+TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
+GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
+GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
+GLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
+QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
+EQTNYVQGANIAGFVKVADAMLAQGVI
+>match$46_2_37
+RQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWD
Binary file interproscan5/data/__base__.html.tar.gz has changed
Binary file interproscan5/data/__base__.svg.tar.gz has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/data/__base__.tsv	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,59 @@
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	SUPERFAMILY	SSF51905		361	415	2.27E-71	T	24-01-2016	IPR023753	FAD/NAD(P)-binding domain	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	SUPERFAMILY	SSF51905		2	250	2.27E-71	T	24-01-2016	IPR023753	FAD/NAD(P)-binding domain	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	TIGRFAM	TIGR01812	sdhA_frdA_Gneg: succinate dehydrogenase or fumarate reductase, flavoprotein subunit	7	581	4.7E-250	T	24-01-2016	IPR014006	Succinate dehydrogenase/fumarate reductase, flavoprotein subunit	GO:0016627|GO:0022900|GO:0050660|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Gene3D	G3DSA:3.90.700.10		234	352	3.6E-37	T	24-01-2016	IPR027477	Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain	
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PRINTS	PR00411	Pyridine nucleotide disulphide reductase class-I signature	375	382	2.5E-5	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PRINTS	PR00411	Pyridine nucleotide disulphide reductase class-I signature	7	29	2.5E-5	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Gene3D	G3DSA:1.20.58.100		426	537	1.5E-38	T	24-01-2016	IPR015939	Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Coils	Coil		423	443	-	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Gene3D	G3DSA:3.50.50.60		353	416	5.9E-106	T	24-01-2016	IPR023753	FAD/NAD(P)-binding domain	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Gene3D	G3DSA:3.50.50.60		2	233	5.9E-106	T	24-01-2016	IPR023753	FAD/NAD(P)-binding domain	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PANTHER	PTHR11632		1	584	0.0	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	SUPERFAMILY	SSF46977		444	590	3.01E-46	T	24-01-2016	IPR015939	Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PANTHER	PTHR11632:SF50		1	584	0.0	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PIRSF	PIRSF000171		1	575	2.0E-42	T	24-01-2016	IPR030664	Succinate dehydrogenase/fumarate reductase, alpha/adenylylsulphate reductase subunit	
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	TIGRFAM	TIGR01176	fum_red_Fp: fumarate reductase (quinol), flavoprotein subunit	3	582	0.0	T	24-01-2016	IPR005884	Fumarate reductase, flavoprotein subunit	GO:0009061|GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Pfam	PF02910	Fumarate reductase flavoprotein C-term	453	581	7.0E-39	T	24-01-2016	IPR015939	Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Coils	Coil		473	493	-	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	ProSitePatterns	PS00504	Fumarate reductase / succinate dehydrogenase FAD-binding site.	43	52	-	T	24-01-2016	IPR003952	Fumarate reductase/succinate dehydrogenase, FAD-binding site	GO:0016491|GO:0055114
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Gene3D	G3DSA:4.10.80.40		543	577	5.5E-18	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	SUPERFAMILY	SSF56425		227	358	6.88E-43	T	24-01-2016	IPR027477	Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain	
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	Pfam	PF00890	FAD binding domain	7	397	1.1E-115	T	24-01-2016	IPR003953	FAD-dependent oxidoreductase 2, FAD binding domain	
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PRINTS	PR00368	FAD-dependent pyridine nucleotide reductase signature	8	27	3.0E-10	T	24-01-2016
+P00363	0d2c0f1acdd08ab0157f2308531a58e4	602	PRINTS	PR00368	FAD-dependent pyridine nucleotide reductase signature	360	382	3.0E-10	T	24-01-2016
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	SUPERFAMILY	SSF51735		4	173	4.86E-50	T	24-01-2016	IPR016040	NAD(P)-binding domain	
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	TIGRFAM	TIGR00873	gnd: 6-phosphogluconate dehydrogenase (decarboxylating)	5	467	1.1E-232	T	24-01-2016	IPR006113	6-phosphogluconate dehydrogenase, decarboxylating	GO:0004616|GO:0006098|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	Gene3D	G3DSA:3.40.50.720		1	180	1.9E-61	T	24-01-2016	IPR016040	NAD(P)-binding domain	
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	Pfam	PF03446	NAD binding domain of 6-phosphogluconate dehydrogenase	3	174	1.8E-52	T	24-01-2016	IPR006115	6-phosphogluconate dehydrogenase, NADP-binding	GO:0004616|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PIRSF	PIRSF000109		1	468	1.9E-243	T	24-01-2016	IPR006113	6-phosphogluconate dehydrogenase, decarboxylating	GO:0004616|GO:0006098|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	ProSitePatterns	PS00461	6-phosphogluconate dehydrogenase signature.	253	265	-	T	24-01-2016	IPR006184	6-phosphogluconate-binding site	GO:0004616|GO:0006098|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	Gene3D	G3DSA:1.10.1040.10		181	433	1.0E-119	T	24-01-2016	IPR013328	6-phosphogluconate dehydrogenase, domain 2	GO:0016491|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	Gene3D	G3DSA:1.20.5.320		436	467	1.4E-22	T	24-01-2016	IPR012284	6-phosphogluconate dehydrogenase, domain 3	
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	249	276	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	168	196	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	66	95	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	119	144	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	4	27	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PRINTS	PR00076	6-phosphogluconate dehydrogenase signature	356	378	1.521867E-89	T	24-01-2016	IPR006183	6-phosphogluconate dehydrogenase	GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PANTHER	PTHR11811:SF25		1	466	7.6E-305	T	24-01-2016
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	PANTHER	PTHR11811		1	466	7.6E-305	T	24-01-2016
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	Pfam	PF00393	6-phosphogluconate dehydrogenase, C-terminal domain	179	466	2.0E-132	T	24-01-2016	IPR006114	6-phosphogluconate dehydrogenase, C-terminal	GO:0004616|GO:0006098|GO:0055114
+P00350	1776f92beb74ff0ccd9ac47a65663644	468	SUPERFAMILY	SSF48179		177	467	6.8E-132	T	24-01-2016	IPR008927	6-phosphogluconate dehydrogenase C-terminal domain-like	GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PRINTS	PR00082	Glutamate/leucine/phenylalanine/valine dehydrogenase signature	372	383	2.5E-33	T	24-01-2016	IPR006095	Glutamate/phenylalanine/leucine/valine dehydrogenase	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PRINTS	PR00082	Glutamate/leucine/phenylalanine/valine dehydrogenase signature	114	128	2.5E-33	T	24-01-2016	IPR006095	Glutamate/phenylalanine/leucine/valine dehydrogenase	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PRINTS	PR00082	Glutamate/leucine/phenylalanine/valine dehydrogenase signature	235	255	2.5E-33	T	24-01-2016	IPR006095	Glutamate/phenylalanine/leucine/valine dehydrogenase	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PRINTS	PR00082	Glutamate/leucine/phenylalanine/valine dehydrogenase signature	193	215	2.5E-33	T	24-01-2016	IPR006095	Glutamate/phenylalanine/leucine/valine dehydrogenase	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	SUPERFAMILY	SSF53223		6	196	6.72E-74	T	24-01-2016
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Gene3D	G3DSA:3.40.192.10		68	188	1.0E-60	T	24-01-2016
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Pfam	PF00208	Glutamate/Leucine/Phenylalanine/Valine dehydrogenase	202	445	1.3E-87	T	24-01-2016	IPR006096	Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PIRSF	PIRSF000185		22	447	1.8E-114	T	24-01-2016	IPR014362	Glutamate dehydrogenase	GO:0016639|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	SMART	SM00839	Glutamate/Leucine/Phenylalanine/Valine dehydrogenase	204	445	2.0E-93	T	24-01-2016	IPR006096	Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Gene3D	G3DSA:3.40.50.720		209	372	1.6E-63	T	24-01-2016	IPR016040	NAD(P)-binding domain	
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	SUPERFAMILY	SSF51735		202	446	4.96E-77	T	24-01-2016	IPR016040	NAD(P)-binding domain	
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Gene3D	G3DSA:1.10.285.10		7	67	8.2E-28	T	24-01-2016
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Gene3D	G3DSA:1.10.285.10		373	446	2.0E-26	T	24-01-2016
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	ProSitePatterns	PS00074	Glu / Leu / Phe / Val dehydrogenases active site.	122	135	-	T	24-01-2016	IPR006095	Glutamate/phenylalanine/leucine/valine dehydrogenase	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	Pfam	PF02812	Glu/Leu/Phe/Val dehydrogenase, dimerisation domain	57	184	6.3E-49	T	24-01-2016	IPR006097	Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domain	GO:0006520|GO:0016491|GO:0055114
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PANTHER	PTHR11606		1	447	3.2E-250	T	24-01-2016
+P00370	9ec8e26fcf5c160f533bf9a69dec0212	447	PANTHER	PTHR11606:SF4		1	447	3.2E-250	T	24-01-2016
+C1P5Z7	abfa044baa298f169ea62ac6b48e1185	43	Pfam	PF15894	Inhibitor of glucose uptake transporter SgrT	2	37	1.0E-11	T	24-01-2016	IPR031767	Inhibitor of glucose uptake transporter SgrT	GO:0046325
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/data/__base__.xml	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,2204 @@
+<?xml version="1.0" encoding="UTF-8" standalone="yes"?>
+<protein-matches xmlns="http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5">
+    <protein>
+        <sequence md5="0d2c0f1acdd08ab0157f2308531a58e4">MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGNGNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGEADAADKAEAANKKEKANG</sequence>
+        <xref desc="FRDA_ECOLI Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) GN=frdA PE=1 SV=3"
+              db="sp" id="P00363" name="Fumarate reductase flavoprotein subunit"/>
+        <matches>
+            <coils-match>
+                <signature ac="Coil" name="Coil">
+                    <signature-library-release library="COILS" version="2.2.1"/>
+                </signature>
+                <locations>
+                    <coils-location start="423" end="443"/>
+                </locations>
+            </coils-match>
+            <coils-match>
+                <signature ac="Coil" name="Coil">
+                    <signature-library-release library="COILS" version="2.2.1"/>
+                </signature>
+                <locations>
+                    <coils-location start="473" end="493"/>
+                </locations>
+            </coils-match>
+            <fingerprints-match evalue="2.5E-5" graphscan="I....I...">
+                <signature ac="PR00411" desc="Pyridine nucleotide disulphide reductase class-I signature"
+                           name="PNDRDTASEI">
+                    <models>
+                        <model ac="PR00411" desc="Pyridine nucleotide disulphide reductase class-I signature"
+                               name="PNDRDTASEI"/>
+                    </models>
+                    <signature-library-release library="PRINTS" version="42.0"/>
+                </signature>
+                <locations>
+                    <fingerprints-location motifNumber="6" pvalue="0.0222" score="30.15" start="375" end="382"/>
+                    <fingerprints-location motifNumber="1" pvalue="4.15E-10" score="41.52" start="7" end="29"/>
+                </locations>
+            </fingerprints-match>
+            <fingerprints-match evalue="3.0E-10" graphscan="I...I">
+                <signature ac="PR00368" desc="FAD-dependent pyridine nucleotide reductase signature" name="FADPNR">
+                    <models>
+                        <model ac="PR00368" desc="FAD-dependent pyridine nucleotide reductase signature" name="FADPNR"/>
+                    </models>
+                    <signature-library-release library="PRINTS" version="42.0"/>
+                </signature>
+                <locations>
+                    <fingerprints-location motifNumber="1" pvalue="4.72E-9" score="47.18" start="8" end="27"/>
+                    <fingerprints-location motifNumber="5" pvalue="3.2E-8" score="30.52" start="360" end="382"/>
+                </locations>
+            </fingerprints-match>
+            <hmmer3-match evalue="4.2E-250" score="829.0">
+                <signature ac="TIGR01812"
+                           desc="sdhA_frdA_Gneg: succinate dehydrogenase or fumarate reductase, flavoprotein subunit"
+                           name="TIGR01812">
+                    <entry ac="IPR014006" desc="Succinate dehydrogenase/fumarate reductase, flavoprotein subunit"
+                           name="Succ_Dhase_FrdA_Gneg" type="FAMILY">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016627"
+                                 name="oxidoreductase activity, acting on the CH-CH group of donors"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0022900" name="electron transport chain"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0050660"
+                                 name="flavin adenine dinucleotide binding"/>
+                        <pathway-xref db="KEGG" id="00020+1.3.5.1" name="Citrate cycle (TCA cycle)"/>
+                        <pathway-xref db="KEGG" id="00650+1.3.5.1" name="Butanoate metabolism"/>
+                        <pathway-xref db="KEGG" id="00190+1.3.5.1" name="Oxidative phosphorylation"/>
+                        <pathway-xref db="MetaCyc" id="PWY-561"
+                                      name="Superpathway of glyoxylate cycle and fatty acid degradation"/>
+                        <pathway-xref db="KEGG" id="00720+1.3.5.1" name="Carbon fixation pathways in prokaryotes"/>
+                        <pathway-xref db="MetaCyc" id="PWY-5690" name="TCA cycle II (plants and fungi)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-7254" name="TCA cycle VII (acetate-producers)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-6969"
+                                      name="TCA cycle V (2-oxoglutarate:ferredoxin oxidoreductase)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-6728" name="Methylaspartate cycle"/>
+                        <pathway-xref db="MetaCyc" id="PWY-4302"
+                                      name="Aerobic respiration III (alternative oxidase pathway)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-7279" name="Aerobic respiration II (cytochrome c) (yeast)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-3781" name="Aerobic respiration I (cytochrome c)"/>
+                    </entry>
+                    <models>
+                        <model ac="TIGR01812"
+                               desc="sdhA_frdA_Gneg: succinate dehydrogenase or fumarate reductase, flavoprotein subunit"
+                               name="TIGR01812"/>
+                    </models>
+                    <signature-library-release library="TIGRFAM" version="15.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="581" env-start="7" score="828.8" evalue="4.7E-250" hmm-start="1"
+                                     hmm-end="568" hmm-length="0" start="7" end="581"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.6E-37" score="127.8">
+                <signature ac="G3DSA:3.90.700.10">
+                    <entry ac="IPR027477"
+                           desc="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"
+                           name="Succ_DH/fumarate_Rdtase_cat" type="DOMAIN"/>
+                    <models>
+                        <model ac="1y0pA03"/>
+                        <model ac="1jnrA02"/>
+                        <model ac="1chuA02"/>
+                        <model ac="2bs2A02"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="352" env-start="230" score="126.6" evalue="3.6E-37" hmm-start="1"
+                                     hmm-end="107" hmm-length="0" start="234" end="352"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="9.1E-39" score="131.9">
+                <signature ac="G3DSA:1.20.58.100">
+                    <entry ac="IPR015939"
+                           desc="Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal"
+                           name="Fum_Rdtase/Succ_DH_flav-like_C" type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="2bs2A03"/>
+                        <model ac="1kf6A03"/>
+                        <model ac="1knrA03"/>
+                        <model ac="2h88A03"/>
+                        <model ac="2wdqA03"/>
+                        <model ac="1jnrA03"/>
+                        <model ac="1chuA03"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="541" env-start="423" score="131.2" evalue="1.5E-38" hmm-start="4"
+                                     hmm-end="115" hmm-length="0" start="426" end="537"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="4.0E-106" score="354.2">
+                <signature ac="G3DSA:3.50.50.60">
+                    <entry ac="IPR023753" desc="FAD/NAD(P)-binding domain" name="FAD/NAD-binding_dom" type="DOMAIN">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                    </entry>
+                    <models>
+                        <model ac="1chuA01"/>
+                        <model ac="1fl2A01"/>
+                        <model ac="1d5tA01"/>
+                        <model ac="1xdiA02"/>
+                        <model ac="1fecA02"/>
+                        <model ac="1w4xA01"/>
+                        <model ac="3c4nA01"/>
+                        <model ac="1jnrA01"/>
+                        <model ac="1xdiA01"/>
+                        <model ac="1sezA01"/>
+                        <model ac="2h88A01"/>
+                        <model ac="1ju2A01"/>
+                        <model ac="1trbA01"/>
+                        <model ac="3qvpA01"/>
+                        <model ac="2gv8A02"/>
+                        <model ac="1fcdA02"/>
+                        <model ac="1rsgB01"/>
+                        <model ac="2yquA02"/>
+                        <model ac="1b37A01"/>
+                        <model ac="1kdgA01"/>
+                        <model ac="2gf3A01"/>
+                        <model ac="1mo9A01"/>
+                        <model ac="1rsgA01"/>
+                        <model ac="2gqwA01"/>
+                        <model ac="1nhpA01"/>
+                        <model ac="2pyxA01"/>
+                        <model ac="3f8dA02"/>
+                        <model ac="2r9zA02"/>
+                        <model ac="2gqfA01"/>
+                        <model ac="1vg0A01"/>
+                        <model ac="1pj5A01"/>
+                        <model ac="2i0zA01"/>
+                        <model ac="1o94A03"/>
+                        <model ac="1rp0A02"/>
+                        <model ac="3gyjA01"/>
+                        <model ac="2eq6A02"/>
+                        <model ac="3dghA02"/>
+                        <model ac="1fcdA01"/>
+                        <model ac="1y0pA02"/>
+                        <model ac="1pn0A01"/>
+                        <model ac="1k0iA01"/>
+                        <model ac="2zbwA01"/>
+                        <model ac="1gteA03"/>
+                        <model ac="1nhpA02"/>
+                        <model ac="1xhcA01"/>
+                        <model ac="2iidA02"/>
+                        <model ac="1lqtA02"/>
+                        <model ac="3c4aA01"/>
+                        <model ac="3cgvA01"/>
+                        <model ac="3dghA01"/>
+                        <model ac="1mo9A02"/>
+                        <model ac="1fl2A02"/>
+                        <model ac="1onfA02"/>
+                        <model ac="3dk9A01"/>
+                        <model ac="2zbwA02"/>
+                        <model ac="1m6iA01"/>
+                        <model ac="2eq6A01"/>
+                        <model ac="1ps9A03"/>
+                        <model ac="1gteA04"/>
+                        <model ac="2qaeA02"/>
+                        <model ac="3fg2P02"/>
+                        <model ac="2gqwA02"/>
+                        <model ac="3dk9A02"/>
+                        <model ac="3fbsB01"/>
+                        <model ac="2gv8A01"/>
+                        <model ac="3o0hA01"/>
+                        <model ac="1s3eA01"/>
+                        <model ac="1ryiA01"/>
+                        <model ac="1m6iA02"/>
+                        <model ac="3kkjA01"/>
+                        <model ac="3fbsA02"/>
+                        <model ac="1q1rA01"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="420" env-start="1" score="353.6" evalue="5.9E-106" hmm-start="15"
+                                     hmm-end="329" hmm-length="0" start="353" end="416"/>
+                    <hmmer3-location env-end="420" env-start="1" score="353.6" evalue="5.9E-106" hmm-start="15"
+                                     hmm-end="329" hmm-length="0" start="2" end="233"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="8.5E-43" score="144.0">
+                <signature ac="PIRSF000171" name="SDHA_APRA_LASPO">
+                    <entry ac="IPR030664"
+                           desc="Succinate dehydrogenase/fumarate reductase, alpha/adenylylsulphate reductase subunit"
+                           name="SdhA/FrdA/AprA" type="FAMILY"/>
+                    <models>
+                        <model ac="PIRSF000171" name="SDHA_APRA_LASPO"/>
+                    </models>
+                    <signature-library-release library="PIRSF" version="3.01"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="575" env-start="1" score="142.8" evalue="2.0E-42" hmm-start="3"
+                                     hmm-end="565" hmm-length="0" start="1" end="575"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="0.0" score="1214.6">
+                <signature ac="TIGR01176" desc="fum_red_Fp: fumarate reductase (quinol), flavoprotein subunit"
+                           name="TIGR01176">
+                    <entry ac="IPR005884" desc="Fumarate reductase, flavoprotein subunit" name="Fum_red_fp"
+                           type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0009061" name="anaerobic respiration"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <pathway-xref db="KEGG" id="00650+1.3.5.4" name="Butanoate metabolism"/>
+                        <pathway-xref db="KEGG" id="00720+1.3.5.4" name="Carbon fixation pathways in prokaryotes"/>
+                        <pathway-xref db="KEGG" id="00620+1.3.5.4" name="Pyruvate metabolism"/>
+                        <pathway-xref db="MetaCyc" id="PWY-5913" name="Partial TCA cycle (obligate autotrophs)"/>
+                        <pathway-xref db="KEGG" id="00020+1.3.5.4" name="Citrate cycle (TCA cycle)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-7384"
+                                      name="Anaerobic energy metabolism (invertebrates, mitochondrial)"/>
+                        <pathway-xref db="MetaCyc" id="PWY-5392" name="Reductive TCA cycle II"/>
+                    </entry>
+                    <models>
+                        <model ac="TIGR01176" desc="fum_red_Fp: fumarate reductase (quinol), flavoprotein subunit"
+                               name="TIGR01176"/>
+                    </models>
+                    <signature-library-release library="TIGRFAM" version="15.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="582" env-start="3" score="1214.4" evalue="0.0" hmm-start="1" hmm-end="580"
+                                     hmm-length="0" start="3" end="582"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="4.2E-39" score="133.1">
+                <signature ac="PF02910" desc="Fumarate reductase flavoprotein C-term" name="Succ_DH_flav_C">
+                    <entry ac="IPR015939"
+                           desc="Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal"
+                           name="Fum_Rdtase/Succ_DH_flav-like_C" type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="PF02910" desc="Fumarate reductase flavoprotein C-term" name="Succ_DH_flav_C"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="581" env-start="453" score="132.4" evalue="7.0E-39" hmm-start="1"
+                                     hmm-end="128" hmm-length="0" start="453" end="581"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="2.3E-18" score="65.2">
+                <signature ac="G3DSA:4.10.80.40">
+                    <models>
+                        <model ac="1kf6A04"/>
+                        <model ac="2h88A04"/>
+                        <model ac="2wdqA04"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="577" env-start="543" score="64.1" evalue="5.5E-18" hmm-start="1"
+                                     hmm-end="35" hmm-length="0" start="543" end="577"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.1E-115" score="386.8">
+                <signature ac="PF00890" desc="FAD binding domain" name="FAD_binding_2">
+                    <entry ac="IPR003953" desc="FAD-dependent oxidoreductase 2, FAD binding domain" name="FAD-binding_2"
+                           type="DOMAIN"/>
+                    <models>
+                        <model ac="PF00890" desc="FAD binding domain" name="FAD_binding_2"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="397" env-start="7" score="386.8" evalue="1.1E-115" hmm-start="1"
+                                     hmm-end="417" hmm-length="0" start="7" end="397"/>
+                </locations>
+            </hmmer3-match>
+            <panther-match evalue="0.0" familyName="SUCCINATE DEHYDROGENASE 2 FLAVOPROTEIN SUBUNIT" score="1520.5">
+                <signature ac="PTHR11632" name="SUCCINATE DEHYDROGENASE 2 FLAVOPROTEIN SUBUNIT">
+                    <models>
+                        <model ac="PTHR11632" name="SUCCINATE DEHYDROGENASE 2 FLAVOPROTEIN SUBUNIT"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="584"/>
+                </locations>
+            </panther-match>
+            <panther-match evalue="0.0" familyName="FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT" score="1520.5">
+                <signature ac="PTHR11632:SF50" name="FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT">
+                    <models>
+                        <model ac="PTHR11632:SF50" name="FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="584"/>
+                </locations>
+            </panther-match>
+            <patternscan-match>
+                <signature ac="PS00504" desc="Fumarate reductase / succinate dehydrogenase FAD-binding site."
+                           name="FRD_SDH_FAD_BINDING">
+                    <entry ac="IPR003952" desc="Fumarate reductase/succinate dehydrogenase, FAD-binding site"
+                           name="FRD_SDH_FAD_BS" type="BINDING_SITE">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                    </entry>
+                    <models>
+                        <model ac="PS00504" desc="Fumarate reductase / succinate dehydrogenase FAD-binding site."
+                               name="FRD_SDH_FAD_BINDING"/>
+                    </models>
+                    <signature-library-release library="PROSITE_PATTERNS" version="20.113"/>
+                </signature>
+                <locations>
+                    <patternscan-location level="STRONG" start="43" end="52">
+                        <alignment>RSHTvaAeGG</alignment>
+                    </patternscan-location>
+                </locations>
+            </patternscan-match>
+            <superfamilyhmmer3-match evalue="2.27E-71">
+                <signature ac="SSF51905" name="FAD/NAD(P)-binding domain">
+                    <entry ac="IPR023753" desc="FAD/NAD(P)-binding domain" name="FAD/NAD-binding_dom" type="DOMAIN">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                    </entry>
+                    <models>
+                        <model ac="0048494" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052964" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0038468" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050363" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052600" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048009" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045798" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0053857" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052313" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047270" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045519" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048583" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0044705" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050364" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050960" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046270" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047022" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036889" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047564" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040688" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046274" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036016" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046416" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0037643" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0054879" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0044413" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0038285" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040660" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040619" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046128" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046972" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046973" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047682" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040602" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047271" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040049" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052032" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052911" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036301" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046446" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0042446" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0044098" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047029" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048584" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052926" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048200" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036654" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048365" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048045" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0035989" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045518" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036300" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048865" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0049150" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046344" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046514" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047565" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0054159" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046750" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0038449" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046761" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046760" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0036092" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047133" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0039664" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0041341" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0041940" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048199" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046751" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050961" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045881" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0043577" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047068" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0053322" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0054729" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0052963" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0049222" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050927" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0050148" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0037441" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048866" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048771" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048356" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0053321" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0049003" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048607" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0038074" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048108" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0047712" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0048364" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046579" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0046834" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045870" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0049930" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0045797" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0054078" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0040035" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0053967" name="FAD/NAD(P)-binding domain"/>
+                        <model ac="0049679" name="FAD/NAD(P)-binding domain"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="361" end="415"/>
+                    <superfamilyhmmer3-location start="2" end="250"/>
+                </locations>
+            </superfamilyhmmer3-match>
+            <superfamilyhmmer3-match evalue="3.01E-46">
+                <signature ac="SSF46977"
+                           name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain">
+                    <entry ac="IPR015939"
+                           desc="Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal"
+                           name="Fum_Rdtase/Succ_DH_flav-like_C" type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="0035988"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain"/>
+                        <model ac="0048345"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain"/>
+                        <model ac="0052031"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain"/>
+                        <model ac="0040048"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain"/>
+                        <model ac="0039663"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="444" end="590"/>
+                </locations>
+            </superfamilyhmmer3-match>
+            <superfamilyhmmer3-match evalue="6.88E-43">
+                <signature ac="SSF56425"
+                           name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain">
+                    <entry ac="IPR027477"
+                           desc="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"
+                           name="Succ_DH/fumarate_Rdtase_cat" type="DOMAIN"/>
+                    <models>
+                        <model ac="0039665"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0052033"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0036733"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0036265"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0040050"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0035990"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0041342"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                        <model ac="0042899"
+                               name="Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="227" end="358"/>
+                </locations>
+            </superfamilyhmmer3-match>
+        </matches>
+    </protein>
+    <protein>
+        <sequence md5="abfa044baa298f169ea62ac6b48e1185">MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES</sequence>
+        <xref desc="SGRT_ECOLI Putative inhibitor of glucose uptake transporter SgrT OS=Escherichia coli (strain K12) GN=sgrT PE=1 SV=1"
+              db="sp" id="C1P5Z7" name="Putative inhibitor of glucose uptake transporter SgrT"/>
+        <matches>
+            <hmmer3-match evalue="8.8E-12" score="44.3">
+                <signature ac="PF15894" desc="Inhibitor of glucose uptake transporter SgrT" name="SgrT">
+                    <entry ac="IPR031767" desc="Inhibitor of glucose uptake transporter SgrT" name="SgrT" type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0046325"
+                                 name="negative regulation of glucose import"/>
+                    </entry>
+                    <models>
+                        <model ac="PF15894" desc="Inhibitor of glucose uptake transporter SgrT" name="SgrT"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="41" env-start="1" score="44.0" evalue="1.0E-11" hmm-start="2" hmm-end="39"
+                                     hmm-length="0" start="2" end="37"/>
+                </locations>
+            </hmmer3-match>
+        </matches>
+    </protein>
+    <protein>
+        <sequence md5="9ec8e26fcf5c160f533bf9a69dec0212">MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAMLAQGVI</sequence>
+        <xref desc="DHE4_ECOLI NADP-specific glutamate dehydrogenase OS=Escherichia coli (strain K12) GN=gdhA PE=1 SV=1"
+              db="sp" id="P00370" name="NADP-specific glutamate dehydrogenase"/>
+        <matches>
+            <fingerprints-match evalue="2.5E-33" graphscan="IIII">
+                <signature ac="PR00082" desc="Glutamate/leucine/phenylalanine/valine dehydrogenase signature"
+                           name="GLFDHDRGNASE">
+                    <entry ac="IPR006095" desc="Glutamate/phenylalanine/leucine/valine dehydrogenase"
+                           name="Glu/Leu/Phe/Val_DH" type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006520"
+                                 name="cellular amino acid metabolic process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="PR00082" desc="Glutamate/leucine/phenylalanine/valine dehydrogenase signature"
+                               name="GLFDHDRGNASE"/>
+                    </models>
+                    <signature-library-release library="PRINTS" version="42.0"/>
+                </signature>
+                <locations>
+                    <fingerprints-location motifNumber="4" pvalue="1.31E-6" score="64.64" start="372" end="383"/>
+                    <fingerprints-location motifNumber="1" pvalue="3.9E-10" score="63.43" start="114" end="128"/>
+                    <fingerprints-location motifNumber="3" pvalue="6.51E-10" score="43.54" start="235" end="255"/>
+                    <fingerprints-location motifNumber="2" pvalue="6.22E-15" score="57.39" start="193" end="215"/>
+                </locations>
+            </fingerprints-match>
+            <hmmer2-match evalue="2.0E-93" score="326.3">
+                <signature ac="SM00839" desc="Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
+                           name="ELFV_dehydrog">
+                    <entry ac="IPR006096" desc="Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal"
+                           name="Glu/Leu/Phe/Val_DH_C" type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006520"
+                                 name="cellular amino acid metabolic process"/>
+                    </entry>
+                    <models>
+                        <model ac="SM00839" desc="Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
+                               name="ELFV_dehydrog"/>
+                    </models>
+                    <signature-library-release library="SMART" version="6.2"/>
+                </signature>
+                <locations>
+                    <hmmer2-location score="326.3" evalue="2.0E-93" hmm-start="1" hmm-end="265" hmm-length="0"
+                                     start="204" end="445"/>
+                </locations>
+            </hmmer2-match>
+            <hmmer3-match evalue="3.9E-61" score="204.1">
+                <signature ac="G3DSA:3.40.192.10">
+                    <models>
+                        <model ac="1vi2A01"/>
+                        <model ac="2hk9A01"/>
+                        <model ac="2d5cA01"/>
+                        <model ac="1c1dA01"/>
+                        <model ac="1gtmA01"/>
+                        <model ac="3o8qA01"/>
+                        <model ac="1lehA01"/>
+                        <model ac="3donA01"/>
+                        <model ac="1a4iA02"/>
+                        <model ac="1bgvA02"/>
+                        <model ac="1edzA02"/>
+                        <model ac="1npyA01"/>
+                        <model ac="1p77A01"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="190" env-start="55" score="202.7" evalue="1.0E-60" hmm-start="2"
+                                     hmm-end="134" hmm-length="0" start="68" end="188"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="9.5E-88" score="293.6">
+                <signature ac="PF00208" desc="Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
+                           name="ELFV_dehydrog">
+                    <entry ac="IPR006096" desc="Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal"
+                           name="Glu/Leu/Phe/Val_DH_C" type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006520"
+                                 name="cellular amino acid metabolic process"/>
+                    </entry>
+                    <models>
+                        <model ac="PF00208" desc="Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
+                               name="ELFV_dehydrog"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="445" env-start="202" score="293.2" evalue="1.3E-87" hmm-start="1"
+                                     hmm-end="243" hmm-length="0" start="202" end="445"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.6E-114" score="380.5">
+                <signature ac="PIRSF000185" name="Glu_DH">
+                    <entry ac="IPR014362" desc="Glutamate dehydrogenase" name="Glu_DH" type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016639"
+                                 name="oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor"/>
+                    </entry>
+                    <models>
+                        <model ac="PIRSF000185" name="Glu_DH"/>
+                    </models>
+                    <signature-library-release library="PIRSF" version="3.01"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="447" env-start="22" score="380.3" evalue="1.8E-114" hmm-start="23"
+                                     hmm-end="446" hmm-length="0" start="22" end="447"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.1E-63" score="213.8">
+                <signature ac="G3DSA:3.40.50.720">
+                    <entry ac="IPR016040" desc="NAD(P)-binding domain" name="NAD(P)-bd_dom" type="DOMAIN"/>
+                    <models>
+                        <model ac="1kolA02"/>
+                        <model ac="1kbzA01"/>
+                        <model ac="1evyA01"/>
+                        <model ac="1gtmA02"/>
+                        <model ac="1gdhA02"/>
+                        <model ac="2a4kB01"/>
+                        <model ac="1xdwA02"/>
+                        <model ac="2bh9A01"/>
+                        <model ac="1xq1A00"/>
+                        <model ac="1ooeA00"/>
+                        <model ac="1v0jA01"/>
+                        <model ac="2zydB01"/>
+                        <model ac="1mx3A01"/>
+                        <model ac="1cjcA01"/>
+                        <model ac="3grpD00"/>
+                        <model ac="1dihA01"/>
+                        <model ac="2ph5A01"/>
+                        <model ac="1f8fA02"/>
+                        <model ac="1xu9C00"/>
+                        <model ac="1jw9B00"/>
+                        <model ac="1u8xX01"/>
+                        <model ac="1edzA01"/>
+                        <model ac="1dxyA01"/>
+                        <model ac="1vl0B01"/>
+                        <model ac="1u1iA01"/>
+                        <model ac="1qp8A01"/>
+                        <model ac="2rafB01"/>
+                        <model ac="1yxmC00"/>
+                        <model ac="1j6uA01"/>
+                        <model ac="1wvgA01"/>
+                        <model ac="1oaaA00"/>
+                        <model ac="1jvbA02"/>
+                        <model ac="1pjcA02"/>
+                        <model ac="3imfC00"/>
+                        <model ac="3e8xA00"/>
+                        <model ac="1jtvA00"/>
+                        <model ac="3ff4A00"/>
+                        <model ac="1y8qB01"/>
+                        <model ac="2gasA01"/>
+                        <model ac="1lqtA01"/>
+                        <model ac="3nx4A02"/>
+                        <model ac="1y7tA01"/>
+                        <model ac="3d4oA02"/>
+                        <model ac="1qp8A02"/>
+                        <model ac="1dljA02"/>
+                        <model ac="2ztuB00"/>
+                        <model ac="2cvzA01"/>
+                        <model ac="1y8qC00"/>
+                        <model ac="2i76A01"/>
+                        <model ac="1ydwA01"/>
+                        <model ac="1eq2A01"/>
+                        <model ac="1li4A02"/>
+                        <model ac="3is3A00"/>
+                        <model ac="1wmaA00"/>
+                        <model ac="1x0vA01"/>
+                        <model ac="3gg9A02"/>
+                        <model ac="2dt5A02"/>
+                        <model ac="3fpcA02"/>
+                        <model ac="1c0pA01"/>
+                        <model ac="2nacA02"/>
+                        <model ac="2ag5C00"/>
+                        <model ac="2nacA01"/>
+                        <model ac="3iccA00"/>
+                        <model ac="1xgkA01"/>
+                        <model ac="3sx2H00"/>
+                        <model ac="2eklA01"/>
+                        <model ac="2g76A02"/>
+                        <model ac="1vi2A02"/>
+                        <model ac="2ekpA00"/>
+                        <model ac="1yqdA02"/>
+                        <model ac="1spxA00"/>
+                        <model ac="2g0tB01"/>
+                        <model ac="2rhcA00"/>
+                        <model ac="1h2bA02"/>
+                        <model ac="1vm6B01"/>
+                        <model ac="2ew2B01"/>
+                        <model ac="1sc6A01"/>
+                        <model ac="1hxhA00"/>
+                        <model ac="1xq6A00"/>
+                        <model ac="2oosB00"/>
+                        <model ac="1e6uA01"/>
+                        <model ac="1gz6B01"/>
+                        <model ac="1t2dA01"/>
+                        <model ac="1piwA02"/>
+                        <model ac="3hn7A01"/>
+                        <model ac="3dr3A01"/>
+                        <model ac="3ckyA01"/>
+                        <model ac="2axqA01"/>
+                        <model ac="1vj0A02"/>
+                        <model ac="3oigA00"/>
+                        <model ac="2rcyA01"/>
+                        <model ac="1f06A01"/>
+                        <model ac="3d1lB01"/>
+                        <model ac="1ebfA01"/>
+                        <model ac="3nepX01"/>
+                        <model ac="2ew8B00"/>
+                        <model ac="3fr7A01"/>
+                        <model ac="1lssA00"/>
+                        <model ac="3p19C00"/>
+                        <model ac="3c24A01"/>
+                        <model ac="2obnD01"/>
+                        <model ac="1hyeA01"/>
+                        <model ac="2hmtA00"/>
+                        <model ac="1omoA02"/>
+                        <model ac="1mv8A03"/>
+                        <model ac="2o3jA03"/>
+                        <model ac="1yl5A01"/>
+                        <model ac="6ldhA01"/>
+                        <model ac="3c85A00"/>
+                        <model ac="1vl6B02"/>
+                        <model ac="1ps9A02"/>
+                        <model ac="3lvfP01"/>
+                        <model ac="3d0oA01"/>
+                        <model ac="2bi7A01"/>
+                        <model ac="2w2kA02"/>
+                        <model ac="1a4iB01"/>
+                        <model ac="3f1lB00"/>
+                        <model ac="1i24A01"/>
+                        <model ac="2ho3A01"/>
+                        <model ac="2py6A02"/>
+                        <model ac="1f0yA01"/>
+                        <model ac="2d4aD01"/>
+                        <model ac="1oi7A01"/>
+                        <model ac="1t4bA01"/>
+                        <model ac="2d0iA02"/>
+                        <model ac="1h5qA00"/>
+                        <model ac="1x7dA02"/>
+                        <model ac="1bgvA01"/>
+                        <model ac="1lu9A02"/>
+                        <model ac="1ks9A01"/>
+                        <model ac="1cydA00"/>
+                        <model ac="2y1eA01"/>
+                        <model ac="2eklA02"/>
+                        <model ac="3mz0A01"/>
+                        <model ac="3c8mA01"/>
+                        <model ac="1lc0A01"/>
+                        <model ac="1i36A01"/>
+                        <model ac="2aefA01"/>
+                        <model ac="1gr0A01"/>
+                        <model ac="2dknB00"/>
+                        <model ac="1zk4A00"/>
+                        <model ac="3meqA02"/>
+                        <model ac="1o6zA02"/>
+                        <model ac="1uzmB00"/>
+                        <model ac="2eggA02"/>
+                        <model ac="1np3B01"/>
+                        <model ac="1geeA00"/>
+                        <model ac="3gg2B01"/>
+                        <model ac="3ai3A00"/>
+                        <model ac="1snyA00"/>
+                        <model ac="1dljA01"/>
+                        <model ac="1ek6A02"/>
+                        <model ac="2amfA01"/>
+                        <model ac="3cinA01"/>
+                        <model ac="2zb4A02"/>
+                        <model ac="3ceaA01"/>
+                        <model ac="1r6dA01"/>
+                        <model ac="1mv8A01"/>
+                        <model ac="1p3dA01"/>
+                        <model ac="1gpjA02"/>
+                        <model ac="1gu7A02"/>
+                        <model ac="3idsA01"/>
+                        <model ac="1txgA01"/>
+                        <model ac="1mx3A02"/>
+                        <model ac="1isiA02"/>
+                        <model ac="1yovC01"/>
+                        <model ac="1j4aD01"/>
+                        <model ac="3hhpA01"/>
+                        <model ac="1jayA00"/>
+                        <model ac="2x9gD00"/>
+                        <model ac="3gemD00"/>
+                        <model ac="3rufA01"/>
+                        <model ac="1dxyA02"/>
+                        <model ac="3kb6A02"/>
+                        <model ac="1lj8A01"/>
+                        <model ac="1q0qA01"/>
+                        <model ac="2d8aA02"/>
+                        <model ac="2pv7A01"/>
+                        <model ac="1y1pA01"/>
+                        <model ac="2z1nA00"/>
+                        <model ac="1v3uB02"/>
+                        <model ac="2dc1A01"/>
+                        <model ac="1fmcA00"/>
+                        <model ac="2jhfA02"/>
+                        <model ac="1xg5B00"/>
+                        <model ac="1xeaA01"/>
+                        <model ac="2gcgA02"/>
+                        <model ac="2bllA01"/>
+                        <model ac="1dpgA01"/>
+                        <model ac="3oidC00"/>
+                        <model ac="1h6dA01"/>
+                        <model ac="1o0sA04"/>
+                        <model ac="1pj3A02"/>
+                        <model ac="2yyyA01"/>
+                        <model ac="3d4oB01"/>
+                        <model ac="2o3jB01"/>
+                        <model ac="3bioB01"/>
+                        <model ac="1l7eA01"/>
+                        <model ac="1hdoA00"/>
+                        <model ac="3fwzA00"/>
+                        <model ac="1sbyA00"/>
+                        <model ac="2h7iA00"/>
+                        <model ac="1up7A01"/>
+                        <model ac="1iukA00"/>
+                        <model ac="1iz0A02"/>
+                        <model ac="1o94A02"/>
+                        <model ac="1r12A02"/>
+                        <model ac="1zmtA00"/>
+                        <model ac="1iy8A00"/>
+                        <model ac="1pl8A02"/>
+                        <model ac="1bdbA00"/>
+                        <model ac="1wlyA02"/>
+                        <model ac="2o23A00"/>
+                        <model ac="3d7lA00"/>
+                        <model ac="1gegA00"/>
+                        <model ac="1c1dA02"/>
+                        <model ac="3k5pA02"/>
+                        <model ac="3g3eA01"/>
+                        <model ac="1n7hA02"/>
+                        <model ac="1hyhA01"/>
+                        <model ac="2a35A00"/>
+                        <model ac="2qytA01"/>
+                        <model ac="2hjsA01"/>
+                        <model ac="2p2sA01"/>
+                        <model ac="1vpdA01"/>
+                        <model ac="2pk3A01"/>
+                        <model ac="1nytA02"/>
+                        <model ac="2g76A01"/>
+                        <model ac="2hrzA01"/>
+                        <model ac="1nvmB01"/>
+                        <model ac="2x5oA01"/>
+                        <model ac="1nhwA00"/>
+                        <model ac="1id1A00"/>
+                        <model ac="1bg6A01"/>
+                        <model ac="3c1aA01"/>
+                        <model ac="3a06B01"/>
+                        <model ac="1npyA02"/>
+                        <model ac="2zatA00"/>
+                        <model ac="3m6iA02"/>
+                        <model ac="1ydeN00"/>
+                        <model ac="2qq5A00"/>
+                        <model ac="3mw9A03"/>
+                        <model ac="1gdhA01"/>
+                        <model ac="1pjqA01"/>
+                        <model ac="1pqwA00"/>
+                        <model ac="1zemA00"/>
+                        <model ac="2d59A00"/>
+                        <model ac="1kyqB01"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="373" env-start="209" score="213.3" evalue="1.6E-63" hmm-start="1"
+                                     hmm-end="167" hmm-length="0" start="209" end="372"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="2.2E-56" score="187.6">
+                <signature ac="G3DSA:1.10.285.10">
+                    <models>
+                        <model ac="1bgvA03"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="79" env-start="5" score="96.0" evalue="8.2E-28" hmm-start="4" hmm-end="75"
+                                     hmm-length="0" start="7" end="67"/>
+                    <hmmer3-location env-end="447" env-start="371" score="91.6" evalue="2.0E-26" hmm-start="1"
+                                     hmm-end="74" hmm-length="0" start="373" end="446"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="2.9E-49" score="165.8">
+                <signature ac="PF02812" desc="Glu/Leu/Phe/Val dehydrogenase, dimerisation domain"
+                           name="ELFV_dehydrog_N">
+                    <entry ac="IPR006097"
+                           desc="Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domain"
+                           name="Glu/Leu/Phe/Val_DH_dimer_dom" type="DOMAIN">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006520"
+                                 name="cellular amino acid metabolic process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                    </entry>
+                    <models>
+                        <model ac="PF02812" desc="Glu/Leu/Phe/Val dehydrogenase, dimerisation domain"
+                               name="ELFV_dehydrog_N"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="185" env-start="57" score="164.8" evalue="6.3E-49" hmm-start="1"
+                                     hmm-end="129" hmm-length="0" start="57" end="184"/>
+                </locations>
+            </hmmer3-match>
+            <panther-match evalue="3.2E-250" familyName="GLUTAMATE DEHYDROGENASE" score="842.1">
+                <signature ac="PTHR11606" name="GLUTAMATE DEHYDROGENASE">
+                    <models>
+                        <model ac="PTHR11606" name="GLUTAMATE DEHYDROGENASE"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="447"/>
+                </locations>
+            </panther-match>
+            <panther-match evalue="3.2E-250" familyName="NADP-SPECIFIC GLUTAMATE DEHYDROGENASE 1-RELATED" score="842.1">
+                <signature ac="PTHR11606:SF4" name="NADP-SPECIFIC GLUTAMATE DEHYDROGENASE 1-RELATED">
+                    <models>
+                        <model ac="PTHR11606:SF4" name="NADP-SPECIFIC GLUTAMATE DEHYDROGENASE 1-RELATED"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="447"/>
+                </locations>
+            </panther-match>
+            <patternscan-match>
+                <signature ac="PS00074" desc="Glu / Leu / Phe / Val dehydrogenases active site."
+                           name="GLFV_DEHYDROGENASE">
+                    <entry ac="IPR006095" desc="Glutamate/phenylalanine/leucine/valine dehydrogenase"
+                           name="Glu/Leu/Phe/Val_DH" type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006520"
+                                 name="cellular amino acid metabolic process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="PS00074" desc="Glu / Leu / Phe / Val dehydrogenases active site."
+                               name="GLFV_DEHYDROGENASE"/>
+                    </models>
+                    <signature-library-release library="PROSITE_PATTERNS" version="20.113"/>
+                </signature>
+                <locations>
+                    <patternscan-location level="STRONG" start="122" end="135">
+                        <alignment>LpmGGGKgGsdfDP</alignment>
+                    </patternscan-location>
+                </locations>
+            </patternscan-match>
+            <superfamilyhmmer3-match evalue="6.72E-74">
+                <signature ac="SSF53223" name="Aminoacid dehydrogenase-like, N-terminal domain">
+                    <models>
+                        <model ac="0040549" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0035291" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0036518" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0037204" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0041590" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0035811" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0036929" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0041513" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0035317" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0035734" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0038223" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0040474" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0040667" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0042181" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0044859" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0041505" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0050104" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0038260" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0035544" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0041638" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0034873" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                        <model ac="0038762" name="Aminoacid dehydrogenase-like, N-terminal domain"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="6" end="196"/>
+                </locations>
+            </superfamilyhmmer3-match>
+            <superfamilyhmmer3-match evalue="4.96E-77">
+                <signature ac="SSF51735" name="NAD(P)-binding Rossmann-fold domains">
+                    <entry ac="IPR016040" desc="NAD(P)-binding domain" name="NAD(P)-bd_dom" type="DOMAIN"/>
+                    <models>
+                        <model ac="0051440" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050247" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046635" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046114" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051702" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048614" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047481" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036194" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041129" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049117" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041868" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040043" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052722" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050365" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035405" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047059" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048454" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049845" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047066" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052744" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050383" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050212" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044853" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039871" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039650" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041692" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044526" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053266" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051213" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045153" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051147" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048533" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040868" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041828" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038050" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035018" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047993" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036744" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035945" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048286" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043337" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048949" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048673" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048469" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045076" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053660" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049902" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047550" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047294" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041770" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048035" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049864" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048414" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052415" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047742" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046123" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049942" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038545" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047681" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049007" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047909" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047963" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038853" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051511" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052284" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051763" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047178" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048755" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045319" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051575" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047040" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046725" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042131" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050721" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037437" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051006" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050204" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036664" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042342" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038057" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038567" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050040" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035477" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041366" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045718" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039935" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048270" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052085" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050237" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038711" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052382" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050203" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051093" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047276" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038342" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044808" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050938" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036579" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049966" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046367" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050241" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049943" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052837" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046059" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037128" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039600" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052803" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052329" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045621" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044044" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036007" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046253" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049730" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048186" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051279" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051542" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041596" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052565" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050022" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041757" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042505" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039780" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044840" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048102" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053216" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048361" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042906" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052183" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035543" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051109" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037662" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046592" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051965" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044559" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042429" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049824" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051996" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050655" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049026" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043042" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036806" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045645" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039438" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051991" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053287" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050090" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039314" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054518" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053172" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045243" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042866" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0034872" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051901" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045894" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052988" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035952" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052326" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051696" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052368" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051235" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038784" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038770" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036542" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043068" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042534" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038547" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040540" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053363" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036438" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050228" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047470" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038324" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048243" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046629" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043041" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051305" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049357" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050914" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046529" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052529" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035290" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036922" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053794" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054099" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046357" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035680" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049686" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044691" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042207" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041999" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047124" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047510" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039919" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040910" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038814" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035305" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048863" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051355" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051285" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038042" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037278" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048808" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052116" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038761" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048799" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038087" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038559" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052978" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048409" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051568" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038068" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043507" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049198" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048757" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049766" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054552" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046574" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036746" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047979" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038232" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048293" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043703" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048227" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050235" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046291" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047054" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047965" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048455" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047263" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046034" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050443" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035535" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047655" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053356" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042340" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046483" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053019" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047346" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036892" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042180" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049519" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046801" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050269" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038379" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047278" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051797" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053195" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051491" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050776" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048416" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050967" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054911" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047847" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038281" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051183" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046673" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051260" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040651" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051264" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035316" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050890" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052745" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045444" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047992" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051925" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036785" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042366" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048107" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035471" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043276" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053286" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046472" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046897" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043678" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051327" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047443" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053383" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049428" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050869" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048027" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048974" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051203" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048585" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047032" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041610" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040551" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052818" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038022" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049820" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047869" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035733" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050103" name="NAD(P)-binding Rossmann-fold domains"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="202" end="446"/>
+                </locations>
+            </superfamilyhmmer3-match>
+        </matches>
+    </protein>
+    <protein>
+        <sequence md5="1776f92beb74ff0ccd9ac47a65663644">MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD</sequence>
+        <xref desc="6PGD_ECOLI 6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli (strain K12) GN=gnd PE=1 SV=2"
+              db="sp" id="P00350" name="6-phosphogluconate dehydrogenase, decarboxylating"/>
+        <matches>
+            <fingerprints-match evalue="1.521867E-89" graphscan="IIIIII">
+                <signature ac="PR00076" desc="6-phosphogluconate dehydrogenase signature" name="6PGDHDRGNASE">
+                    <entry ac="IPR006183" desc="6-phosphogluconate dehydrogenase" name="Pgluconate_DH" type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                    </entry>
+                    <models>
+                        <model ac="PR00076" desc="6-phosphogluconate dehydrogenase signature" name="6PGDHDRGNASE"/>
+                    </models>
+                    <signature-library-release library="PRINTS" version="42.0"/>
+                </signature>
+                <locations>
+                    <fingerprints-location motifNumber="5" pvalue="1.0E-16" score="76.55" start="249" end="276"/>
+                    <fingerprints-location motifNumber="4" pvalue="1.0E-16" score="87.33" start="168" end="196"/>
+                    <fingerprints-location motifNumber="2" pvalue="1.0E-16" score="72.68" start="66" end="95"/>
+                    <fingerprints-location motifNumber="3" pvalue="1.0E-16" score="85.03" start="119" end="144"/>
+                    <fingerprints-location motifNumber="1" pvalue="1.0E-16" score="74.37" start="4" end="27"/>
+                    <fingerprints-location motifNumber="6" pvalue="2.89E-15" score="76.18" start="356" end="378"/>
+                </locations>
+            </fingerprints-match>
+            <hmmer3-match evalue="9.3E-233" score="771.1">
+                <signature ac="TIGR00873" desc="gnd: 6-phosphogluconate dehydrogenase (decarboxylating)"
+                           name="TIGR00873">
+                    <entry ac="IPR006113" desc="6-phosphogluconate dehydrogenase, decarboxylating" name="6PGDH_Gnd/GntZ"
+                           type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006098" name="pentose-phosphate shunt"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0004616"
+                                 name="phosphogluconate dehydrogenase (decarboxylating) activity"/>
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                    </entry>
+                    <models>
+                        <model ac="TIGR00873" desc="gnd: 6-phosphogluconate dehydrogenase (decarboxylating)"
+                               name="TIGR00873"/>
+                    </models>
+                    <signature-library-release library="TIGRFAM" version="15.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="468" env-start="5" score="770.9" evalue="1.1E-232" hmm-start="1"
+                                     hmm-end="466" hmm-length="0" start="5" end="467"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.3E-61" score="206.8">
+                <signature ac="G3DSA:3.40.50.720">
+                    <entry ac="IPR016040" desc="NAD(P)-binding domain" name="NAD(P)-bd_dom" type="DOMAIN"/>
+                    <models>
+                        <model ac="1kolA02"/>
+                        <model ac="1kbzA01"/>
+                        <model ac="1evyA01"/>
+                        <model ac="1gtmA02"/>
+                        <model ac="1gdhA02"/>
+                        <model ac="2a4kB01"/>
+                        <model ac="1xdwA02"/>
+                        <model ac="2bh9A01"/>
+                        <model ac="1xq1A00"/>
+                        <model ac="1ooeA00"/>
+                        <model ac="1v0jA01"/>
+                        <model ac="2zydB01"/>
+                        <model ac="1mx3A01"/>
+                        <model ac="1cjcA01"/>
+                        <model ac="3grpD00"/>
+                        <model ac="1dihA01"/>
+                        <model ac="2ph5A01"/>
+                        <model ac="1f8fA02"/>
+                        <model ac="1xu9C00"/>
+                        <model ac="1jw9B00"/>
+                        <model ac="1u8xX01"/>
+                        <model ac="1edzA01"/>
+                        <model ac="1dxyA01"/>
+                        <model ac="1vl0B01"/>
+                        <model ac="1u1iA01"/>
+                        <model ac="1qp8A01"/>
+                        <model ac="2rafB01"/>
+                        <model ac="1yxmC00"/>
+                        <model ac="1j6uA01"/>
+                        <model ac="1wvgA01"/>
+                        <model ac="1oaaA00"/>
+                        <model ac="1jvbA02"/>
+                        <model ac="1pjcA02"/>
+                        <model ac="3imfC00"/>
+                        <model ac="3e8xA00"/>
+                        <model ac="1jtvA00"/>
+                        <model ac="3ff4A00"/>
+                        <model ac="1y8qB01"/>
+                        <model ac="2gasA01"/>
+                        <model ac="1lqtA01"/>
+                        <model ac="3nx4A02"/>
+                        <model ac="1y7tA01"/>
+                        <model ac="3d4oA02"/>
+                        <model ac="1qp8A02"/>
+                        <model ac="1dljA02"/>
+                        <model ac="2ztuB00"/>
+                        <model ac="2cvzA01"/>
+                        <model ac="1y8qC00"/>
+                        <model ac="2i76A01"/>
+                        <model ac="1ydwA01"/>
+                        <model ac="1eq2A01"/>
+                        <model ac="1li4A02"/>
+                        <model ac="3is3A00"/>
+                        <model ac="1wmaA00"/>
+                        <model ac="1x0vA01"/>
+                        <model ac="3gg9A02"/>
+                        <model ac="2dt5A02"/>
+                        <model ac="3fpcA02"/>
+                        <model ac="1c0pA01"/>
+                        <model ac="2nacA02"/>
+                        <model ac="2ag5C00"/>
+                        <model ac="2nacA01"/>
+                        <model ac="3iccA00"/>
+                        <model ac="1xgkA01"/>
+                        <model ac="3sx2H00"/>
+                        <model ac="2eklA01"/>
+                        <model ac="2g76A02"/>
+                        <model ac="1vi2A02"/>
+                        <model ac="2ekpA00"/>
+                        <model ac="1yqdA02"/>
+                        <model ac="1spxA00"/>
+                        <model ac="2g0tB01"/>
+                        <model ac="2rhcA00"/>
+                        <model ac="1h2bA02"/>
+                        <model ac="1vm6B01"/>
+                        <model ac="2ew2B01"/>
+                        <model ac="1sc6A01"/>
+                        <model ac="1hxhA00"/>
+                        <model ac="1xq6A00"/>
+                        <model ac="2oosB00"/>
+                        <model ac="1e6uA01"/>
+                        <model ac="1gz6B01"/>
+                        <model ac="1t2dA01"/>
+                        <model ac="1piwA02"/>
+                        <model ac="3hn7A01"/>
+                        <model ac="3dr3A01"/>
+                        <model ac="3ckyA01"/>
+                        <model ac="2axqA01"/>
+                        <model ac="1vj0A02"/>
+                        <model ac="3oigA00"/>
+                        <model ac="2rcyA01"/>
+                        <model ac="1f06A01"/>
+                        <model ac="3d1lB01"/>
+                        <model ac="1ebfA01"/>
+                        <model ac="3nepX01"/>
+                        <model ac="2ew8B00"/>
+                        <model ac="3fr7A01"/>
+                        <model ac="1lssA00"/>
+                        <model ac="3p19C00"/>
+                        <model ac="3c24A01"/>
+                        <model ac="2obnD01"/>
+                        <model ac="1hyeA01"/>
+                        <model ac="2hmtA00"/>
+                        <model ac="1omoA02"/>
+                        <model ac="1mv8A03"/>
+                        <model ac="2o3jA03"/>
+                        <model ac="1yl5A01"/>
+                        <model ac="6ldhA01"/>
+                        <model ac="3c85A00"/>
+                        <model ac="1vl6B02"/>
+                        <model ac="1ps9A02"/>
+                        <model ac="3lvfP01"/>
+                        <model ac="3d0oA01"/>
+                        <model ac="2bi7A01"/>
+                        <model ac="2w2kA02"/>
+                        <model ac="1a4iB01"/>
+                        <model ac="3f1lB00"/>
+                        <model ac="1i24A01"/>
+                        <model ac="2ho3A01"/>
+                        <model ac="2py6A02"/>
+                        <model ac="1f0yA01"/>
+                        <model ac="2d4aD01"/>
+                        <model ac="1oi7A01"/>
+                        <model ac="1t4bA01"/>
+                        <model ac="2d0iA02"/>
+                        <model ac="1h5qA00"/>
+                        <model ac="1x7dA02"/>
+                        <model ac="1bgvA01"/>
+                        <model ac="1lu9A02"/>
+                        <model ac="1ks9A01"/>
+                        <model ac="1cydA00"/>
+                        <model ac="2y1eA01"/>
+                        <model ac="2eklA02"/>
+                        <model ac="3mz0A01"/>
+                        <model ac="3c8mA01"/>
+                        <model ac="1lc0A01"/>
+                        <model ac="1i36A01"/>
+                        <model ac="2aefA01"/>
+                        <model ac="1gr0A01"/>
+                        <model ac="2dknB00"/>
+                        <model ac="1zk4A00"/>
+                        <model ac="3meqA02"/>
+                        <model ac="1o6zA02"/>
+                        <model ac="1uzmB00"/>
+                        <model ac="2eggA02"/>
+                        <model ac="1np3B01"/>
+                        <model ac="1geeA00"/>
+                        <model ac="3gg2B01"/>
+                        <model ac="3ai3A00"/>
+                        <model ac="1snyA00"/>
+                        <model ac="1dljA01"/>
+                        <model ac="1ek6A02"/>
+                        <model ac="2amfA01"/>
+                        <model ac="3cinA01"/>
+                        <model ac="2zb4A02"/>
+                        <model ac="3ceaA01"/>
+                        <model ac="1r6dA01"/>
+                        <model ac="1mv8A01"/>
+                        <model ac="1p3dA01"/>
+                        <model ac="1gpjA02"/>
+                        <model ac="1gu7A02"/>
+                        <model ac="3idsA01"/>
+                        <model ac="1txgA01"/>
+                        <model ac="1mx3A02"/>
+                        <model ac="1isiA02"/>
+                        <model ac="1yovC01"/>
+                        <model ac="1j4aD01"/>
+                        <model ac="3hhpA01"/>
+                        <model ac="1jayA00"/>
+                        <model ac="2x9gD00"/>
+                        <model ac="3gemD00"/>
+                        <model ac="3rufA01"/>
+                        <model ac="1dxyA02"/>
+                        <model ac="3kb6A02"/>
+                        <model ac="1lj8A01"/>
+                        <model ac="1q0qA01"/>
+                        <model ac="2d8aA02"/>
+                        <model ac="2pv7A01"/>
+                        <model ac="1y1pA01"/>
+                        <model ac="2z1nA00"/>
+                        <model ac="1v3uB02"/>
+                        <model ac="2dc1A01"/>
+                        <model ac="1fmcA00"/>
+                        <model ac="2jhfA02"/>
+                        <model ac="1xg5B00"/>
+                        <model ac="1xeaA01"/>
+                        <model ac="2gcgA02"/>
+                        <model ac="2bllA01"/>
+                        <model ac="1dpgA01"/>
+                        <model ac="3oidC00"/>
+                        <model ac="1h6dA01"/>
+                        <model ac="1o0sA04"/>
+                        <model ac="1pj3A02"/>
+                        <model ac="2yyyA01"/>
+                        <model ac="3d4oB01"/>
+                        <model ac="2o3jB01"/>
+                        <model ac="3bioB01"/>
+                        <model ac="1l7eA01"/>
+                        <model ac="1hdoA00"/>
+                        <model ac="3fwzA00"/>
+                        <model ac="1sbyA00"/>
+                        <model ac="2h7iA00"/>
+                        <model ac="1up7A01"/>
+                        <model ac="1iukA00"/>
+                        <model ac="1iz0A02"/>
+                        <model ac="1o94A02"/>
+                        <model ac="1r12A02"/>
+                        <model ac="1zmtA00"/>
+                        <model ac="1iy8A00"/>
+                        <model ac="1pl8A02"/>
+                        <model ac="1bdbA00"/>
+                        <model ac="1wlyA02"/>
+                        <model ac="2o23A00"/>
+                        <model ac="3d7lA00"/>
+                        <model ac="1gegA00"/>
+                        <model ac="1c1dA02"/>
+                        <model ac="3k5pA02"/>
+                        <model ac="3g3eA01"/>
+                        <model ac="1n7hA02"/>
+                        <model ac="1hyhA01"/>
+                        <model ac="2a35A00"/>
+                        <model ac="2qytA01"/>
+                        <model ac="2hjsA01"/>
+                        <model ac="2p2sA01"/>
+                        <model ac="1vpdA01"/>
+                        <model ac="2pk3A01"/>
+                        <model ac="1nytA02"/>
+                        <model ac="2g76A01"/>
+                        <model ac="2hrzA01"/>
+                        <model ac="1nvmB01"/>
+                        <model ac="2x5oA01"/>
+                        <model ac="1nhwA00"/>
+                        <model ac="1id1A00"/>
+                        <model ac="1bg6A01"/>
+                        <model ac="3c1aA01"/>
+                        <model ac="3a06B01"/>
+                        <model ac="1npyA02"/>
+                        <model ac="2zatA00"/>
+                        <model ac="3m6iA02"/>
+                        <model ac="1ydeN00"/>
+                        <model ac="2qq5A00"/>
+                        <model ac="3mw9A03"/>
+                        <model ac="1gdhA01"/>
+                        <model ac="1pjqA01"/>
+                        <model ac="1pqwA00"/>
+                        <model ac="1zemA00"/>
+                        <model ac="2d59A00"/>
+                        <model ac="1kyqB01"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="180" env-start="1" score="206.3" evalue="1.9E-61" hmm-start="13"
+                                     hmm-end="192" hmm-length="0" start="1" end="180"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="8.3E-53" score="178.4">
+                <signature ac="PF03446" desc="NAD binding domain of 6-phosphogluconate dehydrogenase"
+                           name="NAD_binding_2">
+                    <entry ac="IPR006115" desc="6-phosphogluconate dehydrogenase, NADP-binding" name="6PGDH_NADP-bd"
+                           type="DOMAIN">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0004616"
+                                 name="phosphogluconate dehydrogenase (decarboxylating) activity"/>
+                    </entry>
+                    <models>
+                        <model ac="PF03446" desc="NAD binding domain of 6-phosphogluconate dehydrogenase"
+                               name="NAD_binding_2"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="175" env-start="3" score="177.3" evalue="1.8E-52" hmm-start="1"
+                                     hmm-end="160" hmm-length="0" start="3" end="174"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.7E-243" score="806.0">
+                <signature ac="PIRSF000109" name="6PGD">
+                    <entry ac="IPR006113" desc="6-phosphogluconate dehydrogenase, decarboxylating" name="6PGDH_Gnd/GntZ"
+                           type="FAMILY">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006098" name="pentose-phosphate shunt"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0004616"
+                                 name="phosphogluconate dehydrogenase (decarboxylating) activity"/>
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                    </entry>
+                    <models>
+                        <model ac="PIRSF000109" name="6PGD"/>
+                    </models>
+                    <signature-library-release library="PIRSF" version="3.01"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="468" env-start="1" score="805.9" evalue="1.9E-243" hmm-start="1"
+                                     hmm-end="468" hmm-length="0" start="1" end="468"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="7.2E-120" score="398.5">
+                <signature ac="G3DSA:1.10.1040.10">
+                    <entry ac="IPR013328" desc="6-phosphogluconate dehydrogenase, domain 2" name="6PGD_dom_2"
+                           type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0016491" name="oxidoreductase activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="1ks9A02"/>
+                        <model ac="3ctvA00"/>
+                        <model ac="1txgA02"/>
+                        <model ac="1x0vA02"/>
+                        <model ac="1lj8A02"/>
+                        <model ac="1pgjA02"/>
+                        <model ac="1i36A02"/>
+                        <model ac="1vpdA02"/>
+                        <model ac="1evyA02"/>
+                        <model ac="1bg6A02"/>
+                        <model ac="2cvzA02"/>
+                        <model ac="2qytA02"/>
+                        <model ac="3fr7B02"/>
+                        <model ac="1f0yA02"/>
+                        <model ac="2zydA02"/>
+                        <model ac="2ew2A02"/>
+                        <model ac="1dljA03"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="434" env-start="181" score="398.0" evalue="1.0E-119" hmm-start="1"
+                                     hmm-end="253" hmm-length="0" start="181" end="433"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="8.5E-23" score="79.3">
+                <signature ac="G3DSA:1.20.5.320">
+                    <entry ac="IPR012284" desc="6-phosphogluconate dehydrogenase, domain 3" name="6PGD_dom_3"
+                           type="DOMAIN">
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                    </entry>
+                    <models>
+                        <model ac="1avyA00"/>
+                        <model ac="2pgdA03"/>
+                        <model ac="3fwnA03"/>
+                        <model ac="1avyB00"/>
+                        <model ac="1pgjA03"/>
+                        <model ac="1ox3A00"/>
+                        <model ac="1aa0A00"/>
+                    </models>
+                    <signature-library-release library="GENE3D" version="3.5.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="468" env-start="435" score="78.6" evalue="1.4E-22" hmm-start="2"
+                                     hmm-end="33" hmm-length="0" start="436" end="467"/>
+                </locations>
+            </hmmer3-match>
+            <hmmer3-match evalue="1.4E-132" score="441.0">
+                <signature ac="PF00393" desc="6-phosphogluconate dehydrogenase, C-terminal domain" name="6PGD">
+                    <entry ac="IPR006114" desc="6-phosphogluconate dehydrogenase, C-terminal" name="6PGDH_C"
+                           type="DOMAIN">
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0004616"
+                                 name="phosphogluconate dehydrogenase (decarboxylating) activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006098" name="pentose-phosphate shunt"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                    </entry>
+                    <models>
+                        <model ac="PF00393" desc="6-phosphogluconate dehydrogenase, C-terminal domain" name="6PGD"/>
+                    </models>
+                    <signature-library-release library="PFAM" version="28.0"/>
+                </signature>
+                <locations>
+                    <hmmer3-location env-end="466" env-start="179" score="440.5" evalue="2.0E-132" hmm-start="1"
+                                     hmm-end="282" hmm-length="0" start="179" end="466"/>
+                </locations>
+            </hmmer3-match>
+            <panther-match evalue="7.6E-305" familyName="6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING"
+                           score="1023.5">
+                <signature ac="PTHR11811:SF25" name="6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING">
+                    <models>
+                        <model ac="PTHR11811:SF25" name="6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="466"/>
+                </locations>
+            </panther-match>
+            <panther-match evalue="7.6E-305" familyName="6-PHOSPHOGLUCONATE DEHYDROGENASE" score="1023.5">
+                <signature ac="PTHR11811" name="6-PHOSPHOGLUCONATE DEHYDROGENASE">
+                    <models>
+                        <model ac="PTHR11811" name="6-PHOSPHOGLUCONATE DEHYDROGENASE"/>
+                    </models>
+                    <signature-library-release library="PANTHER" version="10.0"/>
+                </signature>
+                <locations>
+                    <panther-location start="1" end="466"/>
+                </locations>
+            </panther-match>
+            <patternscan-match>
+                <signature ac="PS00461" desc="6-phosphogluconate dehydrogenase signature." name="6PGD">
+                    <entry ac="IPR006184" desc="6-phosphogluconate-binding site" name="6PGdom_BS" type="BINDING_SITE">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0006098" name="pentose-phosphate shunt"/>
+                        <go-xref category="MOLECULAR_FUNCTION" db="GO" id="GO:0004616"
+                                 name="phosphogluconate dehydrogenase (decarboxylating) activity"/>
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                        <pathway-xref db="KEGG" id="00030+1.1.1.44" name="Pentose phosphate pathway"/>
+                        <pathway-xref db="UniPathway" id="UPA00115"
+                                      name="Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3"/>
+                        <pathway-xref db="KEGG" id="00480+1.1.1.44" name="Glutathione metabolism"/>
+                    </entry>
+                    <models>
+                        <model ac="PS00461" desc="6-phosphogluconate dehydrogenase signature." name="6PGD"/>
+                    </models>
+                    <signature-library-release library="PROSITE_PATTERNS" version="20.113"/>
+                </signature>
+                <locations>
+                    <patternscan-location level="STRONG" start="253" end="265">
+                        <alignment>IlDeaANKGTGkW</alignment>
+                    </patternscan-location>
+                </locations>
+            </patternscan-match>
+            <superfamilyhmmer3-match evalue="4.86E-50">
+                <signature ac="SSF51735" name="NAD(P)-binding Rossmann-fold domains">
+                    <entry ac="IPR016040" desc="NAD(P)-binding domain" name="NAD(P)-bd_dom" type="DOMAIN"/>
+                    <models>
+                        <model ac="0051440" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050247" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046635" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046114" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051702" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048614" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047481" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036194" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041129" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049117" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041868" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040043" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052722" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050365" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035405" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047059" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048454" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049845" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047066" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052744" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050383" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050212" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044853" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039871" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039650" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041692" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044526" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053266" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051213" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045153" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051147" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048533" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040868" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041828" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038050" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035018" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047993" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036744" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035945" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048286" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043337" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048949" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048673" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048469" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045076" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053660" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049902" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047550" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047294" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041770" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048035" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049864" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048414" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052415" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047742" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046123" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049942" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038545" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047681" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049007" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047909" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047963" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038853" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051511" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052284" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051763" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047178" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048755" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045319" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051575" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047040" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046725" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042131" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050721" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037437" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051006" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050204" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036664" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042342" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038057" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038567" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050040" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035477" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041366" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045718" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039935" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048270" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052085" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050237" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038711" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052382" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050203" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051093" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047276" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038342" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044808" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050938" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036579" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049966" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046367" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050241" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049943" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052837" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046059" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037128" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039600" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052803" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052329" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045621" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044044" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036007" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046253" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049730" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048186" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051279" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051542" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041596" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052565" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050022" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041757" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042505" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039780" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044840" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048102" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053216" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048361" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042906" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052183" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035543" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051109" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037662" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046592" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051965" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044559" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042429" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049824" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051996" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050655" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049026" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043042" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036806" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045645" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039438" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051991" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053287" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050090" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039314" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054518" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053172" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045243" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042866" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0034872" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051901" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045894" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052988" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035952" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052326" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051696" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052368" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051235" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038784" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038770" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036542" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043068" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042534" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038547" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040540" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053363" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036438" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050228" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047470" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038324" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048243" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046629" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043041" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051305" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049357" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050914" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046529" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052529" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035290" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036922" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053794" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054099" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046357" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035680" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049686" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0044691" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042207" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041999" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047124" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047510" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0039919" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040910" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038814" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035305" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048863" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051355" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051285" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038042" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0037278" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048808" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052116" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038761" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048799" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038087" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038559" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052978" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048409" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051568" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038068" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043507" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049198" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048757" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049766" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054552" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046574" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036746" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047979" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038232" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048293" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043703" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048227" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050235" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046291" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047054" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047965" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048455" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047263" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046034" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050443" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035535" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047655" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053356" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042340" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046483" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053019" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047346" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036892" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042180" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049519" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046801" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050269" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038379" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047278" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051797" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053195" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051491" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050776" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048416" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050967" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0054911" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047847" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038281" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051183" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046673" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051260" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040651" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051264" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035316" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050890" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052745" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0045444" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047992" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051925" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0036785" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0042366" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047955" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048107" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035471" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043276" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053286" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046472" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0046897" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051873" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0043678" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051327" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047516" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047443" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0053383" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049428" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050869" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048027" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048974" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0051203" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0048585" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047032" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0041610" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0040551" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0052818" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0038022" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0049820" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0047869" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0035733" name="NAD(P)-binding Rossmann-fold domains"/>
+                        <model ac="0050103" name="NAD(P)-binding Rossmann-fold domains"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="4" end="173"/>
+                </locations>
+            </superfamilyhmmer3-match>
+            <superfamilyhmmer3-match evalue="6.8E-132">
+                <signature ac="SSF48179" name="6-phosphogluconate dehydrogenase C-terminal domain-like">
+                    <entry ac="IPR008927" desc="6-phosphogluconate dehydrogenase C-terminal domain-like"
+                           name="6-PGluconate_DH_C-like" type="DOMAIN">
+                        <go-xref category="BIOLOGICAL_PROCESS" db="GO" id="GO:0055114"
+                                 name="oxidation-reduction process"/>
+                    </entry>
+                    <models>
+                        <model ac="0040234" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0036487" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0052836" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0035534" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0042865" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0048408" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0044957" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0049729" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0051872" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0054551" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0041099" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0052328" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0042306" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0048756" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0045524" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0054910" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0052564" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0040515" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0054098" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0053659" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0051796" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0050268" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0044958" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0037218" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0038855" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                        <model ac="0037318" name="6-phosphogluconate dehydrogenase C-terminal domain-like"/>
+                    </models>
+                    <signature-library-release library="SUPERFAMILY" version="1.75"/>
+                </signature>
+                <locations>
+                    <superfamilyhmmer3-location start="177" end="467"/>
+                </locations>
+            </superfamilyhmmer3-match>
+        </matches>
+    </protein>
+</protein-matches>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/data/input.fasta	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,32 @@
+>sp|C1P5Z7|SGRT_ECOLI Putative inhibitor of glucose uptake transporter SgrT OS=Escherichia coli (strain K12) GN=sgrT PE=1 SV=1
+MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES
+>sp|P00350|6PGD_ECOLI 6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli (strain K12) GN=gnd PE=1 SV=2
+MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
+VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
+NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
+YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
+KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
+KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
+RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
+FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
+>sp|P00363|FRDA_ECOLI Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) GN=frdA PE=1 SV=3
+MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
+DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
+KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
+LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
+GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
+KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
+GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
+GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
+AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
+TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGEADAADKAEAANKKEKA
+NG
+>sp|P00370|DHE4_ECOLI NADP-specific glutamate dehydrogenase OS=Escherichia coli (strain K12) GN=gdhA PE=1 SV=1
+MDQTYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERV
+IQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
+TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMA
+GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGS
+GNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEF
+GLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQ
+QAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEG
+EQTNYVQGANIAGFVKVADAMLAQGVI
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/fake_ips.py	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,35 @@
+"""
+"""
+
+__author__ = 'mkh'
+
+if __name__ == '__main__':
+    import argparse
+    import os
+    from shutil import copyfile
+    import sys
+
+    parser = argparse.ArgumentParser(description='Fake IPS.')
+
+    parser.add_argument('-dp', action='store_true')
+    parser.add_argument('--input')
+    parser.add_argument('--seqtype')
+    parser.add_argument('-f', dest='formats', default='tsv')
+    parser.add_argument('--applications')
+    parser.add_argument('--tempdir')
+    parser.add_argument('--pathways', action='store_true')
+    parser.add_argument('--goterms', action='store_true')
+    parser.add_argument('--iprlookup', action='store_true')
+    parser.add_argument('--mode')
+    parser.add_argument('--clusterrunid')
+    parser.add_argument('--output-file-base', dest='output_file_base')
+    parser.add_argument('-o', dest='output_file', default="/tmp/junk")
+
+    args = parser.parse_args()
+    formats = args.formats.split(',')
+    src_data_dir = os.path.dirname(__file__) + '/data'
+
+    for ext in formats:
+        if ext in ['html', 'svg']:
+            ext += '.tar.gz'
+        copyfile(src_data_dir + '/' + '__base__' + '.' + ext, args.output_file_base + '.' + ext)
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/interproscan.xml	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,285 @@
+<tool id="interproscan" name="Interproscan functional predictions of ORFs" version="5.0.0a">
+    <description>Interproscan functional predictions of ORFs</description>
+    <requirements>
+        <!--
+        <requirement type="package">signalp</requirement>
+        <requirement type="package">phobius</requirement>
+        <requirement type="package">tmhmm</requirement>
+        -->
+        <requirement type="set_environment">INTERPROSCAN_SCRIPT_PATH</requirement>
+    </requirements>
+
+    <command>
+        #import os
+        \$IPS_HOME/interproscan.sh
+            ## disables the precalculated lookup service, all calculation will be run locally
+            -dp 
+            --input $infile 
+            --seqtype $seqtype 
+            -f $oformat 
+            --applications $appl 
+            --tempdir \$TEMP
+
+            $pathways
+            $goterms
+            $iprlookup
+            $mode
+
+             #if str($oformat) in ['SVG', 'HTML']:
+                --output-file-base $outfile
+                2>&#38;1;
+                mkdir -p $outfile.files_path;
+                #set temp_archive_file = str($outfile) + '.' + str($oformat).lower() + '.tar.gz'
+                tar -C $outfile.files_path -xvmzf $temp_archive_file;
+                python \$INTERPROSCAN_SCRIPT_PATH/create_index.py $outfile $outfile.files_path;
+                rm $temp_archive_file
+            #else:
+                -o $outfile
+                2>&#38;1
+            #end if
+    </command>
+
+    <inputs>
+        <param name="infile" type="data" format="fasta" label="Protein Fasta File"/>
+
+        <param name="seqtype" type="select" label="Type of the input sequences" help="">
+            <option value="p" selected="true">Protein</option>
+            <option value="n">DNA / RNA</option>
+        </param>
+
+        <param name="mode" type="boolean" label="Run on cluster?" help="Check to submit job to cluster."
+               truevalue="--mode=cluster --clusterrunid=gtdi-ips-analysis"
+               falsevalue=""/>
+
+        <param name="appl" type="select" multiple="True" display="checkboxes" label="Applications to run"
+               help="Select your programm.">
+            <option value="TIGRFAM"
+                    selected="true">TIGRFAM: protein families based on Hidden Markov Models or HMMs</option>
+            <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a hierarchical order (evolutionary relationships)</option>
+            <option value="ProDom"
+                    selected="true">ProDom: set of protein domain families generated from the UniProtKB</option>
+            <option value="Panther"
+                    selected="true">Panther: Protein ANalysis THrough Evolutionary Relationships</option>
+            <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on Hidden Markov Models or HMMs</option>
+            <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional sites as well as associated profiles to identify them</option>
+            <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional sites as well as associated patterns to identify them</option>
+            <option value="HAMAP"
+                    selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes</option>
+            <option value="PfamA" selected="true">PfamA: protein families, each represented by multiple sequence alignments and hidden Markov models</option>
+            <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise a protein family</option>
+            <option value="SuperFamily"
+                    selected="true">SUPERFAMILY: database of structural and functional annotation</option>
+            <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>
+            <option value="Gene3d" selected="true">Gene3d: Structural assignment for whole genes and genomes using the CATH domain structure database</option>
+            <option value="SignalP-GRAM_POSITIVE" selected="false">SignalP Gram Positive Bacteria</option>
+            <option value="SignalP-GRAM_NEGATIVE" selected="false">SignalP Gram Negative Bacteria</option>
+            <option value="SignalP-EUK" selected="false">SignalP Eukaryotic Bacteria</option>
+            <option value="Phobius" selected="false">Phobius: combined transmembrane topology and signal peptide predictor</option>
+            <option value="TMHMM" selected="false">TMHMM: Prediction of transmembrane helices in proteins</option>
+        </param>
+
+        <param name="pathways" truevalue="--pathways" falsevalue="" checked="True" type="boolean"
+               label="Include pathway information"
+               help="Option that provides mappings from matches to pathway information, which is based on the matched manually curated InterPro entries. (--pathways)"/>
+        <param name="goterms" truevalue="--goterms" falsevalue="" checked="True" type="boolean"
+               label="Include Gene Ontology (GO) mappings"
+               help="Look up of corresponding Gene Ontology annotation. Implies -iprlookup option. (--goterms)"/>
+        <param name="iprlookup" truevalue="--iprlookup" falsevalue="" checked="False" type="boolean"
+               label="Provide additional mappings"
+               help="Provide mappings from matched member database signatures to the InterPro entries that they are integrated into (--iprlookup)"/>
+
+        <param name="oformat" type="select" label="Output format" help="Please select a output format.">
+            <option value="TSV" selected="true">Tab-separated values format (TSV)</option>
+            <option value="GFF3">GFF3</option>
+            <option value="SVG">SVG</option>
+            <option value="HTML">HTML</option>
+            <option value="XML">XML</option>
+        </param>
+
+    </inputs>
+
+    <outputs>
+        <data format="tabular" name="outfile" label="Interproscan calculation on ${on_string}">
+            <change_format>
+                <when input="oformat" value="HTML" format="html"/>
+                <when input="oformat" value="XML" format="xml"/>
+                <when input="oformat" value="SVG" format="html"/>
+                <when input="oformat" value="GFF3" format="gff"/>
+            </change_format>
+        </data>
+    </outputs>
+
+    <requirements>
+    </requirements>
+
+    <help>
+
+**What it does**
+
+Interproscan is a batch tool to query the Interpro database. It provides annotations based on multiple searches of profile and other functional databases. 
+
+
+#####
+Input
+#####
+
+Required is a FASTA file containing protein or nucleotide sequences.
+
+
+######
+Output
+######
+
+In this version of InterProScan_, you can retrieve output in any of the following five formats:
+
+ * TSV: a simple tab-delimited file format
+ * XML: the new "IMPACT" XML format (XSD available here_).
+ * GFF: The `GFF 3.0`_ format
+ * HTML: An HTML representation of the protein matches
+ * SVG: An Scalable Vector Graphics representation of the protein matches
+
+
+.. _`GFF 3.0`: http://gmod.org/wiki/GFF#GFF3_Format
+.. _here: http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5
+
+
+
+Tab-separated values format (TSV)
+=================================
+
+Basic tab delimited format.
+
+
+Example Output
+--------------
+
+::
+
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Pfam    PF09103 BRCA2, oligonucleotide/oligosaccharide-binding, domain 1        2670    2799    7.9E-43 T       15-03-2013
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    ProSiteProfiles PS50138 BRCA2 repeat profile.   1002    1036    0.0     T       18-03-2013      IPR002093       BRCA2 repeat    GO:0005515|GO:0006302
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Gene3D  G3DSA:2.40.50.140               2966    3051    3.1E-52 T       15-03-2013
+  ...
+
+
+The TSV format presents the match data in columns as follows:
+
+  - Protein Accession (e.g. P51587)
+  - Sequence MD5 digest (e.g. 14086411a2cdf1c4cba63020e1622579)
+  - Sequence Length (e.g. 3418)
+  - Analysis (e.g. Pfam / PRINTS / Gene3D)
+  - Signature Accession (e.g. PF09103 / G3DSA:2.40.50.140)
+  - Signature Description (e.g. BRCA2 repeat profile)
+  - Start location
+  - Stop location
+  - Score - is the e-value of the match reported by member database method (e.g. 3.1E-52)
+  - Status - is the status of the match (T: true)
+  - Date - is the date of the run
+  - (InterProScan_ annotations - accession (e.g. IPR002093) - optional column; only displayed if -iprscan option is switched on)
+  - (InterProScan_ annotations - description (e.g. BRCA2 repeat) - optional column; only displayed if -iprscan option is switched on)
+  - (GO annotations (e.g. GO:0005515) - optional column; only displayed if --goterms option is switched on)
+  - (Pathways annotations (e.g. REACT_71) - optional column; only displayed if --pathways option is switched on)
+
+
+Extensible Markup Language (XML)
+================================
+
+XML representation of the matches - this is the richest form of the data. The XML Schema Definition (XSD) is available [http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5 here].
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/example_xml_output.png
+
+
+
+Generic Feature Format Version 3 (GFF3)
+=======================================
+
+The GFF3 format is a flat tab-delimited file, which is much richer then the TSV output format. It allows you to trace back from matches to predicted proteins and to nucleic acid sequences. It also contains a FASTA format representation of the predicted protein sequences and their matches. You will find a documentation of all the columns and attributes used on [http://www.sequenceontology.org/gff3.shtml].
+
+Example Output
+--------------
+
+::
+
+  ##gff-version 3
+  ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
+  ##sequence-region AACH01000027 1 1347
+  ##seqid|source|type|start|end|score|strand|phase|attributes
+  AACH01000027    provided_by_user        nucleic_acid    1       1347    .       +       .       Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027
+  AACH01000027    getorf  ORF     1       1347    .       +       .       Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1 449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347
+  AACH01000027    getorf  polypeptide     1       449     .       +       .       md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347
+  AACH01000027    Pfam    protein_match   84      314     1.2E-45 +       .       Name=PF00696;signature_desc=Amino acid kinase family;Target=null 84 314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"
+  ##sequence-region 2
+  ...
+  >pep_AACH01000027_1_1347
+  LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV
+  LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA
+  GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI
+  LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ
+  ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA
+  TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV
+  DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML
+  RSQKAKGVLIYRDDWISITPEIQLLFTEF
+  ...
+  >match$8_84_314
+  KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK
+  RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL
+  LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR
+  AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS
+  
+
+Scalable Vector Graphics (SVG) and HyperText Markup Language (HTML)
+====================================================================
+
+InterProScan_ 5 outputs a single HTML/SVG file for each protein sequence analysed. 
+
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/P51587.svg.png
+
+.. _InterProScan: http://www.ebi.ac.uk/interpro
+
+
+----------
+References
+----------
+
+
+If you use this Galaxy tool in work leading to a scientific publication please
+cite the following papers:
+
+Peter J.A. Cock, Björn A. Grüning, Konrad Paszkiewicz and Leighton Pritchard (2013).
+Galaxy tools and workflows for sequence analysis with applications
+in molecular plant pathology. PeerJ 1:e167
+http://dx.doi.org/10.7717/peerj.167
+
+Zdobnov EM, Apweiler R (2001)
+InterProScan an integration platform for the signature-recognition methods in InterPro.
+Bioinformatics 17, 847-848.
+http://dx.doi.org/10.1093/bioinformatics/17.9.847
+
+Quevillon E, Silventoinen V, Pillai S, Harte N, Mulder N, Apweiler R, Lopez R (2005)
+InterProScan: protein domains identifier.
+Nucleic Acids Research 33 (Web Server issue), W116-W120.
+http://dx.doi.org/10.1093/nar/gki442
+
+Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, McAnulla C, McDowall J, Mistry J, Mitchell A, Mulder N, Natale D, Orengo C, Quinn AF, Selengut JD, Sigrist CJ, Thimma M, Thomas PD, Valentin F, Wilson D, Wu CH, Yeats C. (2009)
+InterPro: the integrative protein signature database.
+Nucleic Acids Research 37 (Database Issue), D224-228.
+http://dx.doi.org/10.1093/nar/gkn785
+
+
+This wrapper is available to install into other Galaxy Instances via the Galaxy Tool Shed at
+http://toolshed.g2.bx.psu.edu/view/bgruening/interproscan5
+
+
+**Galaxy Wrapper Author**::
+
+    *  Bjoern Gruening, University of Freiburg
+    *  Konrad Paszkiewicz, University of Exeter
+
+    </help>
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/ips5.xml	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,313 @@
+<tool id="ips5" name="Interproscan functional predictions of ORFs" version="5.0.0mkh">
+    <description>Interproscan functional predictions of ORFs.</description>
+    <requirements>
+        <!--
+        <requirement type="package">signalp</requirement>
+        <requirement type="package">phobius</requirement>
+        <requirement type="package">tmhmm</requirement>
+        -->
+        <requirement type="set_environment">INTERPROSCAN_SCRIPT_PATH</requirement>
+    </requirements>
+
+    <command>
+        #import os
+
+        \$IPS_HOME/interproscan.sh
+            ## disables the precalculated lookup service, all calculation will be run locally
+            -dp
+            --input $infile
+            --seqtype $seqtype
+            -f $output_types
+            --applications $appl
+            --tempdir \$TEMP
+
+            $pathways
+            $goterms
+            $iprlookup
+            $mode
+            --output-file-base __base__
+            2>&#38;1;
+
+        #if 'tsv' in str($output_types):
+            mv __base__.tsv $tsv_file;
+        #end if
+
+        #if 'gff3' in str($output_types):
+            mv __base__.gff3 $gff3_file;
+        #end if
+
+        #if 'xml' in str($output_types):
+            mv __base__.xml $xml_file;
+        #end if
+
+         #if 'html' in str($output_types):
+            mkdir -p $html_file.files_path;
+            #set temp_archive_file = '__base__.html.tar.gz'
+            tar -C $html_file.files_path -xvmzf $temp_archive_file;
+            python \$INTERPROSCAN_SCRIPT_PATH/interproscan5/create_index.py $html_file $html_file.files_path;
+            rm $temp_archive_file;
+        #end if
+
+         #if 'svg' in str($output_types):
+            mkdir -p $svg_file.files_path;
+            #set temp_archive_file = '__base__.svg.tar.gz'
+            tar -C $svg_file.files_path -xvmzf $temp_archive_file;
+            python \$INTERPROSCAN_SCRIPT_PATH/interproscan5/create_index.py $svg_file $svg_file.files_path;
+            rm $temp_archive_file;
+        #end if
+
+        echo "End of ipsfaux"
+    </command>
+
+    <inputs>
+        <param name="infile" type="data" format="fasta" label="Sequence Fasta File (ignored -- faux mode)"/>
+
+        <param name="seqtype" type="select" label="Type of the input sequences" help="">
+            <option value="p" selected="true">Protein</option>
+            <option value="n">DNA / RNA</option>
+        </param>
+
+        <param name="mode" type="boolean" label="Run on cluster?" help="Check to submit job to cluster."
+               truevalue="--mode=cluster --clusterrunid=gtdi-ips-analysis"
+               falsevalue=""/>
+
+        <param name="appl" type="select" multiple="True" display="checkboxes" label="Applications to run"
+               help="Select your programm.">
+            <option value="TIGRFAM"
+                    selected="true">TIGRFAM: protein families based on Hidden Markov Models or HMMs</option>
+            <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a hierarchical order (evolutionary relationships)</option>
+            <option value="ProDom"
+                    selected="true">ProDom: set of protein domain families generated from the UniProtKB</option>
+            <option value="Panther"
+                    selected="true">Panther: Protein ANalysis THrough Evolutionary Relationships</option>
+            <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on Hidden Markov Models or HMMs</option>
+            <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional sites as well as associated profiles to identify them</option>
+            <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional sites as well as associated patterns to identify them</option>
+            <option value="HAMAP"
+                    selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes</option>
+            <option value="PfamA" selected="true">PfamA: protein families, each represented by multiple sequence alignments and hidden Markov models</option>
+            <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise a protein family</option>
+            <option value="SuperFamily"
+                    selected="true">SUPERFAMILY: database of structural and functional annotation</option>
+            <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>
+            <option value="Gene3d" selected="true">Gene3d: Structural assignment for whole genes and genomes using the CATH domain structure database</option>
+            <option value="SignalP-GRAM_POSITIVE" selected="false">SignalP Gram Positive Bacteria</option>
+            <option value="SignalP-GRAM_NEGATIVE" selected="false">SignalP Gram Negative Bacteria</option>
+            <option value="SignalP-EUK" selected="false">SignalP Eukaryotic Bacteria</option>
+            <option value="Phobius" selected="false">Phobius: combined transmembrane topology and signal peptide predictor</option>
+            <option value="TMHMM" selected="false">TMHMM: Prediction of transmembrane helices in proteins</option>
+        </param>
+
+        <param name="pathways" truevalue="--pathways" falsevalue="" checked="True" type="boolean"
+               label="Include pathway information"
+               help="Option that provides mappings from matches to pathway information, which is based on the matched manually curated InterPro entries. (--pathways)"/>
+        <param name="goterms" truevalue="--goterms" falsevalue="" checked="True" type="boolean"
+               label="Include Gene Ontology (GO) mappings"
+               help="Look up of corresponding Gene Ontology annotation. Implies -iprlookup option. (--goterms)"/>
+
+        <param name="iprlookup" truevalue="--iprlookup" falsevalue="" checked="False" type="boolean"
+               label="Provide additional mappings"
+               help="Provide mappings from matched member database signatures to the InterPro entries that they are integrated into (--iprlookup)"/>
+
+        <param name="output_types" type="select" display="checkboxes" multiple="true" label="Output formats"
+               help="Select the output formats to generate (at least one)">
+            <option value="tsv" selected="true">Raw (TSV)</option>
+            <option value="html" selected="true">HTML (Graphical)</option>
+            <option value="svg" selected="false">SVG (Scalable Vector Graphics)</option>
+            <option value="gff3" selected="true">GFF3</option>
+            <option value="xml" selected="false">XML</option>
+        </param>
+    </inputs>
+
+    <outputs>
+        <data format="tabular" name="tsv_file" label="Interproscan TSV on ${on_string}">
+            <filter>'tsv' in output_types</filter>
+        </data>
+        <data format="html" name="html_file" label="Interproscan HTML on ${on_string}">
+            <filter>'html' in output_types</filter>
+        </data>
+        <data format="html" name="svg_file" label="Interproscan SVG on ${on_string}">
+            <filter>'svg' in output_types</filter>
+        </data>
+        <data format="gff3" name="gff3_file" label="Interproscan GFF3 on ${on_string}">
+            <filter>'gff3' in output_types</filter>
+        </data>
+        <data format="xml" name="xml_file" label="Interproscan XML on ${on_string}">
+            <filter>'xml' in output_types</filter>
+        </data>
+    </outputs>
+
+    <requirements>
+    </requirements>
+
+    <help>
+
+**What it does**
+
+Interproscan is a batch tool to query the Interpro database. It provides annotations based on multiple searches of profile and other functional databases.
+
+
+#####
+Input
+#####
+
+Required is a FASTA file containing protein or nucleotide sequences.
+
+
+######
+Output
+######
+
+In this version of InterProScan_, you can retrieve output in any of the following five formats:
+
+ * TSV: a simple tab-delimited file format
+ * XML: the new "IMPACT" XML format (XSD available here_).
+ * GFF: The `GFF 3.0`_ format
+ * HTML: An HTML representation of the protein matches
+ * SVG: An Scalable Vector Graphics representation of the protein matches
+
+
+.. _`GFF 3.0`: http://gmod.org/wiki/GFF#GFF3_Format
+.. _here: http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5
+
+
+
+Tab-separated values format (TSV)
+=================================
+
+Basic tab delimited format.
+
+
+Example Output
+--------------
+
+::
+
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Pfam    PF09103 BRCA2, oligonucleotide/oligosaccharide-binding, domain 1        2670    2799    7.9E-43 T       15-03-2013
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    ProSiteProfiles PS50138 BRCA2 repeat profile.   1002    1036    0.0     T       18-03-2013      IPR002093       BRCA2 repeat    GO:0005515|GO:0006302
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Gene3D  G3DSA:2.40.50.140               2966    3051    3.1E-52 T       15-03-2013
+  ...
+
+
+The TSV format presents the match data in columns as follows:
+
+  - Protein Accession (e.g. P51587)
+  - Sequence MD5 digest (e.g. 14086411a2cdf1c4cba63020e1622579)
+  - Sequence Length (e.g. 3418)
+  - Analysis (e.g. Pfam / PRINTS / Gene3D)
+  - Signature Accession (e.g. PF09103 / G3DSA:2.40.50.140)
+  - Signature Description (e.g. BRCA2 repeat profile)
+  - Start location
+  - Stop location
+  - Score - is the e-value of the match reported by member database method (e.g. 3.1E-52)
+  - Status - is the status of the match (T: true)
+  - Date - is the date of the run
+  - (InterProScan_ annotations - accession (e.g. IPR002093) - optional column; only displayed if -iprscan option is switched on)
+  - (InterProScan_ annotations - description (e.g. BRCA2 repeat) - optional column; only displayed if -iprscan option is switched on)
+  - (GO annotations (e.g. GO:0005515) - optional column; only displayed if --goterms option is switched on)
+  - (Pathways annotations (e.g. REACT_71) - optional column; only displayed if --pathways option is switched on)
+
+
+Extensible Markup Language (XML)
+================================
+
+XML representation of the matches - this is the richest form of the data. The XML Schema Definition (XSD) is available [http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5 here].
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/example_xml_output.png
+
+
+
+Generic Feature Format Version 3 (GFF3)
+=======================================
+
+The GFF3 format is a flat tab-delimited file, which is much richer then the TSV output format. It allows you to trace back from matches to predicted proteins and to nucleic acid sequences. It also contains a FASTA format representation of the predicted protein sequences and their matches. You will find a documentation of all the columns and attributes used on [http://www.sequenceontology.org/gff3.shtml].
+
+Example Output
+--------------
+
+::
+
+  ##gff-version 3
+  ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
+  ##sequence-region AACH01000027 1 1347
+  ##seqid|source|type|start|end|score|strand|phase|attributes
+  AACH01000027    provided_by_user        nucleic_acid    1       1347    .       +       .       Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027
+  AACH01000027    getorf  ORF     1       1347    .       +       .       Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1 449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347
+  AACH01000027    getorf  polypeptide     1       449     .       +       .       md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347
+  AACH01000027    Pfam    protein_match   84      314     1.2E-45 +       .       Name=PF00696;signature_desc=Amino acid kinase family;Target=null 84 314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"
+  ##sequence-region 2
+  ...
+  >pep_AACH01000027_1_1347
+  LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV
+  LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA
+  GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI
+  LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ
+  ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA
+  TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV
+  DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML
+  RSQKAKGVLIYRDDWISITPEIQLLFTEF
+  ...
+  >match$8_84_314
+  KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK
+  RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL
+  LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR
+  AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS
+
+
+Scalable Vector Graphics (SVG) and HyperText Markup Language (HTML)
+====================================================================
+
+InterProScan_ 5 outputs a single HTML/SVG file for each protein sequence analysed.
+
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/P51587.svg.png
+
+.. _InterProScan: http://www.ebi.ac.uk/interpro
+
+
+----------
+References
+----------
+
+
+If you use this Galaxy tool in work leading to a scientific publication please
+cite the following papers:
+
+Peter J.A. Cock, Björn A. Grüning, Konrad Paszkiewicz and Leighton Pritchard (2013).
+Galaxy tools and workflows for sequence analysis with applications
+in molecular plant pathology. PeerJ 1:e167
+http://dx.doi.org/10.7717/peerj.167
+
+Zdobnov EM, Apweiler R (2001)
+InterProScan an integration platform for the signature-recognition methods in InterPro.
+Bioinformatics 17, 847-848.
+http://dx.doi.org/10.1093/bioinformatics/17.9.847
+
+Quevillon E, Silventoinen V, Pillai S, Harte N, Mulder N, Apweiler R, Lopez R (2005)
+InterProScan: protein domains identifier.
+Nucleic Acids Research 33 (Web Server issue), W116-W120.
+http://dx.doi.org/10.1093/nar/gki442
+
+Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, McAnulla C, McDowall J, Mistry J, Mitchell A, Mulder N, Natale D, Orengo C, Quinn AF, Selengut JD, Sigrist CJ, Thimma M, Thomas PD, Valentin F, Wilson D, Wu CH, Yeats C. (2009)
+InterPro: the integrative protein signature database.
+Nucleic Acids Research 37 (Database Issue), D224-228.
+http://dx.doi.org/10.1093/nar/gkn785
+
+
+This wrapper is available to install into other Galaxy Instances via the Galaxy Tool Shed at
+http://toolshed.g2.bx.psu.edu/view/bgruening/interproscan5
+
+
+**Galaxy Wrapper Author**::
+
+    *  Bjoern Gruening, University of Freiburg
+    *  Konrad Paszkiewicz, University of Exeter
+
+    </help>
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/ipsfaux.xml	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,315 @@
+<tool id="ipsfaux" name="Interproscan functional predictions of ORFs (faux)" version="1.0.0a">
+    <description>Interproscan functional predictions of ORFs (faux). Input file and computation options are
+    ignored (other than the types of outputs). The same precomputed results are produced every time.</description>
+    <requirements>
+        <!--
+        <requirement type="package">signalp</requirement>
+        <requirement type="package">phobius</requirement>
+        <requirement type="package">tmhmm</requirement>
+        -->
+        <requirement type="set_environment">INTERPROSCAN_SCRIPT_PATH</requirement>
+    </requirements>
+
+    <command>
+        #import os
+        echo "output_types=$output_types";
+
+        python \$INTERPROSCAN_SCRIPT_PATH/interproscan5/fake_ips.py
+            ## disables the precalculated lookup service, all calculation will be run locally
+            -dp
+            --input $infile
+            --seqtype $seqtype
+            -f $output_types
+            --applications $appl
+            --tempdir \$TEMP
+
+            $pathways
+            $goterms
+            $iprlookup
+            $mode
+            --output-file-base __base__
+            2>&#38;1;
+
+        #if 'tsv' in str($output_types):
+            mv __base__.tsv $tsv_file;
+        #end if
+
+        #if 'gff3' in str($output_types):
+            mv __base__.gff3 $gff3_file;
+        #end if
+
+        #if 'xml' in str($output_types):
+            mv __base__.xml $xml_file;
+        #end if
+
+         #if 'html' in str($output_types):
+            mkdir -p $html_file.files_path;
+            #set temp_archive_file = '__base__.html.tar.gz'
+            tar -C $html_file.files_path -xvmzf $temp_archive_file;
+            python \$INTERPROSCAN_SCRIPT_PATH/interproscan5/create_index.py $html_file $html_file.files_path;
+            rm $temp_archive_file;
+        #end if
+
+         #if 'svg' in str($output_types):
+            mkdir -p $svg_file.files_path;
+            #set temp_archive_file = '__base__.svg.tar.gz'
+            tar -C $svg_file.files_path -xvmzf $temp_archive_file;
+            python \$INTERPROSCAN_SCRIPT_PATH/interproscan5/create_index.py $svg_file $svg_file.files_path;
+            rm $temp_archive_file;
+        #end if
+
+        echo "End of ipsfaux"
+    </command>
+
+    <inputs>
+        <param name="infile" type="data" format="fasta" label="Sequence Fasta File (ignored -- faux mode)"/>
+
+        <param name="seqtype" type="select" label="Type of the input sequences" help="">
+            <option value="p" selected="true">Protein</option>
+            <option value="n">DNA / RNA</option>
+        </param>
+
+        <param name="mode" type="boolean" label="Run on cluster?" help="Check to submit job to cluster."
+               truevalue="--mode=cluster --clusterrunid=gtdi-ips-analysis"
+               falsevalue=""/>
+
+        <param name="appl" type="select" multiple="True" display="checkboxes" label="Applications to run"
+               help="Select your programm.">
+            <option value="TIGRFAM"
+                    selected="true">TIGRFAM: protein families based on Hidden Markov Models or HMMs</option>
+            <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a hierarchical order (evolutionary relationships)</option>
+            <option value="ProDom"
+                    selected="true">ProDom: set of protein domain families generated from the UniProtKB</option>
+            <option value="Panther"
+                    selected="true">Panther: Protein ANalysis THrough Evolutionary Relationships</option>
+            <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on Hidden Markov Models or HMMs</option>
+            <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional sites as well as associated profiles to identify them</option>
+            <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional sites as well as associated patterns to identify them</option>
+            <option value="HAMAP"
+                    selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes</option>
+            <option value="PfamA" selected="true">PfamA: protein families, each represented by multiple sequence alignments and hidden Markov models</option>
+            <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise a protein family</option>
+            <option value="SuperFamily"
+                    selected="true">SUPERFAMILY: database of structural and functional annotation</option>
+            <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>
+            <option value="Gene3d" selected="true">Gene3d: Structural assignment for whole genes and genomes using the CATH domain structure database</option>
+            <option value="SignalP-GRAM_POSITIVE" selected="false">SignalP Gram Positive Bacteria</option>
+            <option value="SignalP-GRAM_NEGATIVE" selected="false">SignalP Gram Negative Bacteria</option>
+            <option value="SignalP-EUK" selected="false">SignalP Eukaryotic Bacteria</option>
+            <option value="Phobius" selected="false">Phobius: combined transmembrane topology and signal peptide predictor</option>
+            <option value="TMHMM" selected="false">TMHMM: Prediction of transmembrane helices in proteins</option>
+        </param>
+
+        <param name="pathways" truevalue="--pathways" falsevalue="" checked="True" type="boolean"
+               label="Include pathway information"
+               help="Option that provides mappings from matches to pathway information, which is based on the matched manually curated InterPro entries. (--pathways)"/>
+        <param name="goterms" truevalue="--goterms" falsevalue="" checked="True" type="boolean"
+               label="Include Gene Ontology (GO) mappings"
+               help="Look up of corresponding Gene Ontology annotation. Implies -iprlookup option. (--goterms)"/>
+
+        <param name="iprlookup" truevalue="--iprlookup" falsevalue="" checked="False" type="boolean"
+               label="Provide additional mappings"
+               help="Provide mappings from matched member database signatures to the InterPro entries that they are integrated into (--iprlookup)"/>
+
+        <param name="output_types" type="select" display="checkboxes" multiple="true" label="Output formats"
+               help="Select the output formats to generate (at least one)">
+            <option value="tsv" selected="true">Raw (TSV)</option>
+            <option value="html" selected="true">HTML (Graphical)</option>
+            <option value="svg" selected="false">SVG (Scalable Vector Graphics)</option>
+            <option value="gff3" selected="true">GFF3</option>
+            <option value="xml" selected="false">XML</option>
+        </param>
+    </inputs>
+
+    <outputs>
+        <data format="tabular" name="tsv_file" label="Interproscan TSV on ${on_string}">
+            <filter>'tsv' in output_types</filter>
+        </data>
+        <data format="html" name="html_file" label="Interproscan HTML on ${on_string}">
+            <filter>'html' in output_types</filter>
+        </data>
+        <data format="html" name="svg_file" label="Interproscan SVG on ${on_string}">
+            <filter>'svg' in output_types</filter>
+        </data>
+        <data format="gff3" name="gff3_file" label="Interproscan GFF3 on ${on_string}">
+            <filter>'gff3' in output_types</filter>
+        </data>
+        <data format="xml" name="xml_file" label="Interproscan XML on ${on_string}">
+            <filter>'xml' in output_types</filter>
+        </data>
+    </outputs>
+
+    <requirements>
+    </requirements>
+
+    <help>
+
+**What it does**
+
+Interproscan is a batch tool to query the Interpro database. It provides annotations based on multiple searches of profile and other functional databases.
+
+
+#####
+Input
+#####
+
+Required is a FASTA file containing protein or nucleotide sequences.
+
+
+######
+Output
+######
+
+In this version of InterProScan_, you can retrieve output in any of the following five formats:
+
+ * TSV: a simple tab-delimited file format
+ * XML: the new "IMPACT" XML format (XSD available here_).
+ * GFF: The `GFF 3.0`_ format
+ * HTML: An HTML representation of the protein matches
+ * SVG: An Scalable Vector Graphics representation of the protein matches
+
+
+.. _`GFF 3.0`: http://gmod.org/wiki/GFF#GFF3_Format
+.. _here: http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5
+
+
+
+Tab-separated values format (TSV)
+=================================
+
+Basic tab delimited format.
+
+
+Example Output
+--------------
+
+::
+
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Pfam    PF09103 BRCA2, oligonucleotide/oligosaccharide-binding, domain 1        2670    2799    7.9E-43 T       15-03-2013
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    ProSiteProfiles PS50138 BRCA2 repeat profile.   1002    1036    0.0     T       18-03-2013      IPR002093       BRCA2 repeat    GO:0005515|GO:0006302
+  P51587  14086411a2cdf1c4cba63020e1622579        3418    Gene3D  G3DSA:2.40.50.140               2966    3051    3.1E-52 T       15-03-2013
+  ...
+
+
+The TSV format presents the match data in columns as follows:
+
+  - Protein Accession (e.g. P51587)
+  - Sequence MD5 digest (e.g. 14086411a2cdf1c4cba63020e1622579)
+  - Sequence Length (e.g. 3418)
+  - Analysis (e.g. Pfam / PRINTS / Gene3D)
+  - Signature Accession (e.g. PF09103 / G3DSA:2.40.50.140)
+  - Signature Description (e.g. BRCA2 repeat profile)
+  - Start location
+  - Stop location
+  - Score - is the e-value of the match reported by member database method (e.g. 3.1E-52)
+  - Status - is the status of the match (T: true)
+  - Date - is the date of the run
+  - (InterProScan_ annotations - accession (e.g. IPR002093) - optional column; only displayed if -iprscan option is switched on)
+  - (InterProScan_ annotations - description (e.g. BRCA2 repeat) - optional column; only displayed if -iprscan option is switched on)
+  - (GO annotations (e.g. GO:0005515) - optional column; only displayed if --goterms option is switched on)
+  - (Pathways annotations (e.g. REACT_71) - optional column; only displayed if --pathways option is switched on)
+
+
+Extensible Markup Language (XML)
+================================
+
+XML representation of the matches - this is the richest form of the data. The XML Schema Definition (XSD) is available [http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5 here].
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/example_xml_output.png
+
+
+
+Generic Feature Format Version 3 (GFF3)
+=======================================
+
+The GFF3 format is a flat tab-delimited file, which is much richer then the TSV output format. It allows you to trace back from matches to predicted proteins and to nucleic acid sequences. It also contains a FASTA format representation of the predicted protein sequences and their matches. You will find a documentation of all the columns and attributes used on [http://www.sequenceontology.org/gff3.shtml].
+
+Example Output
+--------------
+
+::
+
+  ##gff-version 3
+  ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
+  ##sequence-region AACH01000027 1 1347
+  ##seqid|source|type|start|end|score|strand|phase|attributes
+  AACH01000027    provided_by_user        nucleic_acid    1       1347    .       +       .       Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027
+  AACH01000027    getorf  ORF     1       1347    .       +       .       Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1 449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347
+  AACH01000027    getorf  polypeptide     1       449     .       +       .       md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347
+  AACH01000027    Pfam    protein_match   84      314     1.2E-45 +       .       Name=PF00696;signature_desc=Amino acid kinase family;Target=null 84 314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"
+  ##sequence-region 2
+  ...
+  >pep_AACH01000027_1_1347
+  LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV
+  LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA
+  GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI
+  LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ
+  ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA
+  TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV
+  DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML
+  RSQKAKGVLIYRDDWISITPEIQLLFTEF
+  ...
+  >match$8_84_314
+  KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK
+  RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL
+  LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR
+  AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS
+
+
+Scalable Vector Graphics (SVG) and HyperText Markup Language (HTML)
+====================================================================
+
+InterProScan_ 5 outputs a single HTML/SVG file for each protein sequence analysed.
+
+
+Example Output
+--------------
+
+.. image:: $PATH_TO_IMAGES/P51587.svg.png
+
+.. _InterProScan: http://www.ebi.ac.uk/interpro
+
+
+----------
+References
+----------
+
+
+If you use this Galaxy tool in work leading to a scientific publication please
+cite the following papers:
+
+Peter J.A. Cock, Björn A. Grüning, Konrad Paszkiewicz and Leighton Pritchard (2013).
+Galaxy tools and workflows for sequence analysis with applications
+in molecular plant pathology. PeerJ 1:e167
+http://dx.doi.org/10.7717/peerj.167
+
+Zdobnov EM, Apweiler R (2001)
+InterProScan an integration platform for the signature-recognition methods in InterPro.
+Bioinformatics 17, 847-848.
+http://dx.doi.org/10.1093/bioinformatics/17.9.847
+
+Quevillon E, Silventoinen V, Pillai S, Harte N, Mulder N, Apweiler R, Lopez R (2005)
+InterProScan: protein domains identifier.
+Nucleic Acids Research 33 (Web Server issue), W116-W120.
+http://dx.doi.org/10.1093/nar/gki442
+
+Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, McAnulla C, McDowall J, Mistry J, Mitchell A, Mulder N, Natale D, Orengo C, Quinn AF, Selengut JD, Sigrist CJ, Thimma M, Thomas PD, Valentin F, Wilson D, Wu CH, Yeats C. (2009)
+InterPro: the integrative protein signature database.
+Nucleic Acids Research 37 (Database Issue), D224-228.
+http://dx.doi.org/10.1093/nar/gkn785
+
+
+This wrapper is available to install into other Galaxy Instances via the Galaxy Tool Shed at
+http://toolshed.g2.bx.psu.edu/view/bgruening/interproscan5
+
+
+**Galaxy Wrapper Author**::
+
+    *  Bjoern Gruening, University of Freiburg
+    *  Konrad Paszkiewicz, University of Exeter
+
+    </help>
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/readme.rst	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,83 @@
+==================================================
+Galaxy wrapper for InterProScan 5 prediction tools
+==================================================
+
+InterProScan is a tool that combines different protein signature recognition methods native to the InterPro 
+member databases into one resource with look up of corresponding InterPro and GO annotation.
+
+This wrapper is copyright 2013 by:
+ * Bjoern Gruening
+ * Konrad Paszkiewicz
+
+
+This prepository contains a wrapper for the InterProScan_ command line tool.
+
+.. _InterProScan: http://www.ebi.ac.uk/interpro/interproscan.html
+
+
+Quevillon E., Silventoinen V., Pillai S., Harte N., Mulder N., Apweiler R., Lopez R. (2005). InterProScan: protein domains identifier. Nucleic Acids Res. 33 (Web Server issue): W116-W120
+
+
+============
+Installation
+============
+
+Please download install InterProScan according to:
+
+https://code.google.com/p/interproscan/wiki/HowToDownload
+
+
+========
+Citation
+========
+
+If you use this Galaxy tool in work leading to a scientific
+publication, in addition to citing the invididual underlying tools, please cite:
+
+Peter Cock, Bjoern Gruening, Konrad Paszkiewicz and Leighton Pritchard (2013).
+Galaxy tools and workflows for sequence analysis with applications
+in molecular plant pathology. PeerJ 1:e167
+http://dx.doi.org/10.7717/peerj.167
+
+Full reference information is included in the help text.
+
+
+=============
+Input formats
+=============
+
+The standard interproscan input is either genomic or protein sequences. 
+In the case of genomic sequences Interproscan will run an ORF prediction tool.
+
+
+=======
+History
+=======
+
+interproscan:
+
+ - v5.0: Initial public release of version 5.0
+
+
+=============
+Licence (MIT)
+=============
+
+Permission is hereby granted, free of charge, to any person obtaining a copy
+of this software and associated documentation files (the "Software"), to deal
+in the Software without restriction, including without limitation the rights
+to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
+copies of the Software, and to permit persons to whom the Software is
+furnished to do so, subject to the following conditions:
+
+The above copyright notice and this permission notice shall be included in
+all copies or substantial portions of the Software.
+
+THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
+IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
+FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
+AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
+LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
+OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN
+THE SOFTWARE.
+
Binary file interproscan5/static/images/P51587.svg.png has changed
Binary file interproscan5/static/images/example_xml_output.png has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/tool_dependencies.xml	Thu Jan 28 19:34:51 2016 -0500
@@ -0,0 +1,7 @@
+<?xml version="1.0"?>
+<tool_dependency>
+    <set_environment version="1.0">
+        <environment_variable name="INTERPROSCAN_SCRIPT_PATH"
+                              action="set_to">$REPOSITORY_INSTALL_DIR</environment_variable>
+    </set_environment>
+</tool_dependency>