diff interproscan5/interproscan.xml @ 0:f41c8f299270 draft default tip

Untested version
author mkh
date Sat, 16 Jan 2016 12:30:10 -0500
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/interproscan5/interproscan.xml	Sat Jan 16 12:30:10 2016 -0500
@@ -0,0 +1,307 @@
+<tool id="interproscan" name="Interproscan functional predictions of ORFs" version="5.0.1">
+    <description>Interproscan functional predictions of ORFs</description>
+    <requirements>
+        <requirement type="package">signalp</requirement>
+        <requirement type="package">phobius</requirement>
+        <requirement type="package">tmhmm</requirement>
+        <requirement type="set_environment">INTERPROSCAN_SCRIPT_PATH</requirement>
+    </requirements>
+
+    <command>
+        #import os
+        interproscan.sh
+        ## disables the precalculated lookup service, all calculation will be run locally
+        -dp
+        --input $infile
+        --seqtype $seqtype
+        -f $oformat
+        --applications $appl
+        --tempdir \$TEMP
+
+        $pathways
+        $goterms
+        $iprlookup
+
+        #if str($oformat) in ['SVG', 'HTML']:
+        --output-file-base $outfile
+        2>&#38;1;
+        mkdir -p $outfile.files_path;
+        #set temp_archive_file = str($outfile) + '.' + str($oformat).lower() + '.tar.gz'
+        tar -C $outfile.files_path -xvmzf $temp_archive_file;
+        python \$INTERPROSCAN_SCRIPT_PATH/create_index.py $outfile $outfile.files_path;
+        rm $temp_archive_file
+        #else:
+        -o $outfile
+        2>&#38;1
+        #end if
+    </command>
+
+    <inputs>
+        <param name="infile" type="data" format="fasta" label="Protein Fasta File"/>
+
+        <param name="seqtype" type="select" label="Type of the input sequences" help="">
+            <option value="p" selected="true">Protein</option>
+            <option value="n">DNA / RNA</option>
+        </param>
+
+        <param name="appl" type="select" multiple="True" display="checkboxes" label="Applications to run"
+               help="Select your programm.">
+            <option value="TIGRFAM" selected="true">TIGRFAM: protein families based on Hidden Markov Models or HMMs
+            </option>
+            <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a
+                hierarchical order (evolutionary relationships)
+            </option>
+            <option value="ProDom" selected="true">ProDom: set of protein domain families generated from the UniProtKB
+            </option>
+            <option value="Panther" selected="true">Panther: Protein ANalysis THrough Evolutionary Relationships
+            </option>
+            <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on
+                Hidden Markov Models or HMMs
+            </option>
+            <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional
+                sites as well as associated profiles to identify them
+            </option>
+            <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional
+                sites as well as associated patterns to identify them
+            </option>
+            <option value="HAMAP" selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes
+            </option>
+            <option value="PfamA" selected="true">PfamA: protein families, each represented by multiple sequence
+                alignments and hidden Markov models
+            </option>
+            <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise
+                a protein family
+            </option>
+            <option value="SuperFamily" selected="true">SUPERFAMILY: database of structural and functional annotation
+            </option>
+            <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>
+            <option value="Gene3d" selected="true">Gene3d: Structural assignment for whole genes and genomes using the
+                CATH domain structure database
+            </option>
+            <option value="SignalP-GRAM_POSITIVE" selected="false">SignalP Gram Positive Bacteria</option>
+            <option value="SignalP-GRAM_NEGATIVE" selected="false">SignalP Gram Negative Bacteria</option>
+            <option value="SignalP-EUK" selected="true">SignalP Eukaryotic Bacteria</option>
+            <option value="Phobius" selected="true">Phobius: combined transmembrane topology and signal peptide
+                predictor
+            </option>
+            <option value="TMHMM" selected="true">TMHMM: Prediction of transmembrane helices in proteins</option>
+        </param>
+
+        <param name="pathways" truevalue="--pathways" falsevalue="" checked="True" type="boolean"
+               label="Include pathway information"
+               help="Option that provides mappings from matches to pathway information, which is based on the matched manually curated InterPro entries. (--pathways)"/>
+        <param name="goterms" truevalue="--goterms" falsevalue="" checked="True" type="boolean"
+               label="Include Gene Ontology (GO) mappings"
+               help="Look up of corresponding Gene Ontology annotation. Implies -iprlookup option. (--goterms)"/>
+        <param name="iprlookup" truevalue="--iprlookup" falsevalue="" checked="False" type="boolean"
+               label="Provide additional mappings"
+               help="Provide mappings from matched member database signatures to the InterPro entries that they are integrated into (--iprlookup)"/>
+
+        <param name="oformat" type="select" label="Output format" help="Please select a output format.">
+            <option value="TSV" selected="true">Tab-separated values format (TSV)</option>
+            <option value="GFF3">GFF3</option>
+            <option value="SVG">SVG</option>
+            <option value="HTML">HTML</option>
+            <option value="XML">XML</option>
+        </param>
+    </inputs>
+
+    <outputs>
+        <data format="tabular" name="outfile" label="Interproscan calculation on ${on_string}">
+            <change_format>
+                <when input="oformat" value="HTML" format="html"/>
+                <when input="oformat" value="XML" format="xml"/>
+                <when input="oformat" value="SVG" format="html"/>
+                <when input="oformat" value="GFF3" format="gff"/>
+            </change_format>
+        </data>
+
+    </outputs>
+
+    <requirements>
+    </requirements>
+
+    <help>
+        **What it does and does not do**
+
+        Interproscan is a batch tool to query the Interpro database. It provides annotations based on multiple searches
+        of profile and other functional databases.
+
+
+        #####
+        Input
+        #####
+
+        Required is a FASTA file containing protein or nucleotide sequences.
+
+
+        ######
+        Output
+        ######
+
+        In this version of InterProScan_, you can retrieve output in any of the following five formats:
+
+        * TSV: a simple tab-delimited file format
+        * XML: the new "IMPACT" XML format (XSD available here_).
+        * GFF: The `GFF 3.0`_ format
+        * HTML: An HTML representation of the protein matches
+        * SVG: An Scalable Vector Graphics representation of the protein matches
+
+
+        .. _`GFF 3.0`: http://gmod.org/wiki/GFF#GFF3_Format
+        .. _here: http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5
+
+
+        Tab-separated values format (TSV)
+        =================================
+
+        Basic tab delimited format.
+
+
+        Example Output
+        --------------
+
+        ::
+
+        P51587 14086411a2cdf1c4cba63020e1622579 3418 Pfam PF09103 BRCA2, oligonucleotide/oligosaccharide-binding, domain
+        1 2670 2799 7.9E-43 T 15-03-2013
+        P51587 14086411a2cdf1c4cba63020e1622579 3418 ProSiteProfiles PS50138 BRCA2 repeat profile. 1002 1036 0.0 T
+        18-03-2013 IPR002093 BRCA2 repeat GO:0005515|GO:0006302
+        P51587 14086411a2cdf1c4cba63020e1622579 3418 Gene3D G3DSA:2.40.50.140 2966 3051 3.1E-52 T 15-03-2013
+        ...
+
+
+        The TSV format presents the match data in columns as follows:
+
+        - Protein Accession (e.g. P51587)
+        - Sequence MD5 digest (e.g. 14086411a2cdf1c4cba63020e1622579)
+        - Sequence Length (e.g. 3418)
+        - Analysis (e.g. Pfam / PRINTS / Gene3D)
+        - Signature Accession (e.g. PF09103 / G3DSA:2.40.50.140)
+        - Signature Description (e.g. BRCA2 repeat profile)
+        - Start location
+        - Stop location
+        - Score - is the e-value of the match reported by member database method (e.g. 3.1E-52)
+        - Status - is the status of the match (T: true)
+        - Date - is the date of the run
+        - (InterProScan_ annotations - accession (e.g. IPR002093) - optional column; only displayed if -iprscan option
+        is switched on)
+        - (InterProScan_ annotations - description (e.g. BRCA2 repeat) - optional column; only displayed if -iprscan
+        option is switched on)
+        - (GO annotations (e.g. GO:0005515) - optional column; only displayed if --goterms option is switched on)
+        - (Pathways annotations (e.g. REACT_71) - optional column; only displayed if --pathways option is switched on)
+
+
+        Extensible Markup Language (XML)
+        ================================
+
+        XML representation of the matches - this is the richest form of the data. The XML Schema Definition (XSD) is
+        available [http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5 here].
+
+        Example Output
+        --------------
+
+        .. image:: $PATH_TO_IMAGES/example_xml_output.png
+
+
+        Generic Feature Format Version 3 (GFF3)
+        =======================================
+
+        The GFF3 format is a flat tab-delimited file, which is much richer then the TSV output format. It allows you to
+        trace back from matches to predicted proteins and to nucleic acid sequences. It also contains a FASTA format
+        representation of the predicted protein sequences and their matches. You will find a documentation of all the
+        columns and attributes used on [http://www.sequenceontology.org/gff3.shtml].
+
+        Example Output
+        --------------
+
+        ::
+
+        ##gff-version 3
+        ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
+        ##sequence-region AACH01000027 1 1347
+        ##seqid|source|type|start|end|score|strand|phase|attributes
+        AACH01000027 provided_by_user nucleic_acid 1 1347 . + .
+        Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027
+        AACH01000027 getorf ORF 1 1347 . + . Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1
+        449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347
+        AACH01000027 getorf polypeptide 1 449 . + . md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347
+        AACH01000027 Pfam protein_match 84 314 1.2E-45 + . Name=PF00696;signature_desc=Amino acid kinase
+        family;Target=null 84
+        314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"
+        ##sequence-region 2
+        ...
+        >pep_AACH01000027_1_1347
+        LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV
+        LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA
+        GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI
+        LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ
+        ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA
+        TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV
+        DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML
+        RSQKAKGVLIYRDDWISITPEIQLLFTEF
+        ...
+        >match$8_84_314
+        KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK
+        RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL
+        LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR
+        AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS
+
+
+        Scalable Vector Graphics (SVG) and HyperText Markup Language (HTML)
+        ====================================================================
+
+        InterProScan_ 5 outputs a single HTML/SVG file for each protein sequence analysed.
+
+
+        Example Output
+        --------------
+
+        .. image:: $PATH_TO_IMAGES/P51587.svg.png
+
+        .. _InterProScan: http://www.ebi.ac.uk/interpro
+
+
+        ----------
+        References
+        ----------
+
+
+        If you use this Galaxy tool in work leading to a scientific publication please
+        cite the following papers:
+
+        Peter J.A. Cock, Björn A. Grüning, Konrad Paszkiewicz and Leighton Pritchard (2013).
+        Galaxy tools and workflows for sequence analysis with applications
+        in molecular plant pathology. PeerJ 1:e167
+        http://dx.doi.org/10.7717/peerj.167
+
+        Zdobnov EM, Apweiler R (2001)
+        InterProScan an integration platform for the signature-recognition methods in InterPro.
+        Bioinformatics 17, 847-848.
+        http://dx.doi.org/10.1093/bioinformatics/17.9.847
+
+        Quevillon E, Silventoinen V, Pillai S, Harte N, Mulder N, Apweiler R, Lopez R (2005)
+        InterProScan: protein domains identifier.
+        Nucleic Acids Research 33 (Web Server issue), W116-W120.
+        http://dx.doi.org/10.1093/nar/gki442
+
+        Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn
+        RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J,
+        McAnulla C, McDowall J, Mistry J, Mitchell A, Mulder N, Natale D, Orengo C, Quinn AF, Selengut JD, Sigrist CJ,
+        Thimma M, Thomas PD, Valentin F, Wilson D, Wu CH, Yeats C. (2009)
+        InterPro: the integrative protein signature database.
+        Nucleic Acids Research 37 (Database Issue), D224-228.
+        http://dx.doi.org/10.1093/nar/gkn785
+
+
+        This wrapper is available to install into other Galaxy Instances via the Galaxy Tool Shed at
+        http://toolshed.g2.bx.psu.edu/view/bgruening/interproscan5
+
+
+        **Galaxy Wrapper Author**::
+
+        * Bjoern Gruening, University of Freiburg
+        * Konrad Paszkiewicz, University of Exeter
+
+    </help>
+</tool>