Mercurial > repos > peterjc > seq_filter_by_id
diff test-data/k12_hypothetical.fasta @ 1:262f08104540 draft
Uploaded v0.0.4 which includes a unit test and is faster at filtering FASTA files with large records (e.g. whole chromosomes)
author | peterjc |
---|---|
date | Mon, 15 Apr 2013 12:27:30 -0400 |
parents | |
children |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/k12_hypothetical.fasta Mon Apr 15 12:27:30 2013 -0400 @@ -0,0 +1,3 @@ +>gi|16127999|ref|NP_414546.1| hypothetical protein b0005 [Escherichia coli str. K-12 substr. MG1655] +MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHL +HGPPPPPRHHKKAPHDHHGGHGPGKHHR