diff test-data/k12_hypothetical.fasta @ 1:262f08104540 draft

Uploaded v0.0.4 which includes a unit test and is faster at filtering FASTA files with large records (e.g. whole chromosomes)
author peterjc
date Mon, 15 Apr 2013 12:27:30 -0400
parents
children
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/k12_hypothetical.fasta	Mon Apr 15 12:27:30 2013 -0400
@@ -0,0 +1,3 @@
+>gi|16127999|ref|NP_414546.1| hypothetical protein b0005 [Escherichia coli str. K-12 substr. MG1655]
+MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHL
+HGPPPPPRHHKKAPHDHHGGHGPGKHHR