Mercurial > repos > rnateam > splitfasta
annotate test-data/part1.fasta @ 6:7521d865e770 draft default tip
planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 49709e680f90372edd2b8a2715d95e5949641afa
| author | bgruening |
|---|---|
| date | Tue, 14 Jan 2025 21:52:36 +0000 |
| parents | 733ca84b21ee |
| children |
| rev | line source |
|---|---|
|
5
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
1 >NP_001007355.1 gi|55925472|ref|NP_001007355.1| eukaryotic translation initiation factor 4E-binding protein 3 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
2 MSNSEASSTCPIPSRSIHEKSWSPLPDSYSQTPGGTVFSTTPGGTRIIYDRKFLLECRNS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
3 PIARTPPCCLPDIPGVTRPSLQIIEQEEDSKDLSIDDSQFVIDI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
4 >NP_956692.1 gi|41055339|ref|NP_956692.1| transmembrane protein 218 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
5 MADVVLGVGTGVFIITLIWILTLALTIILSRATGPTKLGIIPVVLLALIITLVLVFFPRA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
6 AEVPAPQRAAQIVDMFFIGRYVLLSLVSLVFLAALFMLLPLHFLEPIYAKPLRTH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
7 >NP_001003767.1 gi|57524633|ref|NP_001003767.1| transmembrane protein 179 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
8 MAVDNFLFGQCILYFLAFLFGFIAVVPLSENGDDFQGKCLLFTEGIWQNENMTMGKQRFI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
9 VEEWGPESSCRFITFVGIVSLILSAVQAWRTFFFLCKGHDDSLFHSFLNLLLSLLVLFVV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
10 FVAGTISSVGFSIWCDSVTENGAMPSSCEDLQDTDLELGVENSSFYDQFAIAQFGLWSAW |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
11 LCWLGLTVLAFLKVYHNHRQQELLESLVQEKELLLGHPLQRSSYVYNRNAMI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
12 >NP_001002700.1 gi|50540464|ref|NP_001002700.1| fatty-acid amide hydrolase 2-A [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
13 MALTRFERFLGRLLRAVVWILFAAFKLFAPQQRHGVSRLPPITNPLLLLSAMQLARKIRR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
14 KEVTSVEVVQAYIDRIQEVNPLINAMVKDRFSAALQEAAQVDKLIEEETGGEDVLEDRLP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
15 LLGVPITVKEAFALQGMPNSTGLLTRRDLVSGADAPSVALLKRAGAIPLGVTNCSELCMW |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
16 LESHNHLYGITNNPYDFERIVGGSSGGEGSILGAGSSVIGIGSDIGGSIRIPCFFNGIFG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
17 HKPSVGIVNNEGQYPPASGQQMGFLCTGPMCRYAEDLIPMLSIMGGPNAEKLSLFTEVDL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
18 KKLRFFSVPHNGGSHLVSPVEPQLLHAQKMVVKRLEADLGVKVQELLIPQLKYSFQIWGT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
19 MMASPGKDGKPPTTFAELMSEGGKKVWPAWELFKWFLGFSSHTLAAIGLALVELFQSSHP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
20 SPFIMQQKESLQQELEELLGTDGVLLYPSHPLIAQKHHHPIFTPFNFSYTGIFNILGLPV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
21 TQCPLGLSAEGLPLGVQIVAGKLQDRLSLATALYLEKAFGGWREPGKTTIKP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
22 >NP_001003555.1 gi|57525887|ref|NP_001003555.1| centromere protein P [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
23 MEQKYEEDIQKLQQEIEMLEAEQEETLRSIFVQHGDRLQQGVKSACEERGGGGAQQHTLS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
24 KLITEVRELEKDLRRQTEINGITLNECFVKTLHKSERKLIQQLRLAGHCGLLLFQVEFAV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
25 TEIQEDNVLHRRVTELNIVVDGVEFKDFSAFVSRVEDTKDLLLFFRTLRTFSERCEDRRQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
26 TFQHFQEKYPDVVNLPEGCRSEIMIIRSPQLPGISMTLFWKIHVSKEGVVKPLLDLLLKM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
27 PDQALELDTKKVMEKASDYFQSLLQLLGVEASIEGLIRTVCS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
28 >NP_997599.1 gi|47058959|ref|NP_997599.1| protein dispatched homolog 2 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
29 MESGSISRQREDAEMPDSSTTEGPSLEAPQSEIPEVSLCPPDSDSTESQMCPVEIEENQT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
30 KSSSPFNSHSSTQLERQVSQGSAYHSPPHKKCPCCGHQQPSQSDVCPGQMNALHQADCAA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
31 SPVKTLYSCSPSRLPSCHTKMQCHWLHGSHDGSNHKPVQHHMVTVRNDGLHRIPRSYSQV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
32 IVEYPMTVLISCTLVLFACSLAGILTGPLPDFSDPLLGFEPRGTDISVRLATWTRLKQNT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
33 GPGKPLSPVPWQLTEKTTTGKDTIKSEPQFRERSRRMLHRDNAEHNFFCNAPGERYAQLV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
34 FRSGNSASLWSLKAIYSMCQMEQTQIRSGPQFDKLCQVKSEFYGSMVKNECCPSWSLGNY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
35 LAVLNNISSCFSLTSQQVSESLGLLRFCAPYYHDGSLIASCTERSKFGRCASVPHRCKLS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
36 SIFQILHYLVDKDFLGPQTVEYKVPSLKYSIVFLPVEKSDSLMNIYLDHLEGHKLTYNNT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
37 TITGMDLGIKQKLFKYYLARDSIYPVLAALALLITIGLYLKSLFIAAMSLVAVILSLSTS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
38 YFFYKVAFRLTFFPLLNLAAVFVLLGSCLNQALTFVDFWKLQLSHNPPAVPEKRMNRVLQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
39 EMGYLIIVSGLTSSVTFYSGYISSITAVRCYAVYLGSASLINTLFALVWLPCTLILQERY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
40 AVLSSNTVGKVAWKPCCSKNAGGFWETSSRKRCLFTFRQKLRTLGRGFSDTSNLLFLKIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
41 PCGVVKFRYIWICWFAVLAAGGTYISCVDPGMKLPTSDSRTTQLFRSSHPFERYDAEYRH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
42 QFMFERMKDGEDEPMMLTLIWGIVPSDNGDHFDPKSNGSLSVDPGFNMSSLQAQIWLRDL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
43 CGKIQNQTFYSPLSAEQDTAEDNVCFVEHLIHWVSIRRCSESEDAFSFCCNNIPFPYPPR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
44 VFEQCLSMMVAEQHAEGRLPSAGGLRFDSEGRIAALVVIFKTVQLYSFNYNRMSQFYQEI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
45 LSWFNREISKAPAGLQRGWFVSQLGLYDLQQCLSSETLEVAGFSVALTFALLLLTTWNIP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
46 LSVYVSIAVAGSVFATVGLLVLLEWQLNGVEALFISAAAGLSVDFVANYCISYSLAPHSD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
47 RLGRVAHSIKRMGCPVATGAGAYFCVGIIMLPATALLFRKLGIFLLLVKCVACGFATFFF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
48 QSLCCFFGPQNNCGRITLPCVTQQSTENILSSCSATEPGTNNPAANGAFGCGKGSRVRRS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
49 FNKENEGFLCPNQQHHRKRQPVGGREPEQNELQPLACQLSDSFENSTCTSKLSNRPSVLS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
50 DDIQFCGLSPKQDYDRVSIEADSTEMCSRHLKGCNPPPALQTSSPYKENMLRLPQDACKE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
51 KVLCKKCRGQSRGGLQLWNVSLSSSSSMDEIMITQTTDTVNERSLSMDDHIHKRLLSCQS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
52 QSSIEGLEESNDTCLTEVEAAIPQAGKIEDEFQPGHLNGKRDTLRLSLKETVYDLASPGS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
53 GRVRTAQSDVPVILPNSKPDMPDVWIKREGKGEGGS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
54 >NP_001013313.1 gi|61651744|ref|NP_001013313.1| coiled-coil domain-containing protein 115 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
55 MRVDENLRLDEQLLLFMEQLEALEEKRQRLNSLIEEGWFSIAKARYSMGNKQVSALQYAS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
56 EMQPLAHVETSLLEGGTAEFKCERSENKAEEQKTKTIEDIGAKETGLRRRVHTKQKEVKE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
57 GEQDTDEVKTKTDSPTPEHRNPLKWFGILVPQNLKQAQSAFKEVITLSVEIASLQSTILA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
58 TRKEMQVQMKEKQERTEKAQLEVKEE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
59 >NP_991238.1 gi|45387769|ref|NP_991238.1| pituitary homeobox 3 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
60 MDFNLLTDSEARSPALSLSDSGTPQHDPGCKGQDNSDTEKSHQNHTDESNPEDGSLKKKQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
61 RRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRER |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
62 NQQAELCKNGFGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPFFNSMNVSPL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
63 SSQPMFSPPSSIPSMNMASSMVPSAVAGVPGSGLNNLGNLNNLNSPTLNSAAVSAAACPY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
64 ATTAGPYMYRDTCNSSLASLRLKAKQHANFAYPAVQNPVSNLSPCQYAVDRPV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
65 >NP_001244093.1 gi|380503827|ref|NP_001244093.1| blood vessel epicardial substance isoform 2 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
66 MSNTTSALPSSVPAVSLDPNATLCQDWEQSHHLLFHLANLSLGLGFLIPTTLALHMIFLR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
67 LLLMTGCSLFIAWATLYRCTLDVMVWNVVFLLVNFMHFFFLLYKRRPIKIDRELKSVYKR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
68 MFEPLHVREALFQRLTGQFCTIQTLKKGQVYAAEDKTSVDERLSILLKGKMKVSYRGHFL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
69 HNIYTNAFIDSPEFRSTQMNRGERFQVTIAAEENCKLLCWSRERLTYFLESESFLNEVFR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
70 YLIGKDITNKLYSLNDPTLSDKAVKKMDRQPSLCSQLSMMQMRNSMASTSDTDDVLNQIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
71 RGGSTGSSLQKNPLTKTSTTMKPIEEGLEDDVFESESPTTSQNVSKTTKKDI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
72 >NP_001013309.2 gi|157042782|ref|NP_001013309.2| tRNA 2'-phosphotransferase 1 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
73 MDCETRGRGRRGRGNRNEESRDVRLSKSLSYVLRHGASKMGLQMNSDGFVFVEELLAHQQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
74 FRSFSVDDVERVVASNDKQRFKLCKHPEDDRLQIRANQGHSVQVTDLELREISQDDQDYP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
75 REAVHGSYMKHWPSIRSQGLSRMNRTHIHLAPGLPGEGRVISGMRQSCDLAVYIDVTKAM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
76 SDGIKFFWSENGVLLTPGDAAGILAPCYFSRAQRLKPLPCDIELH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
77 >NP_001001847.2 gi|380503821|ref|NP_001001847.2| blood vessel epicardial substance isoform 1 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
78 MSNTTSALPSSVPAVSLDPNATLCQDWEQSHHLLFHLANLSLGLGFLIPTTLALHMIFLR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
79 LLLMTGCSLFIAWATLYRCTLDVMVWNVVFLLVNFMHFFFLLYKRRPIKIDRELKSVYKR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
80 MFEPLHVREALFQRLTGQFCTIQTLKKGQVYAAEDKTSVDERLSILLKGKMKVSYRGHFL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
81 HNIYTNAFIDSPEFRSTQMNRGERFQVTIAAEENCKLLCWSRERLTYFLESESFLNEVFR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
82 YLIGKDITNKLYSLNDPTLSDKAVKKMDRQPSLCSQLSMMQMRNSMASTSDTDDVLNQIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
83 RGGSTGSSLPVTSDRA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
84 >NP_001015061.1 gi|62632729|ref|NP_001015061.1| putative all-trans-retinol 13,14-reductase precursor [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
85 MWFAVVAIFLALVAFLYRYVVGSGPNPFAIDTREPLKPMVFDRKLKNKVLKQGFLASRVP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
86 EDLDAVVVGSGIGGLAIAVLLAKVGKKVLVLEQHDRAGGCCHTFKEQGFEFDVGIHYIGE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
87 LSNHKPLRCIIDQMTNGQLQWDPLENPFDNVVIGPPENRRIYQIYSGRKRYMDELKKCFP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
88 GEEKAIDEYVRLCKEVGQGVWVMVLLKFLPTPIANFLVRTGLANRLTSFSRYASRSLTDV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
89 VNELTQNKDLRAVLSYIFGTYGKIPKEASFSMHSLIVNHYMNGAWYPKGGATEIAYHMIP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
90 IIEKAGGAVLVRAPVNRILLNDAKEAIGVSVLKGQEEVHVRAPIVISDAGIFNTYEYLLP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
91 KDVQTMPAIQKQLSMLQHGDSGLSIFIGLDGTKEELGLKADNYFIYPENNIDELLEDYRS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
92 GNREESAKKNPLIFVASPSAKDSTWPERTPGKSTLTVVSFANYEWFEEWKDDKVKNRSTD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
93 YKQLKELFINYILEAVTEIYPKIKDRIEYVDAGTPITNQHYIAAPRGEIYGADHGIPRFS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
94 AELNATIRAQTPIKNLYLTGQDLMLCGFAGALTGALTCGSVILNRNLHLEAFSLAKRVQN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
95 GNNKKKT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
96 >NP_001003580.1 gi|57525791|ref|NP_001003580.1| kelch-like protein 15 [Danio rerio] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
97 MSGDVEVYLSQVHDGSVSSGFRALYEERLLLDVTLLIEEHHFQAHKALLATQSDYFRVMF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
98 TADMRERDQDKIHMKGLTAAGFGHVLRFMYYGSLELSMLTVQEILQAAMYVQLTEAVEFC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
99 CSFLLAKICLENCAEVMRLLEDFSVGVEGVQEQLDAFLLENFVPLMARPDFLSYLSLEKL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
100 MAYLDSDQLSRYPEIELYEAVQAWLRHDRRRWRHTDAVVQNLRFCLMTPANIFEKVKTSE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
101 FYRYSRQLRLEVDQALSYFHQVNEQPLAETKSNRIRSVRPQTAVFRGMIGHSMVNSKILL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
102 LHRPKVWWELEGPQVPLRPDCLAIVNNFAFLLGGEELGPDGEFHASSKVYRYDPRQNSWL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
103 RMADMSVPRSEFAVGVIGKYIYAVAGRTRDETFYSTERYDIVEDKWEFVDPYPVNKYGHE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
104 GTVLNGKLYITGGITSSSTSKQVCVFDPGREGSSEHRTRRTPILTNCWENKSKMNYARCF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
105 HKMISHNGKLYVFGGVCVILRASFESQGCPSTEVYDPETDEWTILASMPIGRSGHGVAVL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
106 DKQIMVLGGLCYNGHYSDSILTFDPEENKWKEDEYPRMPCKLDGLQVCSLHFPEYVLEHV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
107 RRCS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
108 >XP_006779743.1 gi|583968567|ref|XP_006779743.1| PREDICTED: CCAAT/enhancer-binding protein alpha-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
109 MELSNLYEVAPRPLMNNLNQQPPSGYRDPADLGGEIGDNETSIDLSAYIDPSAFNDDFLA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
110 DLFHHSSRQDKLKMMNGEYDPVSCGPGPQQLYMSNYMESKMEPLYEHNPPRLRPVAIKQE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
111 PRDDEDMNPGMPPTYHHPHPHPHPQQYSQQQQMPHLQYQIAHCAQTTMHLQPGHPTPPPT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
112 PVPSPHQHQHSHPHSHQGGMKLLEQQRGCGKTKKHVDKNSPEYRLRRERNNVAVRKSRDK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
113 AKMRNMETQHKVVELTADNDRLRRRVEHLTRELDTLRGIFRQLPDGSFKPMGS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
114 >XP_006779744.1 gi|583968570|ref|XP_006779744.1| PREDICTED: ras-related protein Rab-8B-like, partial [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
115 SLSGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
116 IKNWIRNIEEHASADVEKMVLGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSINV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
117 EEGFYTLARDIMARLNRKMNDNNPSGGGGPVKITEPRSKKSLFRCSLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
118 >XP_006779746.1 gi|583968574|ref|XP_006779746.1| PREDICTED: calcium and integrin-binding family member 2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
119 MGNKQTTFTEEQLEAYQDCTFFTRKEILRLHARYRELAPHLVPLDYTNNPDIKVPMTLIV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
120 TMPELKVQFYRYRIVQVLWQLSTESSRWGSGPDFNRDNFICKEDLEKTLNKLTKGELMPE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
121 EVTLVCDKAIEEADLDGDHKLSFADFENMISKAPDFLSNFHIRI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
122 >XP_006779747.1 gi|583968576|ref|XP_006779747.1| PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
123 MEDYTLPFWIYLVIVTVFIGGAMKKILASHLNTTSTVVAWLGATVLVERLWAFCLPAMLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
124 LVLFGITFCIYYATKTSQPRAMLPAHGKAVIITGCDSGFGNATAKHLDSLGFEVFATVLD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
125 LNGDGAKELQRTCSHRLTLLQVDITQPQQVQQALLDTKAKLGLKGLWALVNNAGVCVNFG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
126 EVELSLMSNYRGCMEVNFFGTLSITKAFLPLLRQTKGRIVTISSPAGDQPFPCLAAYGAS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
127 KAALNLITETLRHELEPWGVQVSTILPSSYRTAQSTNSAYWEKQHKHLLQNLSPALLEDY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
128 GEEYMTETKDLFQTFAKHTTTNLQPVVDTIVQALLAPQPQPRYFAGAGLSLMYFLYAYFP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
129 YSMSNNFLKKKFLKKNVIPRALRKQSAFDLNLSLHNNNNEEKLQQM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
130 >XP_006779748.1 gi|583968578|ref|XP_006779748.1| PREDICTED: transient receptor potential cation channel subfamily M member 1-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
131 MYIRVSFDSKPDSLLHLMVKDWQLELPTLLISVHGGLQNFDLPPKLKQVFGKGLIKAAVT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
132 TGAWIFTGGVSTGVIRHVGDALKDHSSKSRGKVCAIGIAPWGIVENKEDLIGRDVTRPYQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
133 TMSNPLSKLSVLNSSHSHYILADNGTCGKYGAEVRLRRQLEKHISLQKINTRLGQGVPVV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
134 CLIVEGGPNVISITLESLKEEPPVPVVVCDGSGRASDILSFAHRYCEEDG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
135 >XP_006779749.1 gi|583968580|ref|XP_006779749.1| PREDICTED: chymotrypsin B-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
136 MAFLWIVSCLAFVGAAYGCGTPAIPPRVTGYARIVNGEEAVPHSWPWQVSLQQTNGFHFC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
137 GGSLISEQWVVTAAHCNVRTYHNVIVGEHNKGYGSTENIQVLKPAKVFTHPSWNPQTINN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
138 DITLIKLASPARLGTNVSPVCLADTTDSFAAGMKCVTTGWGLTRYNAPSTPNNLQQAALP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
139 LLSNEECKKHWGSNISDVMICAGGAGATSCMGDSGGPLVCQKDNVWTLVGIVSWGSSRCS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
140 TSTPAVYARVTKLRGWVDQILASN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
141 >XP_006779750.1 gi|583968582|ref|XP_006779750.1| PREDICTED: agouti-related protein-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
142 MFGTVLLCCWSFGLLPLASSLVHGNLPLDEGPVAGRRTETFLSEIERSQVPDRMHEPALL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
143 PVDSVEDHFLMDTGSYDEDTSAALQLQGRAMRSPRRCIPHQQSCLGYPLPCCDPCDTCYC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
144 RFFNAICYCRRVGHVCPPRRT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
145 >XP_006779751.1 gi|583968584|ref|XP_006779751.1| PREDICTED: EMILIN-1-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
146 MAALPLLLLLVLWTCGNAKGAFPLRQSYNLYTNGHAHGARAASRHRNWCAFVVTKTVSCV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
147 VEDGVETYVKPDYHPCSWGSGQCSRVVVYRTYMRPRYKVAYKMVTEMDWKCCHGYSGADC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
148 NIGPVGGGGTQISTTRPQPGQGGGTTSGQGGGGHSYGGGSSGSGQSGGNADNEKMRQLEE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
149 KIRSLTKNLQDLQSTMSTMNERLQEEGGRNGFGERSSGGRNPADAAQPEIKETIHSIQTK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
150 LDQLDNRTQAHDKTLVSINNHLVNGKGNELEGGASGGSLSEGRLNSLKEEILSKLERRVS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
151 LSCSSCQAGVEDLRKQQQQDRERIRALEKQMNAMDVQYRQSLDGLRRDVVRSQGCCDIIS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
152 DLQDRVTDAERKISTASENFDILQNRLDREISGQGGTSENTGSRGQGLPVGGETGGHGRD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
153 AMITEEHLNNRLKDLERRVNSTMQKTEESCSYLENHVKDYFHRELDELRSVFLERFDDQA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
154 DRITDVELDVEQVKDSISDHDKRLSKLENTTSQMSWRLEKCGCVASEQGGGGEGRGRGDG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
155 GYGGGSWGAGGGGSTGEGKDGGNRGDGGGTWGAGGGGGGSTGGGGRWGGTGGGLPGTGGE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
156 KDNSTKKSLEWRVVANEDQIRHFNTQLKDLSMSGDSLYDKVLDLTDDVGKIKALTGDHGE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
157 HFNRIVTVVEMLGEDCELCGKVEKELQKMRNYSQNALSNIQNHINRIQNRMDSEGDSCFQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
158 MCSVLQSEVSVLRDDVRRCTNQCKSNPDMTTGVDHARPGGTDDNSGPLDPAKPLDGHSVI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
159 EGINNNHLKTLQGELSNVILTFSSINDTLKGLEHTVQKHDSVITDLGNTKDKIISEIDKV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
160 QQELTEHIEDNRNRLDKMDRDIRRFESTVLEMGDCKRSGDGLEKRLSKLEGVCGRLDGVS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
161 DSILKIKEGLNKHVSSLWTCVSGLNDTVIRHGGLLDFIQDGQDDIHSRVKNLNSSLNQVS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
162 RDLQSFSEHDLTGPPGPQGPQGHPGERGFNGPPGLPGPPGFPGPRGEIGPHGPKGETGLP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
163 GADAQIPKLSFSAALTAPMDRAGTIVFDKVFVNEGNFYNPRTGIFTAPVDGNYYFSAVLT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
164 GHRNEKIEAVLSKSNYGMARVDSGGYQPEGLENNPVAEAKVNPGSLAVFSIILPLQTQDT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
165 VCIDLVMGKLAHSVEPLTVFNGMLLYENK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
166 >XP_006779752.1 gi|583968586|ref|XP_006779752.1| PREDICTED: zinc finger protein 507-like isoform X1 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
167 MEEITNVITHSSAASSSSSTSGSHTRQTKEKQPSQGFQQKTADDSLIQVIKKLSKIVEKR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
168 PQRRCASGGQKRALQVGERGAEQGGGSICKKIKRNLKDEVGVERSTDDSSLPSPWSGDDN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
169 NNVTTAVAEVAANPNSSDLKRTVTCYQCSLCPHLSQTLPLLKEHLKQHNEQHSDLILMCS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
170 ECHFTSRDHEQLEAHVRMHFDNGDNQKRKYPVSEAKEEVLKNQDVDLTGDNCSAGTEVKK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
171 SSVSNAKELPQKKKWYSYEEYGLYRCLICSYVCSQQRMLKTHAWKHAGLVDCSYPIFEDE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
172 DGGSAKREVQAAPNNASAREEIVVLQDKSLQKLPTGFKLQLCMPVAVEDKQEVVNLQGSH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
173 LSESPKTEEEDEYPIKDMTSEEPAVEVQVTTEAETEVELGGHHESTSATDSLLSSAQKII |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
174 NRSPNSAGHINVIVERLPSAEDSVMASNPLLLSPDVDGDKSLLEKKAEEQEHVEGVKDEV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
175 VLCYSPGNANKSQHLGADIKPSIAKSNDLPRDENVPPAGRKRTHSESLRLHSLAAEVLVA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
176 MPMRTPELPNSGAKVALKTVAAQAQSPQAGQKPTEGAAAGQKASDVGTAAAMLNCNEGRE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
177 ETLGSLGLGKGDDDGPAANGGISLSLLTVIERLRERSDQNTSDEDILKELQDNAQFQSGA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
178 GVVAANGAGSYVCSSVPGMDGLVGSPDSGLVDYIPGSDRPYRCRLCRYSSGNKGYIKQHL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
179 RVHRQREPYQCPICEHIASDSKDLENHMIHHCKSRMYQCKQCPDAFHYKSQLRNHEREHH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
180 SFSGDVEMLTPVAETAAAMEETERVTYEEGSPQKMFKCDVCNYTSSTYVGVRNHRRIHNS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
181 DKPYRCCSCDFATTNMNSLKSHMRRHPQEHQAVQLLEQYRCSLCGYVCSHPPSLKSHMWK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
182 HAGDQNYNYEQVNKAINEAISQSSR |
