Mercurial > repos > rnateam > splitfasta
annotate test-data/part2.fasta @ 6:7521d865e770 draft default tip
planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 49709e680f90372edd2b8a2715d95e5949641afa
| author | bgruening |
|---|---|
| date | Tue, 14 Jan 2025 21:52:36 +0000 |
| parents | 733ca84b21ee |
| children |
| rev | line source |
|---|---|
|
5
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
1 >XP_006779753.1 gi|583968588|ref|XP_006779753.1| PREDICTED: zinc finger protein 507-like isoform X2 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
2 MEEITNVITHSSAASSSSSTSGSHTRQTKEKQPSQGFQQKTADDSLIQVIKKLSKIVEKR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
3 PQRRCASGGQKRALQVGERGAEQGGGSICKKIKRNLKDEVGVERSTDDSSLPSPWSGDDN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
4 NNVTTAVAEVAANPNSSDLKRTVTCYQCSLCPHLSQTLPLLKEHLKQHNEQHSDLILMCS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
5 ECHFTSRDHEQLEAHVRMHFDNGDNQKRKYPVSEAKEEVLKNQDVDLTGDNCSAGTEVKK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
6 SSVSNAKELPQKKKWYSYEEYGLYRCLICSYVCSQQRMLKTHAWKHAGLVDCSYPIFEDE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
7 DGGSAKREVQAAPNNASAREEIVVLQDKSLQKLPTGFKLQLCMPVAVEDKQEVVNLQGSH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
8 LSESPKTEEEDEYPIKDMTSEEPAVEVQVTTEAETEVELGGHHESTSATDSLLSSAQKII |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
9 NRSPNSAGHINVIVERLPSAEDSVMASNPLLLSPDVDGDKSLLEKKAEEQEHVEGVKDEV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
10 VLCYSPGNANKSQHLGADIKPSIAKSNDLPRDENVPPAGRKRTHSESLRLHSLAAEVLVA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
11 MPMRTPELPNSGAKVALKTVAAQAQSPQAGQKPTEGAAAGQKASDVGTAAAMLNCNEGRE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
12 ETLGSLGLGKGDDDGPAANGGISLSLLTVIERLRERSDQNTSDEDILKELQDNAQFQSGA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
13 GVVAANGAGSYVCSSVPGMDGLVGSPDSGLVDYIPGSDRPYRCRLCRYSSGNKGYIKQHL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
14 RVHRQREPYQCPICEHIASDSKDLENHMIHHCKSRMYQCKQCPDAFHYKSQLRNHEREHH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
15 SFSGDVEMLTPVAETAAAMEETERVTYEEGSPQKMFKCDVCNYTSSTYVGVRNHRRIHNS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
16 DKPYR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
17 >XP_006779754.1 gi|583968590|ref|XP_006779754.1| PREDICTED: probable C-mannosyltransferase DPY19L3-like isoform X1 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
18 MTTLRQRKGSKGKEPSPAAELQSQQHNCCSEHHPEKILHGDWSWGAIIWTSVGWSVSVGL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
19 GLLCCIYVATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLHAPSIQEGLKEMIHD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
20 NLTESKRTINLLQRMNIYQEVFLSVLYRLLPIQSYLEPVYFYIYTVFSLQAVYVIALYLT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
21 AWLLSGSWLAGALTGVWYILNRVDTTRVEFTISLRENWSLPFFALQVTAITCYLRPQLTT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
22 LQQKVMVWLMYVTTFCFCLTWQFNQFILLVQALVIYTLDCGDFLTTTQVTTLYLVQVSSL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
23 LSVWFLQFCNSMILGSLVLSFIVAALFIRHCQPGVKTGSLVVRLGKVLLHSALVLLLTVT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
24 INYLAKKALQLQSDEHIFKFIKSKFALGSTRDFDASLYLCEEAFGLLPLDTLERLAGTLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
25 LYPYVLTLLLLCGMLVAAALQNLSRPNRGSTEEKKGAREGQVAAFRPDVAYNVLHTLFYG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
26 LLAFSTMRMKYIWTGHMCAVAAYGVCGTELWTVLLSALRCNTKLLLRLVRYVAPVVMIGF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
27 LYYKFWPKLMEELSELREFYDPDTVELMTWISTKTPKQAVFAGSMQLLAGIKLCTGRVLT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
28 NHPHYEDKDLRERTRQVYQVYARRSPEEVYDILKAIGADYVVLENSICYERRHRRGCRLR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
29 DLLDLANGHIMDGPGENDPDLVPATHPRFCDAIKTDAAYNALFTRTFQNKTFHVYRLKKK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
30 RKKNTKGSSEPSVTQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
31 >XP_006779755.1 gi|583968592|ref|XP_006779755.1| PREDICTED: probable C-mannosyltransferase DPY19L3-like isoform X2 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
32 MTTLRQRKGSKGKEPSPAAELQSQQHNCCSEHHPEKILHGDWSWGAIIWTSVGWSVSVGL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
33 GLLCCIYVATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLHAPSIQEGLKEMIHD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
34 NLTESKRTINLLQRMNIYQEVFLSVLYRLLPIQSYLEPVYFYIYTVFSLQAVYVIALYLT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
35 AWLLSGSWLAGALTGVWYILNRVDTTRVEFTISLRENWSLPFFALQVTAITCYLRPQLTT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
36 LQQKVMVWLMYVTTFCFCLTWQFNQFILLVQALVIYTLDCGDFLTTTQVTTLYLVQVSSL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
37 LSVWFLQFCNSMILGSLVLSFIVAALFIRHCQPGVKTGSLVVRLGKVLLHSALVLLLTVT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
38 INYLAKKALQLQSDEHIFKFIKSKFALGSTRDFDASLYLCEEAFGLLPLDTLERLAGTLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
39 LYPYVLTLLLLCGMLVAAALQNLRPNRGSTEEKKGAREGQVAAFRPDVAYNVLHTLFYGL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
40 LAFSTMRMKYIWTGHMCAVAAYGVCGTELWTVLLSALRCNTKLLLRLVRYVAPVVMIGFL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
41 YYKFWPKLMEELSELREFYDPDTVELMTWISTKTPKQAVFAGSMQLLAGIKLCTGRVLTN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
42 HPHYEDKDLRERTRQVYQVYARRSPEEVYDILKAIGADYVVLENSICYERRHRRGCRLRD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
43 LLDLANGHIMDGPGENDPDLVPATHPRFCDAIKTDAAYNALFTRTFQNKTFHVYRLKKKR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
44 KKNTKGSSEPSVTQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
45 >XP_006779756.1 gi|583968594|ref|XP_006779756.1| PREDICTED: probable C-mannosyltransferase DPY19L3-like isoform X3 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
46 MCRGLKEMIHDNLTESKRTINLLQRMNIYQEVFLSVLYRLLPIQSYLEPVYFYIYTVFSL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
47 QAVYVIALYLTAWLLSGSWLAGALTGVWYILNRVDTTRVEFTISLRENWSLPFFALQVTA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
48 ITCYLRPQLTTLQQKVMVWLMYVTTFCFCLTWQFNQFILLVQALVIYTLDCGDFLTTTQV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
49 TTLYLVQVSSLLSVWFLQFCNSMILGSLVLSFIVAALFIRHCQPGVKTGSLVVRLGKVLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
50 HSALVLLLTVTINYLAKKALQLQSDEHIFKFIKSKFALGSTRDFDASLYLCEEAFGLLPL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
51 DTLERLAGTLLLYPYVLTLLLLCGMLVAAALQNLSRPNRGSTEEKKGAREGQVAAFRPDV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
52 AYNVLHTLFYGLLAFSTMRMKYIWTGHMCAVAAYGVCGTELWTVLLSALRCNTKLLLRLV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
53 RYVAPVVMIGFLYYKFWPKLMEELSELREFYDPDTVELMTWISTKTPKQAVFAGSMQLLA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
54 GIKLCTGRVLTNHPHYEDKDLRERTRQVYQVYARRSPEEVYDILKAIGADYVVLENSICY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
55 ERRHRRGCRLRDLLDLANGHIMDGPGENDPDLVPATHPRFCDAIKTDAAYNALFTRTFQN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
56 KTFHVYRLKKKRKKNTKGSSEPSVTQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
57 >XP_006779757.1 gi|583968598|ref|XP_006779757.1| PREDICTED: MTSS1-like protein-like isoform X1 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
58 MLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDLKGSDYSWSYQTPPSSPSSSGSRKS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
59 SMCSSVNSTHSSASRSSGGGGSGGVGGGGSLPHSPTSSSSSSCRYRSSLPHQPPPPGGIA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
60 AHRLSSVSSHDSGFVSQDANIYSKPPSPMPSDITSQKSSSSASSEASETCQSVSECSSPT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
61 TFGSSFATFRPALFHSGSTRPLSVILPVPASPPYIRPPGSSSSSPTSKVPMWKDWSKAGQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
62 YEQPVAAAAVQRRREPLDRLRESEASPGSQGYAGPSHPDDGQRARMTPATIAAKHGEEVS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
63 PAASDLAMVLTRGLSMEQQKSNRDSLQYSSGYSTETTTPSCSEDTIPSQGSDYDCYSVNG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
64 DAEGPDGQTEFDKSSTIPRHSNIAQNYRRMIQTKRPASTAGLPTGVLGPGAHGIPGQPGG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
65 AGGGGTGTPGTATIRRTPSTKPGVRRTLSSAGPIPIRPPIVPVKTPTVPGDSHSPGAGGG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
66 HAGGVPVRVGSEECVFFTGAEDSQGALDYVKASPKRLSLPNTAWGSGAALEVYAQQHGGL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
67 AIGTGSGTGSEEDQMIAANRHSLVEKIGELVASAHALGEGQFPFPALPDDPAPPPTGPTD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
68 TETGTEGAEGSGDMLTTIRRGVRLRKTVSNDRSAPRIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
69 >XP_006779758.1 gi|583968600|ref|XP_006779758.1| PREDICTED: MTSS1-like protein-like isoform X2 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
70 MLGEITHLQAIIDDLTVLTTDPHKLPPASEQVIKDLKGSDYSWSYQTPPSSPSSSGSRKS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
71 SMCSSLPHQPPPPGGIAAHRLSSVSSHDSGFVSQDANIYSKPPSPMPSDITSQKSSSSAS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
72 SEASETCQSVSECSSPTTFGSSFATFRPALFHSGSTRPLSVILPVPASPPYIRPPGSSSS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
73 SPTSKVPMWKDWSKAGQYEQPVAAAAVQRRREPLDRLRESEASPGSQGYAGPSHPDDGQR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
74 ARMTPATIAAKHGEEVSPAASDLAMVLTRGLSMEQQKSNRDSLQYSSGYSTETTTPSCSE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
75 DTIPSQGSDYDCYSVNGDAEGPDGQTEFDKSSTIPRHSNIAQNYRRMIQTKRPASTAGLP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
76 TGVLGPGAHGIPGQPGGAGGGGTGTPGTATIRRTPSTKPGVRRTLSSAGPIPIRPPIVPV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
77 KTPTVPGDSHSPGAGGGHAGGVPVRVGSEECVFFTGAEDSQGALDYVKASPKRLSLPNTA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
78 WGSGAALEVYAQQHGGLAIGTGSGTGSEEDQMIAANRHSLVEKIGELVASAHALGEGQFP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
79 FPALPDDPAPPPTGPTDTETGTEGAEGSGDMLTTIRRGVRLRKTVSNDRSAPRIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
80 >XP_006779759.1 gi|583968603|ref|XP_006779759.1| PREDICTED: G-protein coupled receptor 64-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
81 MCFSPQIPDPSITKKDQEILTRITVIGCSISLFTLVIAILLFITNRKLRQDVSMKVHINL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
82 VIALMLLNLHFLPSQAVAAGSPSGLCLYMALLLHYSLLATFSWMALEGFHLYLLLVKVFN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
83 IYVKKYLLKLSVVGWGVPAMIVSVVVIIDRTFYGLAPLDTSHSSTAM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
84 >XP_006779760.1 gi|583968609|ref|XP_006779760.1| PREDICTED: probable RNA polymerase II nuclear localization protein SLC7A6OS-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
85 MDPNTTILRVKRKRGTDPADALLLACKRIRPETSQSSGETVPEPNEAEVENSVFKLVATV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
86 ATQEAPVQTQVRQALARPRTAHALRPSAASSQRILGDLRSTKWSTRREERYRILSSHRAG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
87 LSAPAEQQTPQMGASECVEETGKETDKCWGLGEIQVVDLIHEDGEDQDKPSGKILSSEPD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
88 EILCNNTKMLRERLSISGDRLGEEHREQDDGYVYDLYYQETVTPGWIQDILSVRAYADEG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
89 ELVPDLVVHEEEVYEDEDDENEEGNWRNDYPDEESDTDSDREERYGGYWEEEHSYSRRSW |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
90 QRYQREVTHELGCRGDDDNGDDDDDDGDKYDSD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
91 >XP_006779761.1 gi|583968612|ref|XP_006779761.1| PREDICTED: Y+L amino acid transporter 2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
92 MANREESKKMNGNSGDSSTLLETPKESMQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
93 IYSASYGLSLVIWAIGGLFSVIGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
94 LLIIEPTSQAVIAITFANYLVQPLFPTCEPPYAASRLIAAACVCLLTFINSAYVKWGTRV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
95 QDIFTYAKVAALIVIIVTGIVKLCQGYTGNFESSFQGSSTDPGDIALALYSALFSYSGWD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
96 TLNFVTEEIKSPERNLPMAIAISMPIVTIIYILTNVAYYAVLDASAILASDAVAVTFADH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
97 TLGVMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIQRFTPIPALI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
98 FNCVMSLIYLTVEDVFQLINYYSFSYWFFMGLSIAGQIYLRLKEPDRPRPLKLSLLYPVV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
99 FCLCTIFLVAVPLYSDTVNSLIGIAIALSGVPVYFLGVYLPESKRPPVITKLLRSLTDFT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
100 QYTCFCVLTEMDKSQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
101 >XP_006779762.1 gi|583968614|ref|XP_006779762.1| PREDICTED: G-protein coupled receptor 64-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
102 MGIEVLHTFWLVYMVFTPRLKPYIWNLVGFALPAVPVVILAPIGDIYGPIEVPPSEDPEN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
103 PYKMCWMDITENKGWLAFCFTNVMILALLVSSGLVMLFLVYRQIRTRDEWKQNRVAFLSI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
104 WGLSCLYGTTWGLAFLEFEPISTFILFITCILNSFQGFFLMLRFCMLDWMQKQAGGSGLG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
105 SSSTGSTRQHMLQAQERS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
106 >XP_006779763.1 gi|583968616|ref|XP_006779763.1| PREDICTED: synapse-associated protein 1-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
107 MLKGLGTWLGLEGPTVTETSVDKEKLNVEQEEKVVEAQTEVNKQQPADQDGTPEAEQENS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
108 DQSTGLGGYIFSFASSATKKISDSMVETAQTIKKTVEEGKIDGIIDKTFLGDFQKEQEKF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
109 VQEKKAKKSEAAVPPWVGYNEEETIQQQILALSADKRNFLRDPPAGVQFHFDMEQMYPLA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
110 AVMLEEDELLNRMRFDLVPKHVKEEMFWRNYFYRVSLIKQSAQLTALAAQQQRNDSVDKG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
111 ASVSPEDIVLTDNVRPKTPPVSISDIQKPTHEEDEEISTSPGVSEFVSDAFDSTAINQED |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
112 LRKEMEQLVLDKKDSPSPDDESADWEKELQQELQEYEVVTESGNKDDQWDQEIEKMLQSD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
113 DS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
114 >XP_006779764.1 gi|583968618|ref|XP_006779764.1| PREDICTED: LOW QUALITY PROTEIN: probable phosphatase phospho2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
115 MKILMVFDFDHTVVDANSDTWVVRCLPDKTLPGSVENSYRKGYWTEYMGRVLNYIGEQKV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
116 SPDRVRSVMETIPFTAGMTELLTFIAENKNAIDCIVISDSNTLFIEWILHAAGLQAAVDK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
117 VFTNPAKLNELGHVEVQCYHSHACDQCPVNLCKKKVLELYLSEQSDAGVEYEQIFYAGDG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
118 GNDLCPTSCLRGRDVVMPRKGYTLEKLLAKLEGQEGNFSVRAKNIAWSSGTDILRELKAS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
119 MQSXPWHMKYYKF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
120 >XP_006779765.1 gi|583968620|ref|XP_006779765.1| PREDICTED: cadherin-8-like isoform X1 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
121 MPKRSEEMLTDLWLSLLLVWITCVLSVSMTPIIGQSKSTQTGGSAVVASGVGEGQRLLSR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
122 AKRGWVWNQMFVLEEFSGPDPILVGRLHTDKVENDTARYSLAGEGAGTIFAINEKTGDIH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
123 AMKRLDREEKAEYTLTAKVTNGITGQLLEPMTEFIIKVQDINDNAPKFTEGPYHAAVEEM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
124 SAVGTSVITITATDADDPVYGNSAKLVYSILEGQPYFSVDPNSATIRIALHGMDREMRED |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
125 YQVVIQAKDMGGHMGGLSGTTTVSITLQDINDNPPKFSKSLYEFVIPEDLPLGKEGGKVK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
126 ANDRDIGENAKSTYSIIEGDDQGVFEIITNATTQEGILQLRKPLDYESKRNYTLKVEATN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
127 IRSEPRSNGPFKDTATVKIVVEDSDEPPVFSKPMYLLEVDENAPINKIIGTVTARDPDAT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
128 GSPIRYFIDRHTDLERQFNINVDNGRITLAKPLDRETDMWHNITVTATEVRNHSQISRAV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
129 VAIRVMDINDNAPEFATEYETFLCENGKPGQVIQTVSAVDKDDPIQGHYFDYRLVPEMLN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
130 NPNFTIKNNQDNSISVLAKHDTFRRQKQEMYFLPIIVTDNGNPPMSSTNTLTIRVCGCSK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
131 DGIVQSCNVEAYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNEPLIIKDDEDVR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
132 ENIIRYDDEGGGEEDTEAFDIATLQNPDGINGYLPRKDIKPDLQFMPRAGQHSGPNGVDV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
133 DEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSIAGSLSSLETASSDSDQNYDYLREWGP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
134 RFRRLGELYSVGESDRET |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
135 >XP_006779766.1 gi|583968622|ref|XP_006779766.1| PREDICTED: cadherin-8-like isoform X2 [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
136 MPKRSEEMLTDLWLSLLLVWITCVLSVSMTPIIGQSKSTQTGGSAVVASGVGEGQRLLSR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
137 AKRGWVWNQMFVLEEFSGPDPILVGRLHTDKVENDTARYSLAGEGAGTIFAINEKTGDIH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
138 AMKRLDREEKAEYTLTAKVTNGITGQLLEPMTEFIIKVQDINDNAPKFTEGPYHAAVEEM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
139 SAVGTSVITITATDADDPVYGNSAKLVYSILEGQPYFSVDPNSATIRIALHGMDREMRED |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
140 YQVVIQAKDMGGHMGGLSGTTTVSITLQDINDNPPKFSKSLYEFVIPEDLPLGKEGGKVK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
141 ANDRDIGENAKSTYSIIEGDDQGVFEIITNATTQEGILQLRKPLDYESKRNYTLKVEATN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
142 IRSEPRSNGPFKDTATVKIVVEDSDEPPVFSKPMYLLEVDENAPINKIIGTVTARDPDAT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
143 GSPIRYFIDRHTDLERQFNINVDNGRITLAKPLDRETDMWHNITVTATEVRNHSQISRAV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
144 VAIRVMDINDNAPEFATEYETFLCENGKPGQVIQTVSAVDKDDPIQGHYFDYRLVPEMLN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
145 NPNFTIKNNQDNSISVLAKHDTFRRQKQEMYFLPIIVTDNGNPPMSSTNTLTIRVCGCSK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
146 DGIVQSCNVEAYVLPIGLSMGALIAILACIILLLVVLFVTLRRHKNEPLIIKDDEDVREN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
147 IIRYDDEGGGEEDTEAFDIATLQNPDGINGYLPRKDIKPDLQFMPRAGQHSGPNGVDVDE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
148 FINVRLHEADNDPTAPPYDSIQIYGYEGRGSIAGSLSSLETASSDSDQNYDYLREWGPRF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
149 RRLGELYSVGESDRET |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
150 >XP_006779767.1 gi|583968626|ref|XP_006779767.1| PREDICTED: T-cell immunomodulatory protein-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
151 MIWTLKLITLAFLLLLGGQYNTFALQDVTADLFGPGNFGTVAAFGDFNSDKQTDIFTIKE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
152 QSDLVIFLADSKPPYFKPKVQAKNILGKDITSVVPGDYDGDSQMDVLLTAKNGPKTEVFI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
153 FWGHNQTLDIGGGIKLNYTFSDQPLVMDFNGDMIPDVFGVISSSSSVVCYLTKRTEVCSK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
154 ALSLTGNMRTPHSNAFIDLDRDFTADLFLTMNNDRMFETWLNKDGNFTKTDVMSKPDETT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
155 LIGQSSFVDFDGDGYQDHLLPACLDTSCQRSTIYLAKSGSRDSKWIPVLSDFKRKETIWG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
156 FVPDNLSQPPALHLGDYNLDGFPDALVVLQNKSGSGQQAFLLENVPCNSETCHSVGRMFH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
157 IHWDQSDLGAIKNAVRATFFDIYEDGILDMLVQSKAEGKQDLRIHALKNNFEADAYFVKV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
158 MVLSGLCSNDCPEGVKPFGVNQPGPYVMYTTVDSNGYLKNASAGQLSQSAYFSLQLPYTV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
159 LGLGRSANFLDHLFVGIPRQPGETEIRNKEWTAIIPNSQLIVMPFPHDTPRSWSAKLYLT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
160 PSNSVLLTAIALIGVCVFILVIIGILHWQEKKADDREKRQEAHRFHFDAM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
161 >XP_006779768.1 gi|583968628|ref|XP_006779768.1| PREDICTED: neuropilin and tolloid-like protein 2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
162 MHRAWVLFFLIEEGFALAQRTKESPSDYGGQRPNQNDCGTWIRNINGGSFTSPNYPNPYP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
163 PNKECVYILEALPRQRIQLSFDKNYYIEPSFECRFDHIEIRDGPFGFSPLIDRFCGGKNP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
164 EIVTSTGRFMWVKFTSDEELEGLGFRIEYTFIADPDFHLHVGGLLNPIPECQFNVGGWDG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
165 IIRSSQVEEEKRVKPGDALDCIWTIKAPSQSKIYLRFIDYQMEHSNECKKNFVAVYDGSS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
166 AIENLKAKFCSTVANDVMLNNDMGVVRMWADEKSRLSRFRMLFTSFIDPPCNDNTFFCHS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
167 NMCINNSLVCNGVQNCVYPWDENHCKEKRSKGLFHQITKTHGTVIGVSSGIVLVLLIISI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
168 LVQMKQPRKKVVARRPGVFNKAGFQEVFDPPHYELFSLRDKEMSSDLADLSEELDSFHKM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
169 RRSSTMSRCVHEHHCGSQGSVATGGGSMKHSRTTLSSMELSYHNDFSKPPPMKTFNSTAS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
170 YKKSCYGYKQHSQTHDCDQQVIEDRVTEETTCEIYGRGATGVGGGAAGGGAMGGGGASGI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
171 AGGAIGGAVGITGGVAMGGGMGGGMSMAGAMSMAGPSGIAGGIGGMGGACGTLSVRGNSA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
172 RNSTTIVDPQQRSMSMDF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
173 >XP_006779769.1 gi|583968630|ref|XP_006779769.1| PREDICTED: dnaJ homolog subfamily A member 2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
174 MSNVVDTKLYDILGVSPSATENELKKAYRKLAKEYHPDKNPNSGDKFKEISFAYEVLTNP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
175 EKKELYDRYGEQGLREGGGGGPGMDDIFSHIFGGGLFGFMGGQSSRSRNGGRRRGEDMVH |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
176 PLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKTGAVQKCTACRGRGMRIMIRQLAPGM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
177 VQQMQSVCTDCNGEGEVISEKDRCKKCEGKKVVKEVKILEVHVDKGMKHGQKITFGGEAD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
178 QAPGVEPGDIVLVLQEKEHETYRRDGNDLFMNHKIGLVEALCGFQFMLKHLDGRQIVVKY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
179 PAGKVIEPGSVRMVRGEGMPQYRNPFEKGDLYIKFDVQFPDNNWISPEKLGELEDMLPSR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
180 SEPPIISGDTEEVDLQDYDVSQSSSSGNRREAYNDSSDEEGSHHGSGVQCAHQ |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
181 >XP_006779770.1 gi|583968632|ref|XP_006779770.1| PREDICTED: low-density lipoprotein receptor-related protein 3-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
182 MGLTELPLLLPLLGLLWLRCALLCAGCSEQVEIHTERRGVIYSPSWPLNYPAGVNCSWHI |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
183 QGGQGEVITISFRNFDLAESGKCTGDWLLLTPTWKRESRLCGSVLPQPFISTRGRVWLFF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
184 HSQANSSGQAQGFRLSYIRGHLGQSSCQSDEFLCGNGKCLPRSWKCNGQDECGDASDERS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
185 CLPTPTEAQPGLCPFGSLPCTEGQSTRCLPTALRCNGARDCHDGSDELGCPDTTCGKRLG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
186 NFYGSFASPDFFRANRSGDTELRCSWLLDTQDPKPIVLQLDLQLGPGDLLHVYDGLLQRA |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
187 EHLLQVFSYHNNRRPALLESSRGQMSVLYMAQPHSPGHGFNATYQVKGYCFPGERPCGSD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
188 QGCYSERQRCDGYWHCPSGRDEEGCPMCPDGEFPCEGGTGMCYPASERCNNQKRCPDGSD |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
189 EKNCYDCQPGNFHCGTNLCIFETWRCDGQEDCLDGSDERDCLAAVPRKVITAALIGSLVC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
190 SLLLVIALGCALKLHSLRNREYRAFETQMTRMEADFVQREAPPSYGQLIAQGLIPPVEDF |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
191 PVYNPTQASVLQNLRLAMRRQIRRHSTRRSTSSSSRRRLGHLWNRLFRSGGRGRGHAPLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
192 DPPGPTQITLGLHSYRTVGEQGPQSRAVPAGGSDVVGVDLPESPASPLSFHSVDSPEEEE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
193 DLSPVSRDGSRAAESSPPTPCQSDSSVQSGLPLSPQEASVPLCPPRASRKLVLELAVNLK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
194 GVSLRRYSPLGPLSPISPPVFPSSSQTPSTQPQPQGSEVTSPTEPLFSSVKPEDSDSQFT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
195 VNVPSRDETKPEARSSLCRFGRSISEEGGDLGRETLC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
196 >XP_006779771.1 gi|583968634|ref|XP_006779771.1| PREDICTED: LOW QUALITY PROTEIN: rhophilin-2-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
197 MTDALLSNGINDGGGDKNYFKKGCNPFAQTGRSKLQNTRASLNQQIIKQMRMRAGAENLL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
198 KATSNSKVKEMVLLELSYVNSNLQLLMSELEGLNSSVEVYQNNQSSTQRILVPVFLNETT |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
199 VEFSILKIXSDFILEHYSEDGKTFEDEIADFMDLRQACRTPSRSEAGVELLGKYYSHLPL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
200 IESRFFSPTRQTGIFFTWYTAFLGLKYQQNHICLIXFCFLFFFLLLFSVKSLMIXITSTN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
201 CSFLALIRFQLVPTALSCPGVLNNLKETFTHTPSYDMSPAMLSMLIRLMLAQAQECLFEK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
202 IALPGIRNQFYSLMKVAQEAAKVSEIYDQVHQCMIQTPVKDNVPFFWSTMSQIKTNHYRS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
203 MAHYFVASALLDHQLGPGDDEDKQEKTLSQVYDSLPEGCTALDILKKKDERQRIGKAHIR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
204 RAIFGHEEALRIYGLCKNTNNLEVLQEILKASHQRSVNKHSENENEEEFADYMEAPKIIS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
205 KTEHKAEMEFPAAAKVKVIDFFQRLGPQSVFSAKQRWTAPRTIRVRSDDRDLGFTLKGDS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
206 PVQVVSLDPLCAAAADGLKEGDYIITVGDTECKWMSVSDVMRLLKDVDEEGIDIQVVSMM |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
207 DNSTAMPTKSATFCGNLPKTYSMICLAYNEDDKNSKVRKVAKKSSFLSWGLKNKMKSAST |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
208 LSLPTADKAGALPWNKPCPTFPSSSSYNNDSGLY |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
209 >XP_006779772.1 gi|583968636|ref|XP_006779772.1| PREDICTED: E3 ubiquitin-protein ligase RNF182-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
210 MKDSAAETSGVEEGESHTLGQEHDLKMSCPQTEFEEKESPPPEELECKICYQRYNVHHRK |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
211 PKILDCLHRVCARCLIKILDIADSAGCISCPFCRHQTEITEQEISALPDDVNIVSHLVMR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
212 DKSWNSDQNREVVLTPKSFSSSSPSHDSSNCLVITIMEVQRDSQHSPSQNGSSDVYAEQS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
213 LDSVSIGSNGPADQDALSKFCNHVPRILVWLLGFLYFGSLPLGIYLLVIQRVTLGIVCVS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
214 LVPSSLTVCLVYGFCQCLCQGMCDCSSRG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
215 >XP_006779773.1 gi|583968638|ref|XP_006779773.1| PREDICTED: centrosomal protein of 89 kDa-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
216 MLRFSFRREKDKEFKHIAHGLIPAASIAPKPAVPRTPPPRSPNPSPERPRSALAAAILSS |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
217 SLTGQTWAIPPARLMSLSESGQSESFTSEPNISTALYTRDRWSEDLVSRPRLSSPDQSEG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
218 ELEDKEQEVVDEEDGEEHVYHTLDRRQNSSLTESVYALPLKAKSVFKSTTPLPTQTSGRR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
219 ESSPDFTEETSGQSPEPKEKKMSVRKTLENWKDDVPTTPTISTAGHPRQASQAKSPKDLR |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
220 ELPPEPSNTYSELRKKVVRDRREKNTRMVDKEKLQEERLQRLEREISDSKAFSNQRSSAG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
221 SQAELQNLRQHAQELVDENDALKLTVHRLNVELSHYQARFRPLSKEEHSKVSGLPNTGSP |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
222 PPWLVDMKYSSPLLLAYEDRMNEKDAILQTTEENMEKLHVQLEEVIKENEKLHDEITKTG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
223 AVNQKDCYQIQQQAVLVLQENQVLINQLEAQHAEAKDTHSRHNTEVAKVSKKMMLLEVEN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
224 QRLEGDLEESRRELQKNKRDLQVLQARLKDAVTWDEHCSIAGKLRRQLEQHESRSKDGID |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
225 KLLLRVSNLQEENRILALDKAQLTAKTRAMEAELELSRQASRKAERRMSMLKQQKAECVL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
226 KEEKTRHYLGAVISVAEHISQERDRLLHMASSLQQEKQRFISRILSGTVRFGKLQEEVKV |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
227 YRSQASTRLAALEEAVEGRTVSYQTEILHLQTLLRERQEAEEKLLQSKREIEEELEVVWE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
228 AATRENQQMRETLLDSKLTGDLHSWPAHAPDEITTSSQQQQHKHGLDFYC |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
229 >XP_006779774.1 gi|583968640|ref|XP_006779774.1| PREDICTED: myocyte-specific enhancer factor 2A-like [Neolamprologus brichardi] |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
230 MGRKKIQITRIVDERNRQVTFMKRKFGLMKKAYELSVLCDCEIALIIFNGSNKLFQYAST |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
231 DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDADASYVLTPNTEEKYKKINE |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
232 EFDNMMKTHKISTGQQQQQHQQHFMHVAPGSMAYSHSGGGGATSQALAAATAALADGGIL |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
233 PSPHSHLHRNINSSQRPPSAGGGLQGSSELALQNGSGPTVNGFGKIIPSKSPPPPPPHGN |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
234 SMVPTSRKTDLRVVIPHSKGMMQTLNNQRMSSSQSSQPLSTPVVSITTPSLPHQSLVYAG |
|
733ca84b21ee
"planemo upload for repository https://github.com/bgruening/galaxytools/tree/master/tools/splitfasta commit 31945d5d8c5ebee64ebf29c6ea022fb831f47274"
rnateam
parents:
diff
changeset
|
235 IGSAYNDYSLNSGELSGFNSAAGPSLSSMAAWEQQQLSSMG |
