Next changeset 1:9cb0534a9829 (2021-12-07) |
Commit message:
"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/megan commit c5facb54a0de925b30cb86f05989e9254d22b89d" |
added:
daa2info.xml macros.xml test-data/13-1941-6_S4_L001_R1_600000.fastq.gz test-data/13-1941-6_S4_L001_R2_600000.fastq.gz test-data/blast_R1.txt test-data/blast_R2.txt test-data/contaminants.txt test-data/daa2info_output1.txt test-data/daa2info_output2.txt test-data/daa2info_output_summary2.txt test-data/input.daa test-data/input_meganized.daa test-data/kegg_output.txt test-data/read_extractor_input.rma6 test-data/read_extractor_output.txt test-data/taxonomy_output.txt |
b |
diff -r 000000000000 -r 2f8df8e575f2 daa2info.xml --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/daa2info.xml Fri Dec 03 23:09:26 2021 +0000 |
[ |
@@ -0,0 +1,143 @@ +<tool id="megan_daa2info" name="MEGAN: Get information" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="@PROFILE@"> + <description>about a DIAMOND file</description> + <macros> + <import>macros.xml</import> + </macros> + <expand macro="bio_tools"/> + <expand macro="requirements"/> + <command detect_errors="exit_code"><![CDATA[ +#set input_identifier = 'input.' + $input.ext.upper() +ln -s '${input}' '${input_identifier}' && + +daa2info +--in '${input_identifier}' +#if str($input_is_meganized_cond.input_is_meganized) == 'yes': + --listMore + #if str($input_is_meganized_cond.list_class2count_cond.list_class2count) == 'yes': + --class2count '$input_is_meganized_cond.list_class2count_cond.class2count' + $input_is_meganized_cond.list_class2count_cond.sum + #end if + #if str($input_is_meganized_cond.list_read2class_cond.list_read2class) == 'yes': + --read2class '$input_is_meganized_cond.list_read2class_cond.read2class' + #end if + $input_is_meganized_cond.names + $input_is_meganized_cond.paths + $input_is_meganized_cond.prefixRank + $input_is_meganized_cond.majorRanksOnly + #if str($input_is_meganized_cond.bo_or_vo) != 'do_not_restrict': + $input_is_meganized_cond.bo_or_vo + #end if + $input_is_meganized_cond.ignoreUnassigned +#else: + --list +#end if +#if $extractSummaryFile: + --extractSummaryFile '$output_summary' +#end if +--out '${output}' +]]></command> + <inputs> + <param name="input" argument="--in" type="data" format="daa" label="Input DIAMOND file"/> + <conditional name="input_is_meganized_cond"> + <param name="input_is_meganized" type="select" checked="false" label="Input is meganized?" help="Implies the input file was produced by the MEGAN: DAA Meganizer tool"> + <option value="no" selected="true">No</option> + <option value="yes">Yes</option> + </param> + <when value="no"/> + <when value="yes"> + <conditional name="list_class2count_cond"> + <param name="list_class2count" type="select" label="List class to count for named classification(s)?"> + <option value="no" selected="true">No</option> + <option value="yes">Yes</option> + </param> + <when value="no"/> + <when value="yes"> + <param argument="--class2count" type="select" label="Select class to count for named classification(s)"> + <expand macro="classification_options"/> + </param> + <param argument="--sum" type="boolean" truevalue="--sum" falsevalue="" checked="false" label="Use summarized rather than assigned counts when listing class to count?"/> + </when> + </conditional> + <conditional name="list_read2class_cond"> + <param name="list_read2class" type="boolean" truevalue="true" falsevalue="false" checked="false" label="List read to class assignments for named classification(s)?"/> + <when value="false"/> + <when value="true"> + <param argument="--read2class" type="select" label="Select read to class assignments for named classification(s)"> + <expand macro="classification_options"/> + </param> + </when> + </conditional> + <param argument="--names" type="boolean" truevalue="--names" falsevalue="" checked="false" label="Report class names rather than class Id numbers?"/> + <param argument="--paths" type="boolean" truevalue="--paths" falsevalue="" checked="false" label="Report class paths rather than class Id numbers?"/> + <param argument="--prefixRank" type="boolean" truevalue="--prefixRank" falsevalue="" checked="false" label="When reporting class paths for taxonomy, prefix single letter to indicate taxonomic rank?"/> + <param argument="--majorRanksOnly" type="boolean" truevalue="--majorRanksOnly" falsevalue="" checked="false" label="Only use major taxonomic ranks?"/> + <param name="bo_or_vo" type="select" label="Restrict reporting to either bacterial reads or viral reads in taxonomic report"> + <option value="do_not_restrict" selected="true">Do not restrict</option> + <option value="--bacteriaOnly" selected="true">Bacterial reads and counts</option> + <option value="--virusOnly">Viral reads and counts</option> + </param> + <param argument="--ignoreUnassigned" type="boolean" truevalue="--ignoreUnassigned" falsevalue="" checked="true" label="Don't report on reads that are unassigned?"/> + </when> + </conditional> + <param argument="--extractSummaryFile" type="boolean" truevalue="--extractSummaryFile" falsevalue="" checked="false" label="Output a MEGAN summary file?" help="Contains all classifications, but no reads or alignments"/> + </inputs> + <outputs> + <data name="output" format="txt"/> + <data name="output_summary" format="txt" label="${tool.name} on ${on_string} (MEGAN summary)"> + <filter>extractSummaryFile</filter> + </data> + </outputs> + <tests> + <test expect_num_outputs="1"> + <param name="input" value="input.daa" ftype="daa"/> + <output name="output" file="daa2info_output1.txt" ftype="txt" compare="contains"/> + </test> + <test expect_num_outputs="1"> + <param name="input" value="input_meganized.daa" ftype="daa"/> + <param name="input_is_meganized" value="yes"/> + <output name="output" file="daa2info_output2.txt" ftype="txt" compare="contains"/> + </test> + <test expect_num_outputs="2"> + <param name="input" value="input_meganized.daa" ftype="daa"/> + <param name="input_is_meganized" value="yes"/> + <param name="bo_or_vo" value="--virusOnly"/> + <param name="extractSummaryFile" value="true"/> + <output name="output" file="daa2info_output2.txt" ftype="txt" compare="contains"/> + <output name="output_summary" file="daa2info_output_summary2.txt" ftype="txt" compare="contains"/> + </test> + </tests> + <help> +**What it does** + +Analyses a DIAMOND (i.e., a Direct Access Archive or DAA) file, a proprietary file format developed by PowerISO Computing +for disk image files, and outputs a text file containing information about the file. The information includes the following. + + * Number of reads + * Alignment mode + * Whether the file is meganized + * Classifications + +If the DIAMOND file is meganized (i.e., it was produced by the MEGAN: DAA Meganizer tool), a summary that includes the +following information (among other items) is included in the output. + + * Content type + * Names + * Uids + * Sizes + * Additional reads + * Algorithm + * Parameters + +If the user elects to output a MEGAN summary file, an additional text file that includes the following information (among +other items) is produced. + + * Creator + * Creation date + * Content type + * Blast mode + * Uids + + </help> + <expand macro="citations"/> +</tool> + |
b |
diff -r 000000000000 -r 2f8df8e575f2 macros.xml --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/macros.xml Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,115 @@ +<macros> + <token name="@TOOL_VERSION@">6.21.7</token> + <token name="@VERSION_SUFFIX@">0</token> + <token name="@PROFILE@">20.09</token> + <xml name="bio_tools"> + <xrefs> + <xref type="bio.tools">megan</xref> + </xrefs> + </xml> + <xml name="requirements"> + <requirements> + <requirement type="package" version="@TOOL_VERSION@">megan</requirement> + </requirements> + </xml> + <macro name="input_type_cond"> + <conditional name="input_type_cond"> + <param name="input_type" type="select" label="Choose the category of the reads files to be analyzed"> + <option value="single" selected="true">Single dataset</option> + <option value="pair">Dataset pair</option> + <option value="paired">List of dataset pairs</option> + </param> + <when value="single"> + <param name="read1" type="data" format="fasta,fasta.gz,fastqsanger.gz,fastqsanger" label="Forward read file" help="This read file should be the one used by Blast to generate the Blast file below"/> + <param name="blast1" type="data" format="daa,blastxml,sam,tabular,txt" label="Output file of Blast on input forward read file"/> + </when> + <when value="pair"> + <param name="read1" type="data" format="fasta,fasta.gz,fastqsanger.gz,fastqsanger" label="Forward read file" help="This read file should be the one used by Blast to generate the Blast file below"/> + <param name="read2" type="data" format="fasta,fasta.gz,fastqsanger.gz,fastqsanger" label="Reverse read file" help="This read file should be the one used by Blast to generate the Blast file below"/> + <param argument="--pairedSuffixLength" type="integer" value="0" label="Length of name suffix used to distinguish read names" help="Use 0 if read and mate have the same name"/> + <param name="blast1" type="data" format="daa,blastxml,sam,tabular,txt" label="Output file of Blast on input forward read file"/> + <param name="blast2" type="data" format="daa,blastxml,sam,tabular,txt" label="Output file of Blast on input reverse read file"/> + </when> + <when value="paired"> + <param name="reads_collection" type="data_collection" format="fasta,fasta.gz,fastqsanger,fastqsanger.gz" collection_type="paired" label="Collection of paired read files"/> + <param argument="--pairedSuffixLength" type="integer" value="0" label="Length of name suffix used to distinguish read names" help="Use 0 if read and mate have the same name"/> + <param name="blast1" type="data" format="daa,blastxml,sam,tabular,txt" label="Blast file for forward read"/> + <param name="blast2" type="data" format="daa,blastxml,sam,tabular,txt" label="Blast file for reverse read"/> + </when> + </conditional> + </macro> + <macro name="long_reads_param"> + <param argument="--longReads" type="boolean" truevalue="--longReads" falsevalue="" checked="false" label="Parse and analyse input reads as long reads?"/> + </macro> + <macro name="classification_options"> + <option value="EC" selected="true">EC</option> + <option value="EGGNOG">EGGNOG</option> + <option value="GTDB">GTDB</option> + <option value="INTERPRO2GO">INTERPRO2GO</option> + <option value="KEGG">KEGG</option> + <option value="SEED">SEED</option> + <option value="Taxonomy">Taxonomy</option> + </macro> + <macro name="blast_mode_options"> + <option value="Unknown" selected="true">Unknown</option> + <option value="BlastN">BlastN</option> + <option value="BlastP">BlastP</option> + <option value="BlastX">BlastX</option> + <option value="Classifier">Classifier</option> + </macro> + <macro name="classify_param"> + <param argument="--classify" type="boolean" truevalue="--classify" falsevalue="" checked="true" label="Run classification algorithm?"/> + </macro> + <macro name="blast_params"> + <param argument="--minScore" type="float" value="50.0" label="Minimum score"/> + <param argument="--maxExpected" type="float" value="0.01" label="Maximum expected"/> + <param argument="--minPercentIdentity" type="float" value="0.0" min="0.0" max="100.0" label="Minimum percent identity"/> + <param argument="--topPercent" type="float" value="10.0" min="0.0" max="100.0" label="Top percent"/> + </macro> + <macro name="min_max_params"> + <param argument="--minSupportPercent" type="float" value="0.05" min="0.0" max="100.0" label="Minimum support as percent of assigned reads" help="0 value ignores"/> + <param argument="--minSupport" type="integer" value="0" label="Minimum support" help="0 value ignores"/> + <param argument="--minPercentReadCover" type="float" value="0.0" min="0.0" max="100.0" label="Minimum percent of read length to be covered by alignments"/> + <param argument="--minPercentReferenceCover" type="float" value="0.0" min="0.0" max="100.0" label="Minimum percent of reference length to be covered by alignments"/> + <param argument="--minReadLength" type="integer" value="0" label="Minimum read length"/> + </macro> + <macro name="lca_params"> + <param argument="--lcaAlgorithm" type="select" label="Select the LCA algorithm to use for taxonomic assignment"> + <option value="naive" selected="true">naive</option> + <option value="weighted">weighted</option> + <option value="longReads">longReads</option> + </param> + <param argument="--lcaCoveragePercent" type="float" value="100.0" min="0.0" max="100.0" label="Percent for the LCA to cover"/> + </macro> + <macro name="read_assignment_mode_param"> + <param argument="--readAssignmentMode" type="select" label="Select the read assignment mode"> + <option value="alignedBases" selected="true">alignedBases</option> + <option value="readCount">readCount</option> + </param> + </macro> + <macro name="con_file_param"> + <param argument="--conFile" type="data" format="txt" optional="true" label="File of contaminant taxa (one id or name per line)" help="Optional, no selection ignores"/> + </macro> + <macro name="mapdb_param"> + <param argument="--mapDB" type="data" format="sqlite" optional="true" label="MEGAN mapping db" help="Optional, no selection ignores"/> + </macro> + <xml name="sanitize_query" token_validinitial="string.printable"> + <sanitizer> + <valid initial="@VALIDINITIAL@"> + <remove value="'" /> + <add value="|" /> + </valid> + <mapping initial="none"> + <add source="'" target="'"'"'" /> + </mapping> + </sanitizer> + </xml> + <xml name="citations"> + <citations> + <citation type="doi">10.1038/nmeth.3176</citation> + <citation type="doi">10.1101/gr.120618.111</citation> + <citation type="doi">10.1101/gr.5969107</citation> + </citations> + </xml> +</macros> + |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/13-1941-6_S4_L001_R1_600000.fastq.gz |
b |
Binary file test-data/13-1941-6_S4_L001_R1_600000.fastq.gz has changed |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/13-1941-6_S4_L001_R2_600000.fastq.gz |
b |
Binary file test-data/13-1941-6_S4_L001_R2_600000.fastq.gz has changed |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/blast_R1.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/blast_R1.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,404 @@ +BLASTN output produced by MALT + + +Query= XXXXXXXXXX:7:1101:1582:1835#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1610:1859#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1743:1871#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1536:1878#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2990:100153#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1624:1906#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1666:1926#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2921:100163#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1513:1929#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2759:100170#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1708:1937#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2981:100211#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1688:1946#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2767:100225#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1536:1959#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2797:100234#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1552:1976#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1748:1978#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2779:100239#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1593:1980#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2946:100242#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1987:1781#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3046:100006#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1900:1788#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3214:100027#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1848:1879#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3237:100032#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3027:100049#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1756:1891#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3238:100065#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1915:1901#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3198:100082#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1964:1931#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3088:100091#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1840:1948#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3105:100094#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1958:1952#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3190:100106#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1993:1999#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3117:100110#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2159:1798#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3147:100111#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2152:1838#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3065:100152#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2180:1843#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3154:100159#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2125:1861#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3198:100173#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2076:1911#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3166:100190#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2196:1920#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3225:100207#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2115:1927#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3019:100219#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2179:1937#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3202:100230#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2149:1945#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3211:100242#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2169:1964#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3168:100244#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3005:100246#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2313:1789#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3253:100014#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2361:1794#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2337:1794#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3284:100039#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2477:1795#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3310:100056#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2355:1821#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3420:100060#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2418:1834#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3267:100061#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2378:1838#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3416:100083#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2481:1853#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3411:100111#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3258:100128#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2252:1856#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3428:100129#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2394:1871#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3387:100138#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2269:1904#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3444:100163#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2259:1943#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3371:100179#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2371:1957#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3311:100186#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2394:1961#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3438:100192#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2333:1962#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3479:100209#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2459:1990#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3417:100210#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2372:1994#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3452:100214#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2677:1830#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3354:100219#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2603:1846#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3600:100019#/1 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2535:1848#/1 + +***** No hits found ****** + +EOF |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/blast_R2.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/blast_R2.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,404 @@ +BLASTN output produced by MALT + + +Query= XXXXXXXXXX:7:1101:1582:1835#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1610:1859#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1743:1871#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1536:1878#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2990:100153#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1624:1906#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1666:1926#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2921:100163#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1513:1929#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2759:100170#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1708:1937#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2981:100211#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1688:1946#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2767:100225#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1536:1959#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2797:100234#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1552:1976#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1748:1978#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2779:100239#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1593:1980#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2946:100242#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1987:1781#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3046:100006#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1900:1788#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3214:100027#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1848:1879#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3237:100032#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3027:100049#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1756:1891#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3238:100065#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1915:1901#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3198:100082#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1964:1931#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3088:100091#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1840:1948#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3105:100094#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1958:1952#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3190:100106#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:1993:1999#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3117:100110#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2159:1798#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3147:100111#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2152:1838#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3065:100152#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2180:1843#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3154:100159#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2125:1861#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3198:100173#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2076:1911#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3166:100190#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2196:1920#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3225:100207#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2115:1927#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3019:100219#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2179:1937#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3202:100230#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2149:1945#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3211:100242#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2169:1964#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3168:100244#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3005:100246#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2313:1789#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3253:100014#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2361:1794#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2337:1794#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3284:100039#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2477:1795#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3310:100056#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2355:1821#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3420:100060#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2418:1834#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3267:100061#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2378:1838#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3416:100083#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2481:1853#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3411:100111#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3258:100128#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2252:1856#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3428:100129#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2394:1871#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3387:100138#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2269:1904#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3444:100163#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2259:1943#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3371:100179#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2371:1957#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3311:100186#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2394:1961#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3438:100192#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2333:1962#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3479:100209#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2459:1990#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3417:100210#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2372:1994#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3452:100214#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2677:1830#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3354:100219#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2603:1846#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:3600:100019#/2 + +***** No hits found ****** + +Query= XXXXXXXXXX:7:1101:2535:1848#/2 + +***** No hits found ****** + +EOF |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/contaminants.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/contaminants.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,12 @@ +Illumina Single End Adapter 1 ACACTCTTTCCCTACACGACGCTGTTCCATCT +Illumina Single End Adapter 2 CAAGCAGAAGACGGCATACGAGCTCTTCCGATCT +Illumina Single End PCR Primer 1 AATGATACGGCGACCACCGAGATCTACACTCTTTCCCTACACGACGCTCTTCCGATCT +Illumina Single End PCR Primer 2 CAAGCAGAAGACGGCATACGAGCTCTTCCGATCT +Illumina Single End Sequencing Primer ACACTCTTTCCCTACACGACGCTCTTCCGATCT + +Illumina Paired End Adapter 1 ACACTCTTTCCCTACACGACGCTCTTCCGATCT +Illumina Paired End Adapter 2 CTCGGCATTCCTGCTGAACCGCTCTTCCGATCT +Illumina Paried End PCR Primer 1 AATGATACGGCGACCACCGAGATCTACACTCTTTCCCTACACGACGCTCTTCCGATCT +Illumina Paired End PCR Primer 2 CAAGCAGAAGACGGCATACGAGATCGGTCTCGGCATTCCTGCTGAACCGCTCTTCCGATCT +Illumina Paried End Sequencing Primer 1 ACACTCTTTCCCTACACGACGCTCTTCCGATCT +Illumina Paired End Sequencing Primer 2 CGGTCTCGGCATTCCTACTGAACCGCTCTTCCGATCT |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/daa2info_output1.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/daa2info_output1.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,3 @@ +# Number of reads: 1 +# Alignment mode: BLASTP +# Is meganized: false |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/daa2info_output2.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/daa2info_output2.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,19 @@ +# Number of reads: 1 +# Alignment mode: BLASTP +# Is meganized: true +# Classifications: Taxonomy +# Meganization summary: +## @Creator DAA2Info +## @CreationDate +## @ContentType Summary4 +## @Names input +## @BlastMode BlastP +## @Uids +## @Sizes 1.0 +## @TotalReads 1 +## @AdditionalReads 0 +## Classifications: +## Taxonomy (1 classes) +## @Algorithm Taxonomy merge +## @Parameters +## |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/daa2info_output_summary2.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/daa2info_output_summary2.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,16 @@ +@Creator DAA2Info +@CreationDate +@ContentType Summary4 +@Names input +@BlastMode BlastP +@Uids +@Sizes 1 +@TotalReads 1 +@AdditionalReads 0 +@Algorithm Taxonomy merge +@Parameters +@ColorTable Fews8 White-Green +TAX -2 1 +END_OF_DATA_TABLE +#SampleID @Source +input.daa input.DAA |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/input.daa |
b |
Binary file test-data/input.daa has changed |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/input_meganized.daa |
b |
Binary file test-data/input_meganized.daa has changed |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/kegg_output.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/kegg_output.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,100 @@ +XXXXXXXXXX:7:1101:1582:1835#/1; ; +XXXXXXXXXX:7:1101:1610:1859#/1; ; +XXXXXXXXXX:7:1101:1743:1871#/1; ; +XXXXXXXXXX:7:1101:1536:1878#/1; ; +XXXXXXXXXX:7:1101:2990:100153#/1; ; +XXXXXXXXXX:7:1101:1624:1906#/1; ; +XXXXXXXXXX:7:1101:1666:1926#/1; ; +XXXXXXXXXX:7:1101:2921:100163#/1; ; +XXXXXXXXXX:7:1101:1513:1929#/1; ; +XXXXXXXXXX:7:1101:2759:100170#/1; ; +XXXXXXXXXX:7:1101:1708:1937#/1; ; +XXXXXXXXXX:7:1101:2981:100211#/1; ; +XXXXXXXXXX:7:1101:1688:1946#/1; ; +XXXXXXXXXX:7:1101:2767:100225#/1; ; +XXXXXXXXXX:7:1101:1536:1959#/1; ; +XXXXXXXXXX:7:1101:2797:100234#/1; ; +XXXXXXXXXX:7:1101:1552:1976#/1; ; +XXXXXXXXXX:7:1101:1748:1978#/1; ; +XXXXXXXXXX:7:1101:2779:100239#/1; ; +XXXXXXXXXX:7:1101:1593:1980#/1; ; +XXXXXXXXXX:7:1101:2946:100242#/1; ; +XXXXXXXXXX:7:1101:1987:1781#/1; ; +XXXXXXXXXX:7:1101:3046:100006#/1; ; +XXXXXXXXXX:7:1101:1900:1788#/1; ; +XXXXXXXXXX:7:1101:3214:100027#/1; ; +XXXXXXXXXX:7:1101:1848:1879#/1; ; +XXXXXXXXXX:7:1101:3237:100032#/1; ; +XXXXXXXXXX:7:1101:3027:100049#/1; ; +XXXXXXXXXX:7:1101:1756:1891#/1; ; +XXXXXXXXXX:7:1101:3238:100065#/1; ; +XXXXXXXXXX:7:1101:1915:1901#/1; ; +XXXXXXXXXX:7:1101:3198:100082#/1; ; +XXXXXXXXXX:7:1101:1964:1931#/1; ; +XXXXXXXXXX:7:1101:3088:100091#/1; ; +XXXXXXXXXX:7:1101:1840:1948#/1; ; +XXXXXXXXXX:7:1101:3105:100094#/1; ; +XXXXXXXXXX:7:1101:1958:1952#/1; ; +XXXXXXXXXX:7:1101:3190:100106#/1; ; +XXXXXXXXXX:7:1101:1993:1999#/1; ; +XXXXXXXXXX:7:1101:3117:100110#/1; ; +XXXXXXXXXX:7:1101:2159:1798#/1; ; +XXXXXXXXXX:7:1101:3147:100111#/1; ; +XXXXXXXXXX:7:1101:2152:1838#/1; ; +XXXXXXXXXX:7:1101:3065:100152#/1; ; +XXXXXXXXXX:7:1101:2180:1843#/1; ; +XXXXXXXXXX:7:1101:3154:100159#/1; ; +XXXXXXXXXX:7:1101:2125:1861#/1; ; +XXXXXXXXXX:7:1101:3198:100173#/1; ; +XXXXXXXXXX:7:1101:2076:1911#/1; ; +XXXXXXXXXX:7:1101:3166:100190#/1; ; +XXXXXXXXXX:7:1101:2196:1920#/1; ; +XXXXXXXXXX:7:1101:3225:100207#/1; ; +XXXXXXXXXX:7:1101:2115:1927#/1; ; +XXXXXXXXXX:7:1101:3019:100219#/1; ; +XXXXXXXXXX:7:1101:2179:1937#/1; ; +XXXXXXXXXX:7:1101:3202:100230#/1; ; +XXXXXXXXXX:7:1101:2149:1945#/1; ; +XXXXXXXXXX:7:1101:3211:100242#/1; ; +XXXXXXXXXX:7:1101:2169:1964#/1; ; +XXXXXXXXXX:7:1101:3168:100244#/1; ; +XXXXXXXXXX:7:1101:3005:100246#/1; ; +XXXXXXXXXX:7:1101:2313:1789#/1; ; +XXXXXXXXXX:7:1101:3253:100014#/1; ; +XXXXXXXXXX:7:1101:2361:1794#/1; ; +XXXXXXXXXX:7:1101:2337:1794#/1; ; +XXXXXXXXXX:7:1101:3284:100039#/1; ; +XXXXXXXXXX:7:1101:2477:1795#/1; ; +XXXXXXXXXX:7:1101:3310:100056#/1; ; +XXXXXXXXXX:7:1101:2355:1821#/1; ; +XXXXXXXXXX:7:1101:3420:100060#/1; ; +XXXXXXXXXX:7:1101:2418:1834#/1; ; +XXXXXXXXXX:7:1101:3267:100061#/1; ; +XXXXXXXXXX:7:1101:2378:1838#/1; ; +XXXXXXXXXX:7:1101:3416:100083#/1; ; +XXXXXXXXXX:7:1101:2481:1853#/1; ; +XXXXXXXXXX:7:1101:3411:100111#/1; ; +XXXXXXXXXX:7:1101:3258:100128#/1; ; +XXXXXXXXXX:7:1101:2252:1856#/1; ; +XXXXXXXXXX:7:1101:3428:100129#/1; ; +XXXXXXXXXX:7:1101:2394:1871#/1; ; +XXXXXXXXXX:7:1101:3387:100138#/1; ; +XXXXXXXXXX:7:1101:2269:1904#/1; ; +XXXXXXXXXX:7:1101:3444:100163#/1; ; +XXXXXXXXXX:7:1101:2259:1943#/1; ; +XXXXXXXXXX:7:1101:3371:100179#/1; ; +XXXXXXXXXX:7:1101:2371:1957#/1; ; +XXXXXXXXXX:7:1101:3311:100186#/1; ; +XXXXXXXXXX:7:1101:2394:1961#/1; ; +XXXXXXXXXX:7:1101:3438:100192#/1; ; +XXXXXXXXXX:7:1101:2333:1962#/1; ; +XXXXXXXXXX:7:1101:3479:100209#/1; ; +XXXXXXXXXX:7:1101:2459:1990#/1; ; +XXXXXXXXXX:7:1101:3417:100210#/1; ; +XXXXXXXXXX:7:1101:2372:1994#/1; ; +XXXXXXXXXX:7:1101:3452:100214#/1; ; +XXXXXXXXXX:7:1101:2677:1830#/1; ; +XXXXXXXXXX:7:1101:3354:100219#/1; ; +XXXXXXXXXX:7:1101:2603:1846#/1; ; +XXXXXXXXXX:7:1101:3600:100019#/1; ; +XXXXXXXXXX:7:1101:2535:1848#/1; ; |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/read_extractor_input.rma6 |
b |
Binary file test-data/read_extractor_input.rma6 has changed |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/read_extractor_output.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/read_extractor_output.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,2 @@ +>sequence +LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLXXXXXXXXXXXXXSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXIENY |
b |
diff -r 000000000000 -r 2f8df8e575f2 test-data/taxonomy_output.txt --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/taxonomy_output.txt Fri Dec 03 23:09:26 2021 +0000 |
b |
@@ -0,0 +1,100 @@ +XXXXXXXXXX:7:1101:1582:1835#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1610:1859#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1743:1871#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1536:1878#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2990:100153#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1624:1906#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1666:1926#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2921:100163#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1513:1929#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2759:100170#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1708:1937#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2981:100211#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1688:1946#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2767:100225#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1536:1959#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2797:100234#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1552:1976#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1748:1978#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2779:100239#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1593:1980#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2946:100242#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1987:1781#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3046:100006#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1900:1788#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3214:100027#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1848:1879#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3237:100032#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3027:100049#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1756:1891#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3238:100065#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1915:1901#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3198:100082#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1964:1931#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3088:100091#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1840:1948#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3105:100094#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1958:1952#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3190:100106#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:1993:1999#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3117:100110#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2159:1798#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3147:100111#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2152:1838#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3065:100152#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2180:1843#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3154:100159#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2125:1861#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3198:100173#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2076:1911#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3166:100190#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2196:1920#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3225:100207#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2115:1927#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3019:100219#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2179:1937#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3202:100230#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2149:1945#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3211:100242#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2169:1964#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3168:100244#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3005:100246#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2313:1789#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3253:100014#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2361:1794#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2337:1794#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3284:100039#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2477:1795#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3310:100056#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2355:1821#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3420:100060#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2418:1834#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3267:100061#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2378:1838#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3416:100083#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2481:1853#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3411:100111#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3258:100128#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2252:1856#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3428:100129#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2394:1871#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3387:100138#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2269:1904#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3444:100163#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2259:1943#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3371:100179#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2371:1957#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3311:100186#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2394:1961#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3438:100192#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2333:1962#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3479:100209#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2459:1990#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3417:100210#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2372:1994#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3452:100214#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2677:1830#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3354:100219#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2603:1846#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:3600:100019#/1; ; No hits; 100; +XXXXXXXXXX:7:1101:2535:1848#/1; ; No hits; 100; |