Previous changeset 1:65620afdf639 (2018-05-24) |
Commit message:
Uploaded |
added:
._interproscan5-e32f2ea6a139 interproscan5-e32f2ea6a139/._.hg_archival.txt interproscan5-e32f2ea6a139/._create_index.py interproscan5-e32f2ea6a139/._interproscan.xml interproscan5-e32f2ea6a139/._readme.rst interproscan5-e32f2ea6a139/._static interproscan5-e32f2ea6a139/._tool_dependencies.xml interproscan5-e32f2ea6a139/create_index.py interproscan5-e32f2ea6a139/interproscan.xml interproscan5-e32f2ea6a139/readme.rst interproscan5-e32f2ea6a139/static/._images interproscan5-e32f2ea6a139/static/images/._P51587.svg.png interproscan5-e32f2ea6a139/static/images/._example_xml_output.png interproscan5-e32f2ea6a139/static/images/P51587.svg.png interproscan5-e32f2ea6a139/static/images/example_xml_output.png interproscan5-e32f2ea6a139/tool_dependencies.xml |
b |
diff -r 65620afdf639 -r 5a720d9e7071 ._interproscan5-e32f2ea6a139 |
b |
Binary file ._interproscan5-e32f2ea6a139 has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._.hg_archival.txt |
b |
Binary file interproscan5-e32f2ea6a139/._.hg_archival.txt has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._create_index.py |
b |
Binary file interproscan5-e32f2ea6a139/._create_index.py has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._interproscan.xml |
b |
Binary file interproscan5-e32f2ea6a139/._interproscan.xml has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._readme.rst |
b |
Binary file interproscan5-e32f2ea6a139/._readme.rst has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._static |
b |
Binary file interproscan5-e32f2ea6a139/._static has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/._tool_dependencies.xml |
b |
Binary file interproscan5-e32f2ea6a139/._tool_dependencies.xml has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/create_index.py --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/interproscan5-e32f2ea6a139/create_index.py Thu May 24 14:39:59 2018 -0400 |
[ |
@@ -0,0 +1,15 @@ +#!/usr/bin/env python + +import os +import sys + +o = open( sys.argv[1], 'w+' ) + + +o.write('<html> <body> <h1> InterProScan result summary page </h1> <ul>' ) + +for filename in [f for f in os.listdir( sys.argv[2] ) if os.path.isfile( os.path.join( sys.argv[2], f) )]: + o.write( '<li><a href="%s"> %s </a></li>' % ( filename, os.path.splitext( filename )[0] ) ) + +o.write( '</ul></body></html>' ) +o.close() |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/interproscan.xml --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/interproscan5-e32f2ea6a139/interproscan.xml Thu May 24 14:39:59 2018 -0400 |
[ |
b'@@ -0,0 +1,268 @@\n+<tool id="interproscan" name="Interproscan functional predictions of ORFs" version="5.0.0">\n+ <description>Interproscan functional predictions of ORFs</description>\n+ <requirements>\n+ <requirement type="package">signalp</requirement>\n+ <requirement type="package">phobius</requirement>\n+ <requirement type="package">tmhmm</requirement>\n+ <requirement type="set_environment">INTERPROSCAN_SCRIPT_PATH</requirement>\n+ </requirements>\n+ <command>\n+\n+ #import os\n+ ./interproscan.sh \n+ ## disables the precalculated lookup service, all calculation will be run locally\n+ -dp \n+ --input $infile \n+ --seqtype $seqtype \n+ -f $oformat \n+ --applications $appl \n+ --tempdir \\$TEMP\n+\n+ $pathways\n+ $goterms\n+ $iprlookup\n+\n+ #if str($oformat) in [\'SVG\', \'HTML\']:\n+ --output-file-base $outfile\n+ 2>&1;\n+ mkdir -p $outfile.files_path;\n+ #set temp_archive_file = str($outfile) + \'.\' + str($oformat).lower() + \'.tar.gz\'\n+ tar -C $outfile.files_path -xvmzf $temp_archive_file;\n+ python \\$INTERPROSCAN_SCRIPT_PATH/create_index.py $outfile $outfile.files_path;\n+ rm $temp_archive_file\n+ #else:\n+ -o $outfile\n+ 2>&1\n+ #end if \n+\n+ </command>\n+ <inputs>\n+ <param name="infile" type="data" format="fasta" label="Protein Fasta File"/>\n+\n+ <param name="seqtype" type="select" label="Type of the input sequences" help="">\n+ <option value="p" selected="true">Protein</option>\n+ <option value="n">DNA / RNA</option>\n+ </param>\n+\n+ <param name="appl" type="select" multiple="True" display="checkboxes" label="Applications to run" help="Select your programm.">\n+ <option value="TIGRFAM" selected="true">TIGRFAM: protein families based on Hidden Markov Models or HMMs</option>\n+ <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a hierarchical order (evolutionary relationships)</option>\n+ <option value="ProDom" selected="true">ProDom: set of protein domain families generated from the UniProtKB</option>\n+ <option value="Panther" selected="true">Panther: Protein ANalysis THrough Evolutionary Relationships</option>\n+ <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on Hidden Markov Models or HMMs</option>\n+ <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional sites as well as associated profiles to identify them</option>\n+ <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional sites as well as associated patterns to identify them</option>\n+ <option value="HAMAP" selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes</option>\n+ <option value="PfamA" selected="true">PfamA: protein families, each represented by multiple sequence alignments and hidden Markov models</option>\n+ <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise a protein family</option>\n+ <option value="SuperFamily" selected="true">SUPERFAMILY: database of structural and functional annotation</option>\n+ <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>\n+ <option value="Gene3d" selected="true">Gene3d: Structural assignment for whole genes and genomes using the CATH domain structure database</option>\n+ <option value="SignalP-GRAM_POSITIVE" selected="false">SignalP Gram Positive Bacteria</option>\n+ '..b'of all the columns and attributes used on [http://www.sequenceontology.org/gff3.shtml].\n+\n+Example Output\n+--------------\n+\n+::\n+\n+ ##gff-version 3\n+ ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269\n+ ##sequence-region AACH01000027 1 1347\n+ ##seqid|source|type|start|end|score|strand|phase|attributes\n+ AACH01000027 provided_by_user nucleic_acid 1 1347 . + . Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027\n+ AACH01000027 getorf ORF 1 1347 . + . Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1 449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347\n+ AACH01000027 getorf polypeptide 1 449 . + . md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347\n+ AACH01000027 Pfam protein_match 84 314 1.2E-45 + . Name=PF00696;signature_desc=Amino acid kinase family;Target=null 84 314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"\n+ ##sequence-region 2\n+ ...\n+ >pep_AACH01000027_1_1347\n+ LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV\n+ LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA\n+ GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI\n+ LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ\n+ ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA\n+ TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV\n+ DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML\n+ RSQKAKGVLIYRDDWISITPEIQLLFTEF\n+ ...\n+ >match$8_84_314\n+ KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK\n+ RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL\n+ LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR\n+ AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS\n+ \n+\n+Scalable Vector Graphics (SVG) and HyperText Markup Language (HTML)\n+====================================================================\n+\n+InterProScan_ 5 outputs a single HTML/SVG file for each protein sequence analysed. \n+\n+\n+Example Output\n+--------------\n+\n+.. image:: $PATH_TO_IMAGES/P51587.svg.png\n+\n+.. _InterProScan: http://www.ebi.ac.uk/interpro\n+\n+\n+----------\n+References\n+----------\n+\n+\n+If you use this Galaxy tool in work leading to a scientific publication please\n+cite the following papers:\n+\n+Peter J.A. Cock, Bj\xc3\xb6rn A. Gr\xc3\xbcning, Konrad Paszkiewicz and Leighton Pritchard (2013).\n+Galaxy tools and workflows for sequence analysis with applications\n+in molecular plant pathology. PeerJ 1:e167\n+http://dx.doi.org/10.7717/peerj.167\n+\n+Zdobnov EM, Apweiler R (2001)\n+InterProScan an integration platform for the signature-recognition methods in InterPro.\n+Bioinformatics 17, 847-848.\n+http://dx.doi.org/10.1093/bioinformatics/17.9.847\n+\n+Quevillon E, Silventoinen V, Pillai S, Harte N, Mulder N, Apweiler R, Lopez R (2005)\n+InterProScan: protein domains identifier.\n+Nucleic Acids Research 33 (Web Server issue), W116-W120.\n+http://dx.doi.org/10.1093/nar/gki442\n+\n+Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, McAnulla C, McDowall J, Mistry J, Mitchell A, Mulder N, Natale D, Orengo C, Quinn AF, Selengut JD, Sigrist CJ, Thimma M, Thomas PD, Valentin F, Wilson D, Wu CH, Yeats C. (2009)\n+InterPro: the integrative protein signature database.\n+Nucleic Acids Research 37 (Database Issue), D224-228.\n+http://dx.doi.org/10.1093/nar/gkn785\n+\n+\n+This wrapper is available to install into other Galaxy Instances via the Galaxy Tool Shed at\n+http://toolshed.g2.bx.psu.edu/view/bgruening/interproscan5\n+\n+\n+**Galaxy Wrapper Author**::\n+\n+ * Bjoern Gruening, University of Freiburg\n+ * Konrad Paszkiewicz, University of Exeter\n+\n+ </help>\n+</tool>\n' |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/readme.rst --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/interproscan5-e32f2ea6a139/readme.rst Thu May 24 14:39:59 2018 -0400 |
b |
@@ -0,0 +1,83 @@ +================================================== +Galaxy wrapper for InterProScan 5 prediction tools +================================================== + +InterProScan is a tool that combines different protein signature recognition methods native to the InterPro +member databases into one resource with look up of corresponding InterPro and GO annotation. + +This wrapper is copyright 2013 by: + * Bjoern Gruening + * Konrad Paszkiewicz + + +This prepository contains a wrapper for the InterProScan_ command line tool. + +.. _InterProScan: http://www.ebi.ac.uk/interpro/interproscan.html + + +Quevillon E., Silventoinen V., Pillai S., Harte N., Mulder N., Apweiler R., Lopez R. (2005). InterProScan: protein domains identifier. Nucleic Acids Res. 33 (Web Server issue): W116-W120 + + +============ +Installation +============ + +Please download install InterProScan according to: + +https://code.google.com/p/interproscan/wiki/HowToDownload + + +======== +Citation +======== + +If you use this Galaxy tool in work leading to a scientific +publication, in addition to citing the invididual underlying tools, please cite: + +Peter Cock, Bjoern Gruening, Konrad Paszkiewicz and Leighton Pritchard (2013). +Galaxy tools and workflows for sequence analysis with applications +in molecular plant pathology. PeerJ 1:e167 +http://dx.doi.org/10.7717/peerj.167 + +Full reference information is included in the help text. + + +============= +Input formats +============= + +The standard interproscan input is either genomic or protein sequences. +In the case of genomic sequences Interproscan will run an ORF prediction tool. + + +======= +History +======= + +interproscan: + + - v5.0: Initial public release of version 5.0 + + +============= +Licence (MIT) +============= + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in +all copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +THE SOFTWARE. + |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/static/._images |
b |
Binary file interproscan5-e32f2ea6a139/static/._images has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/static/images/._P51587.svg.png |
b |
Binary file interproscan5-e32f2ea6a139/static/images/._P51587.svg.png has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/static/images/._example_xml_output.png |
b |
Binary file interproscan5-e32f2ea6a139/static/images/._example_xml_output.png has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/static/images/P51587.svg.png |
b |
Binary file interproscan5-e32f2ea6a139/static/images/P51587.svg.png has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/static/images/example_xml_output.png |
b |
Binary file interproscan5-e32f2ea6a139/static/images/example_xml_output.png has changed |
b |
diff -r 65620afdf639 -r 5a720d9e7071 interproscan5-e32f2ea6a139/tool_dependencies.xml --- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/interproscan5-e32f2ea6a139/tool_dependencies.xml Thu May 24 14:39:59 2018 -0400 |
b |
@@ -0,0 +1,9 @@ +<?xml version="1.0"?> +<tool_dependency> + <set_environment version="1.0"> + <environment_variable name="INTERPROSCAN_SCRIPT_PATH" action="set_to">$REPOSITORY_INSTALL_DIR</environment_variable> + </set_environment> +</tool_dependency> + + + |