annotate interproscan.xml @ 11:98cafcbd2578 draft default tip

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit c8c7a5c3fa0560d6bc6bbb45cfbff12621ab2f43"
author iuc
date Fri, 29 Apr 2022 20:14:21 +0000
parents c55643c3d813
children
Ignore whitespace changes - Everywhere: Within whitespace: At end of lines:
rev   line source
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
1 <tool id="interproscan" name="InterProScan" version="@TOOL_VERSION@+galaxy@VERSION_SUFFIX@" profile="20.09">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
2 <description>functional annotation</description>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
3 <macros>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
4 <import>macros.xml</import>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
5 </macros>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
6 <xrefs>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
7 <xref type="bio.tools">interproscan_4</xref>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
8 </xrefs>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
9 <requirements>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
10 <requirement type="package" version="@TOOL_VERSION@">interproscan</requirement>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
11 </requirements>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
12 <version_command>interproscan.sh --version</version_command>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
13 <command><![CDATA[
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
14 ## Adapt properties file to use data from data table
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
15 mkdir -p \$HOME/.interproscan-5
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
16 &&
5
2e1cf7d85dbc "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 8308746e12723b6a9e56f2ec524070673d74d6cc"
iuc
parents: 4
diff changeset
17 sed 's|^\(data.directory=\).*$|\1${database.fields.path}/data|' \$(dirname \$(readlink -f \$(command -v interproscan.sh)))/interproscan.properties > \$HOME/.interproscan-5/interproscan.properties
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
18 &&
9
c55643c3d813 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 38c5ce62205ebeda50bedd83dd55737aef339468"
iuc
parents: 7
diff changeset
19 ## Java doesn't read the HOME env var
c55643c3d813 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 38c5ce62205ebeda50bedd83dd55737aef339468"
iuc
parents: 7
diff changeset
20 export _JAVA_OPTIONS=-Duser.home=\$HOME
c55643c3d813 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 38c5ce62205ebeda50bedd83dd55737aef339468"
iuc
parents: 7
diff changeset
21 &&
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
22
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
23 ## Now run interproscan
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
24 interproscan.sh
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
25
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
26 ## disables the precalculated lookup service, all calculation will be run locally
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
27 -dp
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
28 --input '$input'
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
29 --seqtype $seqtype
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
30 -f ${','.join($oformat)}
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
31
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
32 #if $licensed.use == 'true' and $licensed.applications_licensed:
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
33 --applications ${','.join($applications)},${','.join($licensed.applications_licensed)}
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
34 #else:
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
35 --applications ${','.join($applications)}
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
36 #end if
9
c55643c3d813 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 38c5ce62205ebeda50bedd83dd55737aef339468"
iuc
parents: 7
diff changeset
37 --tempdir \${TEMP:-\$_GALAXY_JOB_TMP_DIR}
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
38
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
39 $pathways
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
40 $goterms
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
41 $iprlookup
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
42
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
43 --cpu \${GALAXY_SLOTS:-4}
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
44
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
45 --output-file-base 'output'
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
46 ]]></command>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
47 <inputs>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
48 <param argument="--input" type="data" format="fasta" label="Protein FASTA File"/>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
49
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
50 <param argument="--seqtype" type="select" label="Type of the input sequences" help="">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
51 <option value="p" selected="true">Protein</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
52 <option value="n">DNA / RNA</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
53 </param>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
54
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
55 <param name="database" label="InterProScan database" type="select">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
56 <options from_data_table="interproscan">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
57 <column name="value" index="0" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
58 <column name="name" index="1" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
59 <column name="path" index="3" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
60 <filter type="sort_by" column="0" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
61 <filter type="static_value" column="2" value="@TOOL_VERSION@" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
62 </options>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
63 </param>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
64
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
65 <param name="applications" type="select" multiple="True" label="Applications to run" help="Select your program">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
66 <option value="TIGRFAM" selected="true">TIGRFAM: protein families based on hidden Markov models (HMMs)</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
67 <option value="SFLD" selected="true">SFLD: a database of protein families based on hidden Markov models (HMMs)</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
68 <option value="SUPERFAMILY" selected="true">SUPERFAMILY: database of structural and functional annotation for all proteins and genomes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
69 <option value="PANTHER" selected="true">PANTHER: Protein ANalysis THrough Evolutionary Relationships</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
70 <option value="Gene3D" selected="true">Gene3d: Structural assignment for whole genes and genomes using the CATH domain structure database</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
71 <option value="Hamap" selected="true">HAMAP: High-quality Automated Annotation of Microbial Proteomes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
72 <option value="PrositeProfiles" selected="true">PROSITE Profiles: protein domains, families and functional sites as well as associated profiles to identify them</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
73 <option value="Coils" selected="true">Coils: Prediction of Coiled Coil Regions in Proteins</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
74 <option value="SMART" selected="true">SMART: identification and analysis of domain architectures based on Hidden Markov Models or HMMs</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
75 <option value="CDD" selected="true">SMART: protein domains and families based on well-annotated multiple sequence alignment models</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
76 <option value="PRINTS" selected="true">PRINTS: group of conserved motifs (fingerprints) used to characterise a protein family</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
77 <option value="PIRSR" selected="true">PIRSR: protein families based on hidden Markov models (HMMs) and Site Rules</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
78 <option value="PrositePatterns" selected="true">PROSITE Pattern: protein domains, families and functional sites as well as associated patterns to identify them</option>
11
98cafcbd2578 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit c8c7a5c3fa0560d6bc6bbb45cfbff12621ab2f43"
iuc
parents: 9
diff changeset
79 <option value="AntiFam" selected="true">AntiFam: a resource of profile-HMMs designed to identify spurious protein predictions.</option>
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
80 <option value="Pfam" selected="true">Pfam: protein families, each represented by multiple sequence alignments and hidden Markov models</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
81 <option value="MobiDBLite" selected="true">MobiDBLite: Prediction of intrinsically disordered regions in proteins</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
82 <option value="PIRSF" selected="true">PIRSF: non-overlapping clustering of UniProtKB sequences into a hierarchical order (evolutionary relationships)</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
83 </param>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
84
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
85 <conditional name="licensed">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
86 <param name="use" type="select" label="Use applications with restricted license, only for non-commercial use?" help="The corresponding tools must be installed manually by the administrator of this Galaxy instance" >
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
87 <option value="false" selected="true">No</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
88 <option value="true">Yes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
89 </param>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
90 <when value="false" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
91 <when value="true">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
92 <param name="applications_licensed" type="select" multiple="True" label="Applications to run" help="Select your programm.">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
93 <option value="Phobius" selected="true">Phobius: combined transmembrane topology and signal peptide predictor</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
94 <option value="SignalP_GRAM_NEGATIVE" selected="false">SignalP (gram-negative): signal peptide cleavage sites in amino acid sequences for gram-negative prokaryotes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
95 <option value="SignalP_EUK" selected="true">SignalP (eukaryotes): signal peptide cleavage sites in amino acid sequences for eukaryotes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
96 <option value="SignalP_GRAM_POSITIVE" selected="false">SignalP (Gram Positive Bacteria): signal peptide cleavage sites in amino acid sequences for gram-positive prokaryotes</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
97 <option value="TMHMM" selected="true">TMHMM: Prediction of transmembrane helices in proteins</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
98 </param>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
99 </when>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
100 </conditional>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
101
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
102 <param argument="--pathways" truevalue="--pathways" falsevalue="" checked="True" type="boolean" label="Include pathway information"
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
103 help="Option that provides mappings from matches to pathway information, which is based on the matched manually curated InterPro entries."/>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
104 <param argument="--goterms" truevalue="--goterms" falsevalue="" checked="True" type="boolean" label="Include Gene Ontology (GO) mappings"
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
105 help="Look up of corresponding Gene Ontology annotation. Implies -iprlookup option."/>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
106 <param argument="--iprlookup" truevalue="--iprlookup" falsevalue="" checked="False" type="boolean"
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
107 label="Provide additional mappings" help="Provide mappings from matched member database signatures to the InterPro entries that they are integrated into"/>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
108
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
109 <param name="oformat" type="select" multiple="true" label="Output format" help="Please select a output format (JSON output can be visualised on https://www.ebi.ac.uk/interpro/result/InterProScan/).">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
110 <option value="TSV" selected="true">Tab-separated values format (TSV)</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
111 <option value="GFF3">GFF3</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
112 <option value="XML">XML</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
113 <option value="JSON">JSON</option>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
114 </param>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
115 </inputs>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
116
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
117 <outputs>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
118 <data format="tabular" name="outfile_tsv" from_work_dir="output.tsv" label="InterProScan on ${on_string} (tsv)">
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
119 <filter>oformat and 'TSV' in oformat</filter>
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
120 </data>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
121 <data format="xml" name="outfile_xml" from_work_dir="output.xml" label="InterProScan on ${on_string} (xml)">
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
122 <filter>oformat and 'XML' in oformat</filter>
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
123 </data>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
124 <data format="gff3" name="outfile_gff3" from_work_dir="output.gff3" label="InterProScan on ${on_string} (gff3)">
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
125 <filter>oformat and 'GFF3' in oformat</filter>
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
126 </data>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
127 <data format="json" name="outfile_json" from_work_dir="output.json" label="InterProScan on ${on_string} (json)">
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
128 <filter>oformat and 'JSON' in oformat</filter>
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
129 </data>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
130 </outputs>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
131
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
132 <tests>
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
133 <test expect_num_outputs="1">
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
134 <param name="input" value="prots.fa" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
135 <param name="seqtype" value="p" />
7
1207025b9b9c "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 3e5aef1ff8f33003ae2314b8df52c4f4187c37ef"
iuc
parents: 6
diff changeset
136 <param name="database" value="@TOOL_VERSION@" />
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
137 <param name="applications" value="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
138 <param name="oformat" value="TSV" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
139 <output name="outfile_tsv">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
140 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
141 <has_text text="FUN_000011-T1" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
142 <has_text text="ea9924e11f7decc417e8d9ed8b9c682e" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
143 <has_text text="FUN_000012-T1" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
144 <has_text text="01beedc2fbf8012cba37f0c0d39aa071" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
145 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
146 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
147 </test>
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
148 <test expect_num_outputs="4">
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
149 <param name="input" value="prots.fa" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
150 <param name="seqtype" value="p" />
7
1207025b9b9c "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 3e5aef1ff8f33003ae2314b8df52c4f4187c37ef"
iuc
parents: 6
diff changeset
151 <param name="database" value="@TOOL_VERSION@" />
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
152 <param name="applications" value="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
153 <param name="oformat" value="TSV,GFF3,XML,JSON" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
154 <output name="outfile_tsv">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
155 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
156 <has_text text="FUN_000011-T1" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
157 <has_text text="ea9924e11f7decc417e8d9ed8b9c682e" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
158 <has_text text="FUN_000012-T1" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
159 <has_text text="01beedc2fbf8012cba37f0c0d39aa071" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
160 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
161 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
162 <output name="outfile_xml">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
163 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
164 <has_text text="mobidblite-location" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
165 <has_text text="Polyampholyte" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
166 <has_text text="consensus disorder prediction" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
167 <has_text text="FUN_000011-T1 FUN_000011" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
168 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
169 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
170 <output name="outfile_gff3">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
171 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
172 <has_text text="protein_match" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
173 <has_text text="ID=FUN_000011-T1;md5=" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
174 <has_text text="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
175 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
176 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
177 <output name="outfile_json">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
178 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
179 <has_text text="signatureLibraryRelease" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
180 <has_text text="disorder_prediction" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
181 <has_text text="Polyampholyte" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
182 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
183 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
184 </test>
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
185 <test expect_num_outputs="4">
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
186 <param name="input" value="transcripts.fa" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
187 <param name="seqtype" value="n" />
7
1207025b9b9c "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 3e5aef1ff8f33003ae2314b8df52c4f4187c37ef"
iuc
parents: 6
diff changeset
188 <param name="database" value="@TOOL_VERSION@" />
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
189 <param name="applications" value="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
190 <param name="oformat" value="TSV,GFF3,XML,JSON" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
191 <output name="outfile_tsv">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
192 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
193 <has_text text="FUN_000018-T1_orf336" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
194 <has_text text="0b28fe115d4cc09260b038b19fb0b21d" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
195 <has_text text="FUN_000012-T1_orf133" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
196 <has_text text="01beedc2fbf8012cba37f0c0d39aa071" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
197 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
198 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
199 <output name="outfile_xml">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
200 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
201 <has_text text="mobidblite-location" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
202 <has_text text="Polyampholyte" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
203 <has_text text="consensus disorder prediction" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
204 <has_text text="orf355" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
205 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
206 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
207 <output name="outfile_gff3">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
208 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
209 <has_text text="protein_match" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
210 <has_text text="ID=FUN_000012-T1;" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
211 <has_text text="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
212 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
213 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
214 <output name="outfile_json">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
215 <assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
216 <has_text text="signatureLibraryRelease" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
217 <has_text text="disorder_prediction" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
218 <has_text text="Polyampholyte" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
219 </assert_contents>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
220 </output>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
221 </test>
6
0cd163d805e3 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 959550b5431b15acf3609f536efc864fd0845b3c"
iuc
parents: 5
diff changeset
222 <test expect_failure="true" expect_num_outputs="1">
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
223 <param name="input" value="prots.fa" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
224 <param name="seqtype" value="p" />
7
1207025b9b9c "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 3e5aef1ff8f33003ae2314b8df52c4f4187c37ef"
iuc
parents: 6
diff changeset
225 <param name="database" value="@TOOL_VERSION@" />
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
226 <param name="applications" value="MobiDBLite" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
227 <conditional name="licensed">
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
228 <param name="use" value="true" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
229 <param name="applications_licensed" value="Phobius,TMHMM" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
230 </conditional>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
231 <param name="oformat" value="TSV" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
232 <assert_stdout>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
233 <!-- expected to be "deactivated" as they are not installed by default -->
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
234 <has_text text="Analysis Phobius does not exist or is deactivated" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
235 <has_text text="Analysis TMHMM does not exist or is deactivated" />
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
236 </assert_stdout>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
237 </test>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
238 </tests>
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
239
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
240 <help><![CDATA[
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
241
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
242 **What it does**
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
243
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
244 Interproscan is a batch tool to query the InterPro database. It provides annotations based on multiple searches of profile and other functional databases.
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
245
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
246 Phobius (licensed software), SignalP, SMART (licensed components) and TMHMM use
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
247 licensed code and data provided by third parties. If you wish to run these
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
248 analyses it will be necessary for you to obtain a licence from the vendor and
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
249 configure the Galaxy server InterProScan installation to use them.
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
250
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
251 **Input**
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
252
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
253 Required is a FASTA file containing protein or nucleotide sequences.
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
254
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
255 **Output**
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
256
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
257 In this version of InterProScan, you can retrieve output in any of the following five formats:
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
258
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
259 * TSV: tab-separated values format
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
260 * XML: XML format
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
261 * GFF: The GFF 3.0 format
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
262 * JSON: A JSON representation of the protein matches that can be visualised on https://www.ebi.ac.uk/interpro/result/InterProScan/
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
263
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
264 **Example Output**
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
265
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
266
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
267 ::
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
268
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
269 P51587 14086411a2cdf1c4cba63020e1622579 3418 Pfam PF09103 BRCA2, oligonucleotide/oligosaccharide-binding, domain 1 2670 2799 7.9E-43 T 15-03-2013
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
270 P51587 14086411a2cdf1c4cba63020e1622579 3418 ProSiteProfiles PS50138 BRCA2 repeat profile. 1002 1036 0.0 T 18-03-2013 IPR002093 BRCA2 repeat GO:0005515|GO:0006302
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
271 P51587 14086411a2cdf1c4cba63020e1622579 3418 Gene3D G3DSA:2.40.50.140 2966 3051 3.1E-52 T 15-03-2013
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
272 ...
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
273
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
274
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
275 The TSV format presents the match data in columns as follows:
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
276
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
277 - Protein Accession (e.g. P51587)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
278 - Sequence MD5 digest (e.g. 14086411a2cdf1c4cba63020e1622579)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
279 - Sequence Length (e.g. 3418)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
280 - Analysis (e.g. Pfam / PRINTS / Gene3D)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
281 - Signature Accession (e.g. PF09103 / G3DSA:2.40.50.140)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
282 - Signature Description (e.g. BRCA2 repeat profile)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
283 - Start location
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
284 - Stop location
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
285 - Score - is the e-value of the match reported by member database method (e.g. 3.1E-52)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
286 - Status - is the status of the match (T: true)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
287 - Date - is the date of the run
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
288 - (InterProScan annotations - accession (e.g. IPR002093) - optional column; only displayed if -iprscan option is switched on)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
289 - (InterProScan annotations - description (e.g. BRCA2 repeat) - optional column; only displayed if -iprscan option is switched on)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
290 - (GO annotations (e.g. GO:0005515) - optional column; only displayed if --goterms option is switched on)
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
291 - (Pathways annotations (e.g. REACT_71) - optional column; only displayed if --pathways option is switched on)
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
292
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
293
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
294 **Extensible Markup Language (XML)**
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
295
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
296 XML representation of the matches - this is the richest form of the data. The XML Schema Definition (XSD) is available [http://www.ebi.ac.uk/interpro/resources/schemas/interproscan5 here].
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
297
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
298 **Generic Feature Format Version 3 (GFF3)**
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
299
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
300 The GFF3 format is a flat tab-delimited file, which is much richer then the TSV output format. It allows you to trace back from matches to predicted proteins and to nucleic acid sequences. It also contains a FASTA format representation of the predicted protein sequences and their matches. You will find a documentation of all the columns and attributes used on [https://github.com/The-Sequence-Ontology/Specifications/blob/master/gff3.md].
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
301
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
302 **Example Output**
1
eb12db502d3c updated tool help
bgruening
parents: 0
diff changeset
303
eb12db502d3c updated tool help
bgruening
parents: 0
diff changeset
304
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
305 ::
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
306
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
307 ##gff-version 3
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
308 ##feature-ontology http://song.cvs.sourceforge.net/viewvc/song/ontology/sofa.obo?revision=1.269
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
309 ##sequence-region AACH01000027 1 1347
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
310 ##seqid|source|type|start|end|score|strand|phase|attributes
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
311 AACH01000027 provided_by_user nucleic_acid 1 1347 . + . Name=AACH01000027;md5=b2a7416cb92565c004becb7510f46840;ID=AACH01000027
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
312 AACH01000027 getorf ORF 1 1347 . + . Name=AACH01000027.2_21;Target=pep_AACH01000027_1_1347 1 449;md5=b2a7416cb92565c004becb7510f46840;ID=orf_AACH01000027_1_1347
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
313 AACH01000027 getorf polypeptide 1 449 . + . md5=fd0743a673ac69fb6e5c67a48f264dd5;ID=pep_AACH01000027_1_1347
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
314 AACH01000027 Pfam protein_match 84 314 1.2E-45 + . Name=PF00696;signature_desc=Amino acid kinase family;Target=null 84 314;status=T;ID=match$8_84_314;Ontology_term="GO:0008652";date=15-04-2013;Dbxref="InterPro:IPR001048","Reactome:REACT_13"
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
315 ##sequence-region 2
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
316 ...
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
317 >pep_AACH01000027_1_1347
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
318 LVLLAAFDCIDDTKLVKQIIISEIINSLPNIVNDKYGRKVLLYLLSPRDPAHTVREIIEV
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
319 LQKGDGNAHSKKDTEIRRREMKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEA
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
320 GHELILVSSGAIAAGFGALGFKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQI
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
321 LLTQDDFVDKRRYKNAHQALSVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQ
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
322 ADLLVFLTDVDGLYTGNPNSDPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAA
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
323 TIATESGVPVYICSSLKSDSMIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWV
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
324 DKGAAEALSQYGKSLLLSGIVEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDML
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
325 RSQKAKGVLIYRDDWISITPEIQLLFTEF
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
326 ...
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
327 >match$8_84_314
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
328 KRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALGFKK
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
329 RPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQALSVL
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
330 LNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNSDPR
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
331 AKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICS
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
332
4
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
333 ]]></help>
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
334
fcedfe919603 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/interproscan commit 2f5d27a375fcc2e8d77914b3d9e402a9e2df2d97"
iuc
parents: 2
diff changeset
335 <expand macro="citations" />
0
c10e37cca7e3 Uploaded
bgruening
parents:
diff changeset
336 </tool>