Mercurial > repos > cpt > cpt_find_spanins
annotate spaninFuncs.py @ 3:fd70980a516b draft
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
| author | cpt |
|---|---|
| date | Mon, 05 Jun 2023 02:42:01 +0000 |
| parents | |
| children | 46b252c89e9e |
| rev | line source |
|---|---|
|
3
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
1 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
2 PREMISE |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
3 ### Functions/Classes that are used in both generate-putative-osp.py and generate-putative-isp.py |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
4 ###### Main premise here is to make the above scripts a little more DRY, as well as easily readable for execution. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
5 ###### Documentation will ATTEMPT to be thourough here |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
6 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
7 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
8 import re |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
9 from Bio import SeqIO |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
10 from Bio import Seq |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
11 from collections import OrderedDict |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
12 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
13 # Not written in OOP for a LITTLE bit of trying to keep the complication down in case adjustments are needed by someone else. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
14 # Much of the manipulation is string based; so it should be straightforward as well as moderately quick |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
15 ################## GLobal Variables |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
16 Lys = "K" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
17 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
18 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
19 def check_back_end_snorkels(seq, tmsize): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
20 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
21 Searches through the backend of a potential TMD snorkel. This is the 2nd part of a TMD snorkel lysine match. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
22 --> seq : should be the sequence fed from the "search_region" portion of the sequence |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
23 --> tmsize : size of the potential TMD being investigated |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
24 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
25 found = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
26 if seq[tmsize - 4] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 5]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
27 found = "match" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
28 return found |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
29 elif seq[tmsize - 3] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 4]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
30 found = "match" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
31 return found |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
32 elif seq[tmsize - 2] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 3]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
33 found = "match" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
34 return found |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
35 elif seq[tmsize - 1] == Lys and re.search(("[FIWLVMYCATGS]"), seq[tmsize - 2]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
36 found = "match" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
37 return found |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
38 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
39 found = "NOTmatch" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
40 return found |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
41 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
42 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
43 def prep_a_gff3(fa, spanin_type, org): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
44 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
45 Function parses an input detailed 'fa' file and outputs a 'gff3' file |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
46 ---> fa = input .fa file |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
47 ---> output = output a returned list of data, easily portable to a gff3 next |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
48 ---> spanin_type = 'isp' or 'osp' |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
49 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
50 with org as f: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
51 header = f.readline() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
52 orgacc = header.split(" ") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
53 orgacc = orgacc[0].split(">")[1].strip() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
54 fa_zip = tuple_fasta(fa) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
55 data = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
56 for a_pair in fa_zip: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
57 # print(a_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
58 if re.search(("(\[1\])"), a_pair[0]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
59 strand = "+" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
60 elif re.search(("(\[-1\])"), a_pair[0]): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
61 strand = "-" # column 7 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
62 start = re.search(("[\d]+\.\."), a_pair[0]).group(0).split("..")[0] # column 4 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
63 end = re.search(("\.\.[\d]+"), a_pair[0]).group(0).split("..")[1] # column 5 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
64 orfid = re.search(("(ORF)[\d]+"), a_pair[0]).group(0) # column 1 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
65 if spanin_type == "isp": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
66 methodtype = "CDS" # column 3 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
67 spanin = "isp" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
68 elif spanin_type == "osp": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
69 methodtype = "CDS" # column 3 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
70 spanin = "osp" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
71 elif spanin_type == "usp": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
72 methodtype = "CDS" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
73 spanin = "usp" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
74 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
75 raise "need to input spanin type" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
76 source = "cpt.py|putative-*.py" # column 2 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
77 score = "." # column 6 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
78 phase = "." # column 8 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
79 attributes = ( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
80 "ID=" + orgacc + "|" + orfid + ";ALIAS=" + spanin + ";SEQ=" + a_pair[1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
81 ) # column 9 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
82 sequence = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
83 [orgacc, source, methodtype, start, end, score, strand, phase, attributes] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
84 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
85 data += sequence |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
86 return data |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
87 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
88 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
89 def write_gff3(data, output="results.gff3"): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
90 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
91 Parses results from prep_a_gff3 into a gff3 file |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
92 ---> input : list from prep_a_gff3 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
93 ---> output : gff3 file |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
94 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
95 data = data |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
96 filename = output |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
97 with filename as f: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
98 f.write("#gff-version 3\n") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
99 for value in data: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
100 f.write( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
101 "{}\t{}\t{}\t{}\t{}\t{}\t{}\t{}\t{}\n".format( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
102 value[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
103 value[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
104 value[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
105 value[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
106 value[4], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
107 value[5], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
108 value[6], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
109 value[7], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
110 value[8], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
111 ) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
112 ) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
113 f.close() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
114 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
115 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
116 def find_tmd( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
117 pair, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
118 minimum=10, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
119 maximum=30, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
120 TMDmin=10, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
121 TMDmax=20, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
122 isp_mode=False, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
123 peri_min=18, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
124 peri_max=206, |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
125 ): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
126 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
127 Function that searches for lysine snorkels and then for a spanning hydrophobic region that indicates a potential TMD |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
128 ---> pair : Input of tuple with description and AA sequence (str) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
129 ---> minimum : How close from the initial start codon a TMD can be within |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
130 ---> maximum : How far from the initial start codon a TMD can be within |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
131 ---> TMDmin : The minimum size that a transmembrane can be (default = 10) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
132 ---> TMDmax : The maximum size tha ta transmembrane can be (default = 20) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
133 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
134 # hydrophobicAAs = ['P', 'F', 'I', 'W', 'L', 'V', 'M', 'Y', 'C', 'A', 'T', 'G', 'S'] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
135 tmd = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
136 s = str(pair[1]) # sequence being analyzed |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
137 # print(s) # for trouble shooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
138 if maximum > len(s): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
139 maximum = len(s) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
140 search_region = s[minimum - 1 : maximum + 1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
141 # print(f"this is the search region: {search_region}") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
142 # print(search_region) # for trouble shooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
143 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
144 for tmsize in range(TMDmin, TMDmax + 1, 1): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
145 # print(f"this is the current tmsize we're trying: {tmsize}") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
146 # print('==============='+str(tmsize)+'================') # print for troubleshooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
147 pattern = ( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
148 "[PFIWLVMYCATGS]{" + str(tmsize) + "}" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
149 ) # searches for these hydrophobic residues tmsize total times |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
150 # print(pattern) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
151 # print(f"sending to regex: {search_region}") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
152 if re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
153 ("[K]"), search_region[1:8] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
154 ): # grabbing one below with search region, so I want to grab one ahead here when I query. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
155 store_search = re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
156 ("[K]"), search_region[1:8] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
157 ) # storing regex object |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
158 where_we_are = store_search.start() # finding where we got the hit |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
159 if re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
160 ("[PFIWLVMYCATGS]"), search_region[where_we_are + 1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
161 ) and re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
162 ("[PFIWLVMYCATGS]"), search_region[where_we_are - 1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
163 ): # hydrophobic neighbor |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
164 # try: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
165 g = re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
166 ("[PFIWLVMYCATGS]"), search_region[where_we_are + 1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
167 ).group() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
168 backend = check_back_end_snorkels(search_region, tmsize) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
169 if backend == "match": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
170 if isp_mode: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
171 g = re.search((pattern), search_region).group() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
172 end_of_tmd = re.search((g), s).end() + 1 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
173 amt_peri = len(s) - end_of_tmd |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
174 if peri_min <= amt_peri <= peri_max: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
175 pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
176 new_pair = (pair_desc, pair[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
177 tmd.append(new_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
178 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
179 tmd.append(pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
180 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
181 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
182 # else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
183 # print("I'm continuing out of snorkel loop") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
184 # print(f"{search_region}") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
185 # continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
186 if re.search((pattern), search_region): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
187 # print(f"found match: {}") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
188 # print("I AM HEREEEEEEEEEEEEEEEEEEEEEEE") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
189 # try: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
190 if isp_mode: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
191 g = re.search((pattern), search_region).group() |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
192 end_of_tmd = re.search((g), s).end() + 1 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
193 amt_peri = len(s) - end_of_tmd |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
194 if peri_min <= amt_peri <= peri_max: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
195 pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
196 new_pair = (pair_desc, pair[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
197 tmd.append(new_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
198 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
199 tmd.append(pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
200 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
201 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
202 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
203 return tmd |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
204 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
205 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
206 def find_lipobox( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
207 pair, minimum=10, maximum=50, min_after=30, max_after=185, regex=1, osp_mode=False |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
208 ): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
209 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
210 Function that takes an input tuple, and will return pairs of sequences to their description that have a lipoobox |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
211 ---> minimum - min distance from start codon to first AA of lipobox |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
212 ---> maximum - max distance from start codon to first AA of lipobox |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
213 ---> regex - option 1 (default) => more strict regular expression ; option 2 => looser selection, imported from LipoRy |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
214 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
215 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
216 if regex == 1: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
217 pattern = "[ILMFTV][^REKD][GAS]C" # regex for Lipobox from findSpanin.pl |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
218 elif regex == 2: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
219 pattern = "[ACGSILMFTV][^REKD][GAS]C" # regex for Lipobox from LipoRy |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
220 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
221 candidates = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
222 s = str(pair[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
223 # print(s) # trouble shooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
224 search_region = s[ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
225 minimum - 1 : maximum + 5 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
226 ] # properly slice the input... add 4 to catch if it hangs off at max input |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
227 # print(search_region) # trouble shooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
228 patterns = ["[ILMFTV][^REKD][GAS]C", "AW[AGS]C"] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
229 for pattern in patterns: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
230 # print(pattern) # trouble shooting |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
231 if re.search((pattern), search_region): # lipobox must be WITHIN the range... |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
232 # searches the sequence with the input RegEx AND omits if |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
233 g = re.search( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
234 (pattern), search_region |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
235 ).group() # find the exact group match |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
236 amt_peri = len(s) - re.search((g), s).end() + 1 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
237 if min_after <= amt_peri <= max_after: # find the lipobox end region |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
238 if osp_mode: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
239 pair_desc = pair[0] + ", peri_count~=" + str(amt_peri) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
240 new_pair = (pair_desc, pair[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
241 candidates.append(new_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
242 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
243 candidates.append(pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
244 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
245 return candidates |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
246 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
247 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
248 def tuple_fasta(fasta_file): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
249 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
250 #### INPUT: Fasta File |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
251 #### OUTPUT: zipped (zip) : pairwise relationship of description to sequence |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
252 #### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
253 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
254 fasta = SeqIO.parse(fasta_file, "fasta") |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
255 descriptions = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
256 sequences = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
257 for r in fasta: # iterates and stores each description and sequence |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
258 description = r.description |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
259 sequence = str(r.seq) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
260 if ( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
261 sequence[0] != "I" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
262 ): # the translation table currently has I as a potential start codon ==> this will remove all ORFs that start with I |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
263 descriptions.append(description) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
264 sequences.append(sequence) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
265 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
266 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
267 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
268 return zip(descriptions, sequences) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
269 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
270 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
271 def lineWrapper(text, charactersize=60): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
272 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
273 if len(text) <= charactersize: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
274 return text |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
275 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
276 return ( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
277 text[:charactersize] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
278 + "\n" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
279 + lineWrapper(text[charactersize:], charactersize) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
280 ) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
281 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
282 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
283 def getDescriptions(fasta): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
284 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
285 Takes an output FASTA file, and parses retrieves the description headers. These headers contain information needed |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
286 for finding locations of a potential i-spanin and o-spanin proximity to one another. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
287 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
288 desc = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
289 with fasta as f: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
290 for line in f: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
291 if line.startswith(">"): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
292 desc.append(line) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
293 return desc |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
294 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
295 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
296 def splitStrands(text, strand="+"): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
297 # positive_strands = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
298 # negative_strands = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
299 if strand == "+": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
300 if re.search(("(\[1\])"), text): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
301 return text |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
302 elif strand == "-": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
303 if re.search(("(\[-1\])"), text): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
304 return text |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
305 # return positive_strands, negative_strands |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
306 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
307 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
308 def parse_a_range(pair, start, end): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
309 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
310 Takes an input data tuple from a fasta tuple pair and keeps only those within the input sequence range |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
311 ---> data : fasta tuple data |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
312 ---> start : start range to keep |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
313 ---> end : end range to keep (will need to + 1) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
314 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
315 matches = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
316 for each_pair in pair: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
317 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
318 s = re.search(("[\d]+\.\."), each_pair[0]).group(0) # Start of the sequence |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
319 s = int(s.split("..")[0]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
320 e = re.search(("\.\.[\d]+"), each_pair[0]).group(0) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
321 e = int(e.split("..")[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
322 if start - 1 <= s and e <= end + 1: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
323 matches.append(each_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
324 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
325 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
326 # else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
327 # continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
328 # if matches != []: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
329 return matches |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
330 # else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
331 # print('no candidates within selected range') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
332 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
333 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
334 def grabLocs(text): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
335 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
336 Grabs the locations of the spanin based on NT location (seen from ORF). Grabs the ORF name, as per named from the ORF class/module |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
337 from cpt.py |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
338 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
339 start = re.search(("[\d]+\.\."), text).group( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
340 0 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
341 ) # Start of the sequence ; looks for [numbers].. |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
342 end = re.search(("\.\.[\d]+"), text).group( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
343 0 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
344 ) # End of the sequence ; Looks for ..[numbers] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
345 orf = re.search(("(ORF)[\d]+"), text).group( |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
346 0 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
347 ) # Looks for ORF and the numbers that are after it |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
348 if re.search(("(\[1\])"), text): # stores strand |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
349 strand = "+" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
350 elif re.search(("(\[-1\])"), text): # stores strand |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
351 strand = "-" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
352 start = int(start.split("..")[0]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
353 end = int(end.split("..")[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
354 vals = [start, end, orf, strand] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
355 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
356 return vals |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
357 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
358 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
359 def spaninProximity(isp, osp, max_dist=30): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
360 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
361 _NOTE THIS FUNCTION COULD BE MODIFIED TO RETURN SEQUENCES_ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
362 Compares the locations of i-spanins and o-spanins. max_dist is the distance in NT measurement from i-spanin END site |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
363 to o-spanin START. The user will be inputting AA distance, so a conversion will be necessary (<user_input> * 3) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
364 I modified this on 07.30.2020 to bypass the pick + or - strand. To |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
365 INPUT: list of OSP and ISP candidates |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
366 OUTPUT: Return (improved) candidates for overlapping, embedded, and separate list |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
367 """ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
368 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
369 embedded = {} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
370 overlap = {} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
371 separate = {} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
372 for iseq in isp: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
373 embedded[iseq[2]] = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
374 overlap[iseq[2]] = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
375 separate[iseq[2]] = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
376 for oseq in osp: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
377 if iseq[3] == "+": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
378 if oseq[3] == "+": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
379 if iseq[0] < oseq[0] < iseq[1] and oseq[1] < iseq[1]: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
380 ### EMBEDDED ### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
381 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
382 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
383 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
384 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
385 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
386 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
387 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
388 ] # ordering a return for dic |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
389 embedded[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
390 elif iseq[0] < oseq[0] <= iseq[1] and oseq[1] > iseq[1]: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
391 ### OVERLAP / SEPARATE ### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
392 if (iseq[1] - oseq[0]) < 6: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
393 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
394 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
395 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
396 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
397 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
398 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
399 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
400 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
401 separate[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
402 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
403 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
404 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
405 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
406 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
407 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
408 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
409 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
410 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
411 overlap[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
412 elif iseq[1] <= oseq[0] <= iseq[1] + max_dist: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
413 combo = [iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3]] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
414 separate[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
415 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
416 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
417 if iseq[3] == "-": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
418 if oseq[3] == "-": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
419 if iseq[0] <= oseq[1] <= iseq[1] and oseq[0] > iseq[0]: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
420 ### EMBEDDED ### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
421 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
422 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
423 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
424 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
425 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
426 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
427 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
428 ] # ordering a return for dict |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
429 embedded[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
430 elif iseq[0] <= oseq[1] <= iseq[1] and oseq[0] < iseq[0]: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
431 if (oseq[1] - iseq[0]) < 6: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
432 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
433 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
434 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
435 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
436 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
437 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
438 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
439 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
440 separate[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
441 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
442 combo = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
443 iseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
444 iseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
445 oseq[2], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
446 oseq[0], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
447 oseq[1], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
448 iseq[3], |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
449 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
450 overlap[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
451 elif iseq[0] - 10 < oseq[1] < iseq[0]: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
452 combo = [iseq[0], iseq[1], oseq[2], oseq[0], oseq[1], iseq[3]] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
453 separate[iseq[2]] += [combo] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
454 else: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
455 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
456 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
457 embedded = {k: embedded[k] for k in embedded if embedded[k]} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
458 overlap = {k: overlap[k] for k in overlap if overlap[k]} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
459 separate = {k: separate[k] for k in separate if separate[k]} |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
460 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
461 return embedded, overlap, separate |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
462 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
463 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
464 def check_for_usp(): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
465 "pass" |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
466 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
467 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
468 ############################################### TEST RANGE ######################################################################### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
469 #################################################################################################################################### |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
470 if __name__ == "__main__": |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
471 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
472 #### TMD TEST |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
473 test_desc = ["one", "two", "three", "four", "five"] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
474 test_seq = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
475 "XXXXXXXXXXXXXXXFMCFMCFMCFMCFMCXXXXXXXXXXXXXXXXXXXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
476 "XXXXXXXXAAKKKKKKKKKKKKKKKXXXXXXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
477 "XXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
478 "XXXXXXXXXXXKXXXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
479 "XXXXXXXXXXAKXXXXXXXXXXAKXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
480 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
481 # for l in |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
482 # combo = zip(test_desc,test_seq) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
483 pairs = zip(test_desc, test_seq) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
484 tmd = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
485 for each_pair in pairs: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
486 # print(each_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
487 try: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
488 tmd += find_tmd(pair=each_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
489 except (IndexError, TypeError): |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
490 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
491 # try:s = each_pair[1] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
492 # tmd += find_tmd(seq=s, tmsize=15) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
493 # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
494 # print(tmd) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
495 # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
496 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
497 #### tuple-fasta TEST |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
498 # fasta_file = 'out_isp.fa' |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
499 # ret = tuple_fasta(fasta_file) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
500 # print('=============') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
501 # for i in ret: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
502 # print(i[1]) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
503 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
504 #### LipoBox TEST |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
505 test_desc = ["one", "two", "three", "four", "five", "six", "seven"] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
506 test_seq = [ |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
507 "XXXXXXXXXTGGCXXXXXXXXXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
508 "XXXXXXXXAAKKKKKKKKKKKKKKKXXXXXXXXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
509 "XXXXXXX", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
510 "AGGCXXXXXXXXXXXXXXXXXXXXTT", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
511 "XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGGC", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
512 "XXXXXXXXXXXXXXXXXXXXXXXXXXTGGC", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
513 "MSTLRELRLRRALKEQSMRYLLSIKKTLPRWKGALIGLFLICVATISGCASESKLPEPPMVSVDSSLMVEPNLTTEMLNVFSQ*", |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
514 ] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
515 pairs = zip(test_desc, test_seq) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
516 lipo = [] |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
517 for each_pair in pairs: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
518 # print(each_pair) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
519 # try: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
520 try: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
521 lipo += find_lipobox(pair=each_pair, regex=2) # , minimum=8) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
522 except TypeError: # catches if something doesnt have the min/max requirements (something is too small) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
523 continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
524 # except: |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
525 # continue |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
526 # print('\n+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++\n') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
527 #############################3 |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
528 # g = prep_a_gff3(fa='putative_isp.fa', spanin_type='isp') |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
529 # print(g) |
|
fd70980a516b
planemo upload commit 94b0cd1fff0826c6db3e7dc0c91c0c5a8be8bb0c
cpt
parents:
diff
changeset
|
530 # write_gff3(data=g) |
