Mercurial > repos > devteam > ncbi_blast_plus
diff test-data/tblastn_four_human_vs_rhodopsin.html @ 8:1f546099212f draft
Uploaded v0.0.17, default to extended 24 column tabular output (rather than standard 12 column output). This should avoid many cases of repeated BLAST jobs being run due to later needing the extra columns.
author | peterjc |
---|---|
date | Tue, 19 Feb 2013 12:49:43 -0500 |
parents | d375502056f1 |
children | 4c4a0da938ff |
line wrap: on
line diff
--- a/test-data/tblastn_four_human_vs_rhodopsin.html Fri Feb 08 05:51:26 2013 -0500 +++ b/test-data/tblastn_four_human_vs_rhodopsin.html Tue Feb 19 12:49:43 2013 -0500 @@ -3,7 +3,7 @@ <BODY BGCOLOR="#FFFFFF" LINK="#0000FF" VLINK="#660099" ALINK="#660099"> <PRE> -<b>TBLASTN 2.2.25+</b> +<b>TBLASTN 2.2.26+</b> <b>Query=</b> sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 @@ -563,7 +563,7 @@ <script src="blastResult.js"></script> Score = 151 bits (342), Expect(2) = 1e-72, Method: Compositional matrix adjust. - Identities = 69/74 (94%), Positives = 73/74 (99%), Gaps = 0/74 (0%) + Identities = 69/74 (93%), Positives = 73/74 (99%), Gaps = 0/74 (0%) Frame = +3 Query 239 ESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSA 298 @@ -584,8 +584,8 @@ Sbjct 2855 RYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEVRS 3031 - Score = 229 bits (523), Expect = 1e-64, Method: Compositional matrix adjust. - Identities = 107/111 (97%), Positives = 109/111 (99%), Gaps = 0/111 (0%) + Score = 229 bits (523), Expect = 9e-67, Method: Compositional matrix adjust. + Identities = 107/111 (96%), Positives = 109/111 (98%), Gaps = 0/111 (0%) Frame = +1 Query 11 VPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT 70 @@ -598,7 +598,7 @@ Score = 122 bits (276), Expect = 1e-32, Method: Compositional matrix adjust. - Identities = 55/59 (94%), Positives = 56/59 (95%), Gaps = 0/59 (0%) + Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%) Frame = +3 Query 119 LGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSR 177 @@ -606,8 +606,8 @@ Sbjct 1404 LAGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWVMALACAAPPLVGWSR 1580 - Score = 57.7 bits (125), Expect = 6e-13, Method: Compositional matrix adjust. - Identities = 23/26 (89%), Positives = 24/26 (93%), Gaps = 0/26 (0%) + Score = 57.7 bits (125), Expect = 2e-12, Method: Compositional matrix adjust. + Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%) Frame = +1 Query 312 QFRNCMLTTICCGKNPLGDDEASATV 337 @@ -637,7 +637,7 @@ <script src="blastResult.js"></script> Score = 658 bits (1517), Expect = 0.0, Method: Compositional matrix adjust. - Identities = 310/326 (96%), Positives = 322/326 (99%), Gaps = 0/326 (0%) + Identities = 310/326 (95%), Positives = 322/326 (99%), Gaps = 0/326 (0%) Frame = +1 Query 11 VPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT 70 @@ -687,7 +687,7 @@ <script src="blastResult.js"></script> Score = 711 bits (1640), Expect = 0.0, Method: Compositional matrix adjust. - Identities = 325/348 (94%), Positives = 337/348 (97%), Gaps = 0/348 (0%) + Identities = 325/348 (93%), Positives = 337/348 (97%), Gaps = 0/348 (0%) Frame = +1 Query 1 MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY 60 @@ -737,7 +737,7 @@ <script src="blastResult.js"></script> Score = 626 bits (1444), Expect = 0.0, Method: Compositional matrix adjust. - Identities = 281/342 (83%), Positives = 311/342 (91%), Gaps = 1/342 (0%) + Identities = 281/342 (82%), Positives = 311/342 (91%), Gaps = 1/342 (0%) Frame = +2 Query 1 MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY 60