Mercurial > repos > iuc > snpeff
diff test-data/pBR322.gbk @ 10:5b4ac70948d2 draft
planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tool_collections/snpeff commit eea43430ff90fe6b13b295f6d5efb2208401a7ef
| author | iuc |
|---|---|
| date | Tue, 27 Mar 2018 09:44:18 -0400 |
| parents | |
| children |
line wrap: on
line diff
--- /dev/null Thu Jan 01 00:00:00 1970 +0000 +++ b/test-data/pBR322.gbk Tue Mar 27 09:44:18 2018 -0400 @@ -0,0 +1,474 @@ +LOCUS SYNPBR322 4361 bp DNA circular SYN 30-SEP-2008 +DEFINITION Cloning vector pBR322, complete sequence. +ACCESSION J01749 K00005 L08654 M10282 M10283 M10286 M10356 M10784 M10785 + M10786 M33694 V01119 +VERSION J01749.1 +KEYWORDS ampicillin resistance; beta-lactamase; cloning vector; drug + resistance protein; origin of replication; plasmid; tetracycline + resistance. +SOURCE Cloning vector pBR322 + ORGANISM Cloning vector pBR322 + other sequences; artificial sequences; vectors. +REFERENCE 1 (bases 1 to 3; 3259 to 4361) + AUTHORS Sutcliffe,J.G. + TITLE Nucleotide sequence of the ampicillin resistance gene of + Escherichia coli plasmid pBR322 + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 75 (8), 3737-3741 (1978) + PUBMED 358200 +REFERENCE 2 (bases 1 to 4361) + AUTHORS Sutcliffe,J.G. + TITLE Complete nucleotide sequence of the Escherichia coli plasmid pBR322 + JOURNAL Cold Spring Harb. Symp. Quant. Biol. 43 (Pt 1), 77-90 (1979) + PUBMED 383387 +REFERENCE 3 (bases 1500 to 2300) + AUTHORS Reed,R.R., Young,R.A., Steitz,J.A., Grindley,N.D. and Guyer,M.S. + TITLE Transposition of the Escherichia coli insertion element gamma + generates a five-base-pair repeat + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 76 (10), 4882-4886 (1979) + PUBMED 388421 +REFERENCE 4 (bases 2207 to 2265) + AUTHORS Covarrubias,L., Cervantes,L., Covarrubias,A., Soberon,X., + Vichido,I., Blanco,A., Kupersztoch-Portnoy,Y.M. and Bolivar,F. + TITLE Construction and characterization of new cloning vehicles. V. + Mobilization and coding properties of pBR322 and several deletion + derivatives including pBR327 and pBR328 + JOURNAL Gene 13 (1), 25-35 (1981) + PUBMED 6263753 +REFERENCE 5 (bases 2000 to 2500) + AUTHORS Marians,K.J., Soeller,W. and Zipursky,S.L. + TITLE Maximal limits of the Escherichia coli replication factor Y + effector site sequences in pBR322 DNA + JOURNAL J. Biol. Chem. 257 (10), 5656-5662 (1982) + PUBMED 6279609 +REFERENCE 6 (bases 1 to 80; 4151 to 4229; 4349 to 4361) + AUTHORS Brosius,J., Cate,R.L. and Perlmutter,A.P. + TITLE Precise location of two promoters for the beta-lactamase gene of + pBR322. S1 mapping of ribonucleic acid isolated from Escherichia + coli or synthesized in vitro + JOURNAL J. Biol. Chem. 257 (15), 9205-9210 (1982) + PUBMED 6178738 +REFERENCE 7 (bases 4241 to 4343) + AUTHORS Van Dyke,M.W., Hertzberg,R.P. and Dervan,P.B. + TITLE Map of distamycin, netropsin, and actinomycin binding sites on + heterogeneous DNA: DNA cleavage-inhibition patterns with + methidiumpropyl-EDTA.Fe(II) + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 79 (18), 5470-5474 (1982) + PUBMED 6291045 +REFERENCE 8 (bases 584 to 709) + AUTHORS Peden,K.W. and Nathans,D. + TITLE Local mutagenesis within deletion loops of DNA heteroduplexes + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 79 (23), 7214-7217 (1982) + PUBMED 6760191 +REFERENCE 9 (bases 373 to 649) + AUTHORS Peden,K.W. + TITLE Revised sequence of the tetracycline-resistance gene of pBR322 + JOURNAL Gene 22 (2-3), 277-280 (1983) + PUBMED 6307828 +REFERENCE 10 (bases 132 to 181) + AUTHORS Watabe,H., Iino,T., Kaneko,T., Shibata,T. and Ando,T. + TITLE A new class of site-specific endodeoxyribonucleases. Endo.Sce I + isolated from a eukaryote, Saccharomyces cerevisiae + JOURNAL J. Biol. Chem. 258 (8), 4663-4665 (1983) + PUBMED 6300094 +REFERENCE 11 (bases 368 to 581) + AUTHORS Livneh,Z. + TITLE Directed mutagenesis method for analysis of mutagen specificity: + application to ultraviolet-induced mutagenesis + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (1), 237-241 (1983) + PUBMED 6337373 +REFERENCE 12 (bases 2627 to 2682; 2781 to 2828) + AUTHORS Mascharak,P.K., Sugiura,Y., Kuwahara,J., Suzuki,T. and Lippard,S.J. + TITLE Alteration and activation of sequence-specific cleavage of DNA by + bleomycin in the presence of the antitumor drug + cis-diamminedichloroplatinum(II) + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (22), 6795-6798 (1983) + PUBMED 6196777 +REFERENCE 13 (bases 4276 to 4336) + AUTHORS Schultz,P.G. and Dervan,P.B. + TITLE Sequence-specific double-strand cleavage of DNA by + penta-N-methylpyrrolecarboxamide-EDTA X Fe(II) + JOURNAL Proc. Natl. Acad. Sci. U.S.A. 80 (22), 6834-6837 (1983) + PUBMED 6417654 +REFERENCE 14 (bases 518 to 528) + AUTHORS Sutcliffe,J.G. + JOURNAL Unpublished +REFERENCE 15 (bases 2395 to 2495) + AUTHORS Fuller,R.S., Funnell,B.E. and Kornberg,A. + TITLE The dnaA protein complex with the E. coli chromosomal replication + origin (oriC) and other DNA sites + JOURNAL Cell 38 (3), 889-900 (1984) + PUBMED 6091903 +REFERENCE 16 (bases 2729 to 2731) + AUTHORS Lathe,R., Kieny,M.P., Skory,S. and Lecocq,J.P. + TITLE Linker tailing: unphosphorylated linker oligonucleotides for + joining DNA termini + JOURNAL DNA 3 (2), 173-182 (1984) + PUBMED 6327214 +REFERENCE 17 (bases 2729 to 2730) + AUTHORS Heusterspreute,M. and Davison,J. + TITLE Restriction site bank vectors. II. DNA sequence analysis of plasmid + pJRD158 + JOURNAL DNA 3 (3), 259-268 (1984) + PUBMED 6086259 +REFERENCE 18 (bases 2113 to 2186; 2348 to 2415) + AUTHORS Abarzua,P., Soeller,W. and Marians,K.J. + TITLE Mutational analysis of primosome assembly sites. I. Distinct + classes of mutants in the pBR322 Escherichia coli factor Y DNA + effector sequences + JOURNAL J. Biol. Chem. 259 (22), 14286-14292 (1984) + PUBMED 6209275 +REFERENCE 19 (bases 2348 to 2415) + AUTHORS Soeller,W., Abarzua,P. and Marians,K.J. + TITLE Mutational analysis of primosome assembly sites. II. Role of + secondary structure in the formation of active sites + JOURNAL J. Biol. Chem. 259 (22), 14293-14300 (1984) + PUBMED 6150042 +REFERENCE 20 (bases 1 to 4361) + AUTHORS Van Dyke,M.M. and Dervan,P.B. + TITLE Echinomycin binding sites on DNA + JOURNAL Science 225 (4667), 1122-1127 (1984) + PUBMED 6089341 +REFERENCE 21 (sites) + AUTHORS Pouwels,P.H., Enger-Valk,B.E. and Brammar,W.J. + JOURNAL (in) CLONING VECTORS. Elsevier Scientific Publishing, Amsterdam + (1985) + REMARK Vector I-A-iv-1 +REFERENCE 22 (bases 1 to 4361) + AUTHORS Watson,N. + TITLE A new revision of the sequence of plasmid pBR322 + JOURNAL Gene 70 (2), 399-403 (1988) + PUBMED 3063608 +REFERENCE 23 (sites) + AUTHORS Gilbert,W. + TITLE Obtained from VecBase 3.0 + JOURNAL Unpublished +COMMENT On or before Apr 4, 2002 this sequence version replaced L08654.1, + gi:58257. + The circular sequence is numbered such that 0 is the middle of the + unique EcoRI site and the count increases first through the tet + genes, the pMB1 material, and finally through the Tn3 region. + Plasmid pBR322 contains ampicillin and tetracycline resistance + genes. The ampicillin resistance gene (amp-r) is a penicillin + beta-lactamase. Promoters P1 and P3 are for the beta-lactamase + gene. P3 is the natural promoter, and P1 is artificially created by + the ligation of two different DNA fragments to create pBR322. P2 is + in the same region as P1, but it is on the opposite strand and + initiates transcription in the direction of the tetracycline + resistance gene. + Mutational studies in the primosome assembly sites indicate four + types of mutations: Class I having no effect on the activities + elicited by the DNA site and the bases involved are probably + spacers; Class II requiring higher Mg-2+ concentrations than the + wild-type to be fully activated as factor Y ATPase effectors; Class + III co-inactivating both the ATPase effector and DNA replication + template activity of the site, indicating that they probably + represent essential contact points between factor Y and the DNA; + Class IV having a replication template activity intermediate that + of class III and class II mutant DNAs. + Specific sites within or near the origins of replication are + recognized by dnaA protein. Without dnaA binding to the origin of + replication chromosomal replication is not possible (15). pBR322 + DNA contains two separate regions on opposite strands and close to + the origin of replication which, when in single-stranded form, can + act as effectors for the ATPase activity of E.coli replication + factor Y (5). Small fragments of DNA containing these sites when + cloned in an f1 phage vector act as origins of DNA replication + allowing the formation of complementary double-stranded DNA in + rifampicin-resistant, dna(B,G,C)-dependent fashion in vitro (5). + The biological activity of echinomycin is thought to be related to + the formation of complexes by intercalating with cellular DNA (20). + Complete source information: + Plasmid pBR322 from E.coli (2),(1),(3),(6),(11),(8),(5),(7),(12), + (13),(10),(9),(14),(18),(19),(15),(20),(16); pBR322 DNA in pXf3 + (4). + The following data and their annotation were supplied by Will + Gilbert under the auspices of the Curator Program. + CROSSREFERENCE + #parent + GenBank(50):pSC101C, GenBank(50):Trn3 + #offspring + VecBase(3):pBR325, VecBase(3):pBR327, + VecBase(3):pBR328, + VecBase(3):pAT153, VecBase(3):pUC7, + VecBase(3):pJRD158, + VecBase(3):PiVX, VecBase(3):PiAN7, + VecBase(3):pSP64, + VecBase(3):pSP65, VecBase(3):pGEM1, + VecBase(3):pGEM2, + VecBase(3):pGEM3, VecBase(3):pGEM4, + VecBase(3):pKK223, + VecBase(3):pLBU3, VecBase(3):pTrS3, + VecBase(3):pRSVNeo, + VecBase(3):pSV2Cat, VecBase(3):M13mp9, + VecBase(3):pHC79, + VecBase(3):pV34, VecBase(3):pKTH601, + VecBase(3):pKTH604, + VecBase(3):pKTH605, VecBase(3):pKTH606, + VecBase(3):YEp24, + VecBase(3):YIp5, VecBase(3):YRp17, + VecBase(3):pSP18, + VecBase(3):pSP19, + VecBase(3):pSP6T3, VecBase(3):pSP6T719, + VecBase(3):pT712, + VecBase(3):pT713, VecBase(3):pT7T318, + VecBase(3):pT7T319, + VecBase(3):pT7T3A18, VecBase(3):pT7T3A19, + VecBase(3):pEX1, + VecBase(3):pEX2, VecBase(3):pEX3, + VecBase(3):pCKSP6, + VecBase(3):pACYC177, VecBase(3):pKO1, + VecBase(3):pKO2, + VecBase(3):pKM1, + VecBase(3):pKM2, VecBase(3):pMBL1, + VecBase(3):pMBL604, + VecBase(3):pMC1511, VecBase(3):pMC1871, + VecBase(3):pAA37X, + VecBase(3):pUR278, VecBase(3):pUR288, + VecBase(3):pUR289, + VecBase(3):pUR290, VecBase(3):pUR291, + VecBase(3):pUR292, + VecBase(3):pUR222. +FEATURES Location/Qualifiers + source 1..4361 + /organism="Cloning vector pBR322" + /mol_type="other DNA" + /db_xref="taxon:47470" + /tissue_lib="ATCC 31344, ATCC 37017" + /focus + source 1..1762 + /organism="Plasmid pSC101" + /mol_type="other DNA" + /db_xref="taxon:2625" + misc_binding 24..27 + /bound_moiety="echinomycin" + regulatory complement(27..33) + /regulatory_class="promoter" + /note="promoter P1 (6)" + misc_binding 39..42 + /bound_moiety="echinomycin" + regulatory 43..49 + /regulatory_class="promoter" + /note="promoter P2 (6)" + misc_binding 53..56 + /bound_moiety="echinomycin" + misc_binding 67..70 + /bound_moiety="echinomycin" + misc_binding 80..83 + /bound_moiety="echinomycin" + gene 86..1276 + /gene="tet" + CDS 86..1276 + /gene="tet" + /codon_start=1 + /transl_table=11 + /product="tetracycline resistance protein" + /protein_id="AAB59735.1" + /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASH + YGVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAG + RIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLH + APFLAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTV + FFIMQLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGE + KQAIIAGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQG + QLQGSLAALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSR + ATST" + misc_feature complement(141..142) + /note="Endo.Sce I cleavage site coordinated with site at + base 146 (10)" + misc_feature 146..147 + /gene="tet" + /note="Endo.Sce I cleavage site coordinated with site at + base 142 (10)" + misc_binding 411..414 + /gene="tet" + /bound_moiety="echinomycin" + misc_difference 426 + /gene="tet" + /note="conflict" + /citation=[11] + /replace="" + misc_binding 469..472 + /gene="tet" + /bound_moiety="echinomycin" + old_sequence 526..528 + /gene="tet" + /citation=[17] + repeat_region complement(1515..1519) + /note="gamma-delta insertion target sequence" + /rpt_type=direct + misc_feature 1636..1762 + /note="from pSC101 (bp 1860-1986)" + repeat_region complement(1788..1792) + /note="gamma-delta insertion target sequence" + /rpt_type=direct + misc_difference 1891..1892 + /note="conflict" + /citation=[23] + /replace="att" + old_sequence 1892..1893 + /citation=[2] + /citation=[22] + regulatory 1905..1910 + /regulatory_class="ribosome_binding_site" + regulatory 1905..1909 + /regulatory_class="ribosome_binding_site" + /note="Shine-Dalgarno sequence" + misc_difference 1913..1914 + /note="conflict" + /citation=[23] + /replace="caa" + old_sequence 1914..1915 + /citation=[17] + CDS 1915..2106 + /codon_start=1 + /transl_table=11 + /product="ROP protein" + /protein_id="AAB59736.1" + /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDH + ADELYRSCLARFGDDGENL" + misc_feature 2011..2167 + /note="H-strand Y effector site" + /citation=[5] + repeat_region complement(2245..2249) + /note="gamma-delta insertion target sequence" + /rpt_type=direct + misc_feature complement(2351..2414) + /note="L-strand Y effector site" + /citation=[5] + misc_binding 2439..2447 + /bound_moiety="dnaA" + rep_origin 2535 + old_sequence 2729..2730 + /note="revision according to (17)" + /citation=[2] + /citation=[17] + /replace="at" + old_sequence 2729 + /citation=[17] + old_sequence 2730 + /note="revision according to (16)" + /citation=[2] + /citation=[16] + /citation=[17] + /replace="t" + mobile_element 3148..4361 + /mobile_element_type="transposon:Tn3" + repeat_region 3148..3185 + /note="corresponds to one of the 38bp repeats found in Tn3 + (bp 1-38 and complement (4920-4957))" + /rpt_type=inverted + gene complement(3293..4153) + /gene="bla" + CDS complement(3293..4153) + /gene="bla" + /note="E-286" + /codon_start=1 + /transl_table=11 + /product="beta-lactamase" + /protein_id="AAB59737.1" + /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY + IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE + YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL + DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL + LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA + EIGASLIKHW" + sig_peptide complement(4085..4153) + /gene="bla" + mat_peptide complement(3296..4084) + /gene="bla" + /product="beta-lactamase" + regulatory complement(4161..4165) + /regulatory_class="ribosome_binding_site" + /note="Shine-Dalgarno sequence" + regulatory complement(4188..4194) + /regulatory_class="promoter" + /note="promoter P3 (6)" + misc_binding complement(4268..4271) + /bound_moiety="echinomycin" + misc_binding complement(4280..4283) + /bound_moiety="echinomycin" + misc_binding complement(4285..4288) + /bound_moiety="echinomycin" + misc_binding complement(4296..4299) + /bound_moiety="echinomycin" + misc_binding complement(4311..4314) + /bound_moiety="echinomycin" + misc_binding complement(4317..4320) + /bound_moiety="echinomycin" + misc_binding complement(4331..4334) + /bound_moiety="echinomycin" +ORIGIN + 1 ttctcatgtt tgacagctta tcatcgataa gctttaatgc ggtagtttat cacagttaaa + 61 ttgctaacgc agtcaggcac cgtgtatgaa atctaacaat gcgctcatcg tcatcctcgg + 121 caccgtcacc ctggatgctg taggcatagg cttggttatg ccggtactgc cgggcctctt + 181 gcgggatatc gtccattccg acagcatcgc cagtcactat ggcgtgctgc tagcgctata + 241 tgcgttgatg caatttctat gcgcacccgt tctcggagca ctgtccgacc gctttggccg + 301 ccgcccagtc ctgctcgctt cgctacttgg agccactatc gactacgcga tcatggcgac + 361 cacacccgtc ctgtggatcc tctacgccgg acgcatcgtg gccggcatca ccggcgccac + 421 aggtgcggtt gctggcgcct atatcgccga catcaccgat ggggaagatc gggctcgcca + 481 cttcgggctc atgagcgctt gtttcggcgt gggtatggtg gcaggccccg tggccggggg + 541 actgttgggc gccatctcct tgcatgcacc attccttgcg gcggcggtgc tcaacggcct + 601 caacctacta ctgggctgct tcctaatgca ggagtcgcat aagggagagc gtcgaccgat + 661 gcccttgaga gccttcaacc cagtcagctc cttccggtgg gcgcggggca tgactatcgt + 721 cgccgcactt atgactgtct tctttatcat gcaactcgta ggacaggtgc cggcagcgct + 781 ctgggtcatt ttcggcgagg accgctttcg ctggagcgcg acgatgatcg gcctgtcgct + 841 tgcggtattc ggaatcttgc acgccctcgc tcaagccttc gtcactggtc ccgccaccaa + 901 acgtttcggc gagaagcagg ccattatcgc cggcatggcg gccgacgcgc tgggctacgt + 961 cttgctggcg ttcgcgacgc gaggctggat ggccttcccc attatgattc ttctcgcttc + 1021 cggcggcatc gggatgcccg cgttgcaggc catgctgtcc aggcaggtag atgacgacca + 1081 tcagggacag cttcaaggat cgctcgcggc tcttaccagc ctaacttcga tcactggacc + 1141 gctgatcgtc acggcgattt atgccgcctc ggcgagcaca tggaacgggt tggcatggat + 1201 tgtaggcgcc gccctatacc ttgtctgcct ccccgcgttg cgtcgcggtg catggagccg + 1261 ggccacctcg acctgaatgg aagccggcgg cacctcgcta acggattcac cactccaaga + 1321 attggagcca atcaattctt gcggagaact gtgaatgcgc aaaccaaccc ttggcagaac + 1381 atatccatcg cgtccgccat ctccagcagc cgcacgcggc gcatctcggg cagcgttggg + 1441 tcctggccac gggtgcgcat gatcgtgctc ctgtcgttga ggacccggct aggctggcgg + 1501 ggttgcctta ctggttagca gaatgaatca ccgatacgcg agcgaacgtg aagcgactgc + 1561 tgctgcaaaa cgtctgcgac ctgagcaaca acatgaatgg tcttcggttt ccgtgtttcg + 1621 taaagtctgg aaacgcggaa gtcagcgccc tgcaccatta tgttccggat ctgcatcgca + 1681 ggatgctgct ggctaccctg tggaacacct acatctgtat taacgaagcg ctggcattga + 1741 ccctgagtga tttttctctg gtcccgccgc atccataccg ccagttgttt accctcacaa + 1801 cgttccagta accgggcatg ttcatcatca gtaacccgta tcgtgagcat cctctctcgt + 1861 ttcatcggta tcattacccc catgaacaga aatccccctt acacggaggc atcagtgacc + 1921 aaacaggaaa aaaccgccct taacatggcc cgctttatca gaagccagac attaacgctt + 1981 ctggagaaac tcaacgagct ggacgcggat gaacaggcag acatctgtga atcgcttcac + 2041 gaccacgctg atgagcttta ccgcagctgc ctcgcgcgtt tcggtgatga cggtgaaaac + 2101 ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc + 2161 agacaagccc gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc + 2221 cagtcacgta gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg + 2281 tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc + 2341 gcatcaggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc + 2401 ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata + 2461 acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg + 2521 cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct + 2581 caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa + 2641 gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc + 2701 tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt + 2761 aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg + 2821 ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg + 2881 cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct + 2941 tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc + 3001 tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg + 3061 ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc + 3121 aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt + 3181 aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt ttaaattaaa + 3241 aatgaagttt taaatcaatc taaagtatat atgagtaaac ttggtctgac agttaccaat + 3301 gcttaatcag tgaggcacct atctcagcga tctgtctatt tcgttcatcc atagttgcct + 3361 gactccccgt cgtgtagata actacgatac gggagggctt accatctggc cccagtgctg + 3421 caatgatacc gcgagaccca cgctcaccgg ctccagattt atcagcaata aaccagccag + 3481 ccggaagggc cgagcgcaga agtggtcctg caactttatc cgcctccatc cagtctatta + 3541 attgttgccg ggaagctaga gtaagtagtt cgccagttaa tagtttgcgc aacgttgttg + 3601 ccattgctgc aggcatcgtg gtgtcacgct cgtcgtttgg tatggcttca ttcagctccg + 3661 gttcccaacg atcaaggcga gttacatgat cccccatgtt gtgcaaaaaa gcggttagct + 3721 ccttcggtcc tccgatcgtt gtcagaagta agttggccgc agtgttatca ctcatggtta + 3781 tggcagcact gcataattct cttactgtca tgccatccgt aagatgcttt tctgtgactg + 3841 gtgagtactc aaccaagtca ttctgagaat agtgtatgcg gcgaccgagt tgctcttgcc + 3901 cggcgtcaac acgggataat accgcgccac atagcagaac tttaaaagtg ctcatcattg + 3961 gaaaacgttc ttcggggcga aaactctcaa ggatcttacc gctgttgaga tccagttcga + 4021 tgtaacccac tcgtgcaccc aactgatctt cagcatcttt tactttcacc agcgtttctg + 4081 ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg aataagggcg acacggaaat + 4141 gttgaatact catactcttc ctttttcaat attattgaag catttatcag ggttattgtc + 4201 tcatgagcgg atacatattt gaatgtattt agaaaaataa acaaataggg gttccgcgca + 4261 catttccccg aaaagtgcca cctgacgtct aagaaaccat tattatcatg acattaacct + 4321 ataaaaatag gcgtatcacg aggccctttc gtcttcaaga a +// +