Mercurial > repos > uga-galaxy-group > webservice_toolsuite_v1_1
view WebServiceExtensionsV1.1/WebServiceToolWorkflow_REST_SOAP/clientGenerator/paramConverter.py~ @ 0:049760c677de default tip
Galaxy WSExtensions added successfully
author | uga-galaxy-group |
---|---|
date | Tue, 05 Jul 2011 19:34:18 -0400 |
parents | |
children |
line wrap: on
line source
''' @author Rui Wnag, Chaitanya Guttula @see LICENSE (MIT style license file). ''' ''' converter galaxy parameter <-----> user input dictionary for web service '|' is the seperator, if the real name contains it, it will cause wrong result in this converter ''' from types import * #from galaxy.tools.parameters.basic import * __author__="Rui Wang" def nested2flatDict(nestedDic): ''' nestedDic is dictionary e.g.{a:{a1:None, a2:None}, b:None, c:[{c1:None, c2:None},{c1:None, c2:None}]}, converter it into flatDict e.g. {a|a1:TextToolParameter(), a|a2:TextToolParameter(), b:TextToolParameter(), c|1|c1:TextToolParameter(),c|1|c2:TextToolParameter(), c|2|c1:TextToolParameter(),c|2|c2:TextToolParameter()} seperator is |, not / ''' if nestedDic is None or len(nestedDic) == 0: return {}; flatDic={} for key, value in nestedDic.iteritems(): if type(value) is DictType: dicRecur(key, value, flatDic); elif type(value) is ListType: listRecur(key, value, flatDic); elif value is None: flatDic[key]=None#TextToolParameter(None, XML( '<param name="' + str(key) + '" type="text" size="10" value="default" />' ) ) else: flatDic[key]=str(value) return flatDic def dicRecur(prefix, dic, flatDic): ''' ''' if dic is None or len(dic) == 0: raise ValueError, 'dic is empty' i=0; for key, value in dic.items(): if type(value) is DictType: #print key dicRecur(prefix+"|"+key, value, flatDic); elif type(value) is ListType: listRecur(prefix+"|"+key, value, flatDic); elif value is None: #print 'key',key #if (key.find('$')>-1): # vlist = key.split('$') # key = ''.join(vlist) #print 'key',key # flatDic[prefix+"|_"+str(i)+"|"+key]=None # i=i+1 #else: flatDic[prefix+"|"+key]=None#TextToolParameter(None, XML( '<param name="' + str(prefix) + '|' + str(key) + '" type="text" size="10" value="default" />' ) ) else: #print prefix #if (key.find('$')>-1): # vlist = key.split('$') # key = ''.join(vlist) # print 'key',key # flatDic[prefix+"|_"+str(i)+"|"+key]=None # i=i+1 #else: flatDic[prefix+"|"+key]=str(value) def listRecur(prefix, list, flatDic): '''''' #You are expecting this list to contain a complexType. #When it doesn't you raise a ValueError. #If the list contains a simpletype then we add |$| # when flatenning. if list is None or len(list)==0: flatDic[prefix+'|$|'] = []; return []; i=0 for value in list: if type(value) is DictType: #print prefix dicRecur(prefix+"|"+str(i), value, flatDic); #else:#if type(value) is ListType: # if prefix+'|0|' not in flatDic: # flatDic[prefix+'|0|'] = [] # flatDic[prefix+'|0|'].append(value) # return ; i += 1; def flat2nestedDict(flatDic): '''the flatDic has value in it converter it to nested dictionary''' if flatDic is None or flatDic=={}: raise ValueError, 'flatDic is empty' nestedDic = {}; for key, value in flatDic.iteritems() : key_arr = key.split('|'); print key_arr last_idx = len(key_arr) - 1; sub_dic = nestedDic; if last_idx != 0 : i = 0; # Iterates over the split values of a single key while i < last_idx : try : key_int = int(key_arr[i]); # checking if the split value of key is number (true only if it ) if key_int >= len(sub_dic) : for j in range(key_int - len(sub_dic) + 1) : sub_dic.append({}); sub_dic = sub_dic[key_int]; except ValueError : #If the split value is not present in thhe subdic if key_arr[i] == '$': print '$ is there'#,nestedDic else: if key_arr[i] not in sub_dic : try : key_int = int(key_arr[i + 1]); # Ckecking of the next split value in key is number # Executed if the key is or array type key sub_list = []; sub_dic[key_arr[i]] = sub_list; for j in range(key_int + 1) : sub_list.append({}); sub_dic = sub_list[key_int]; i += 1; except ValueError : # 2 consicutive split values in key are not numerical value (i.e not array) if key_arr[last_idx-1] == '$' : if i == last_idx-2 : print 'Found the value',key_arr[i] else: temp = {}; sub_dic[key_arr[i]] = temp; sub_dic = temp; else: temp = {}; sub_dic[key_arr[i]] = temp; sub_dic = temp; # If the split value is present in the subdir then create a new subdic with else : sub_dic = nestedDic[key_arr[i]]; i += 1; if value == '' : value = None; if key_arr[last_idx-1] == '$': templist=[]; if value != []: if value.find(',')>-1: vlist = value.split(',') for l in vlist: templist.append(l); else: templist.append(value); sub_dic[key_arr[last_idx-2]] = templist; else: sub_dic[key_arr[last_idx]] = value; # If the leaf node is basic array type #if key_arr[last_idx] == '': # sub_dic[key_arr[last_idx-2]].append(value); #else: # sub_dic[key_arr[last_idx]] = value; return nestedDic #testing this module only, before run below test, please comment line 6,30,33,50,53, and uncomment line 29,32,49,52, since they will use other modules of galaxy if __name__=="__main__": # nestedDic={'_params':{ '_program' : 'blastp', '_database' :'swissprot', '_email' :'riververy@yahoo.com', '_async': 1}, '_content':[{'_type':'sequence', '_content':'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa'},{'_type':'ss', '_content':'bbbbbbbbbbbbbbbb'}]} nestedDic={'_params':{ '_program' : 'blastp', '_database' :{'_string':[]}, '_email' :'riververy@yahoo.com', '_async': '', '_test':[{'_name':'chaithu'},{'_name':'srinivas'}]}, '_content':[{'_type':'sequence', '_content':'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa'},{'_type':'ss', '_content':'bbbbbbbbbbbbbbbb'}]} #flatdic = nested2flatDict(nestedDic) #print flatdic flatDic={'_parameters|_program': 'blastp', '_parameters|_stype': 'protein', '_parameters|_sequence': 'MKLSKRYRFWQKVIKALGVLALIATLVLVVYLYKLGILNDSNELKDLVHKYEFWGPMIFIVAQIVQIVFPVIPGGVTTVAGFLIFGPTLGFIYNYIGIIIGSVILFWLVKFYGRKFVLLF', '_email': 'chaitanya.g86@gmail.com', '_parameters|_database|_string|$|': 'uniprotkb,swissprot'} #{'_params|_email': 'riververy@yahoo.com', '_params|_database': 'swissprot', '_params|_async': '1', '_content|0|_type': 'sequence', '_content|1|_type': 'ss','_params|_program|0|': 'hrllo', '_content|1|_content':'bbbbbbbbbbbbbbbb', '_content|0|_content': 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa'} print flat2nestedDict(flatDic)