changeset 28:2a3fdec156e0

Deleted selected files
author m-zytnicki
date Mon, 29 Apr 2013 03:31:52 -0400
parents 4e7ee5683ef1
children c78966712a57
files SMART/Java/Python/.RData SMART/Java/Python/.Rhistory SMART/Java/Python/.gitignore SMART/Java/Python/CompareOverlapping.pyc SMART/Java/Python/CompareOverlappingSmallQuery.pyc SMART/Java/Python/CompareOverlappingSmallRef.pyc SMART/Java/Python/Cpp/Makefile SMART/Java/Python/Cpp/findOverlaps.cpp SMART/Java/Python/Cpp/genomicInterval.hpp SMART/Java/Python/Cpp/inputFileParser.cpp SMART/Java/Python/Cpp/inputFileParser.hpp SMART/Java/Python/Cpp/inputFileParser.o SMART/Java/Python/Cpp/interval.hpp SMART/Java/Python/Cpp/ncList.hpp SMART/Java/Python/Cpp/ncListCreator.cpp SMART/Java/Python/Cpp/ncListCreator.hpp SMART/Java/Python/Cpp/table.hpp SMART/Java/Python/Cpp/testIn.bed SMART/Java/Python/Cpp/testOut.bed SMART/Java/Python/GetUpDownStream.pyc SMART/Java/Python/TestFiles/SR1.fastq SMART/Java/Python/TestFiles/Wig/chr1.wig SMART/Java/Python/TestFiles/adress.txt SMART/Java/Python/TestFiles/clusterize_default_expected.gff3 SMART/Java/Python/TestFiles/clusterize_default_expected.map SMART/Java/Python/TestFiles/clusterize_normalize_expected.gff3 SMART/Java/Python/TestFiles/clusterize_output_tag_expected.gff3 SMART/Java/Python/TestFiles/clusterize_strands_expected.gff3 SMART/Java/Python/TestFiles/expOutputGff.gff3 SMART/Java/Python/TestFiles/expRef.fasta SMART/Java/Python/TestFiles/inputCR.gff3 SMART/Java/Python/TestFiles/inputFileTest1.bed SMART/Java/Python/TestFiles/inputFileTest2.bed SMART/Java/Python/TestFiles/inputMSWC1.gff3 SMART/Java/Python/TestFiles/inputMSWC2.gff3 SMART/Java/Python/TestFiles/inputMTC.sam SMART/Java/Python/TestFiles/inputMapping.map SMART/Java/Python/TestFiles/mapperAnalyzerExpected.gff3 SMART/Java/Python/TestFiles/mapperAnalyzerMappings.axt SMART/Java/Python/TestFiles/mapperAnalyzerOutput.gff3 SMART/Java/Python/TestFiles/mapperAnalyzerSequences.mfq SMART/Java/Python/TestFiles/sorted_file_oneline.gff3 SMART/Java/Python/TestFiles/sorted_query.gff3 SMART/Java/Python/TestFiles/sorted_query_wig.wig SMART/Java/Python/TestFiles/sorted_ref.gff3 SMART/Java/Python/TestFiles/testBedParser1.bed SMART/Java/Python/TestFiles/testC2S.fa SMART/Java/Python/TestFiles/testC2S.gff3 SMART/Java/Python/TestFiles/testCompareTranscriptListDistanceAntisense1.gff3 SMART/Java/Python/TestFiles/testCompareTranscriptListDistanceAntisense2.gff3 SMART/Java/Python/TestFiles/testCompareTranscriptListDistanceSimple1.gff3 SMART/Java/Python/TestFiles/testCompareTranscriptListDistanceSimple2.gff3 SMART/Java/Python/TestFiles/testDifferentialExpressionExpected.gff3 SMART/Java/Python/TestFiles/testDifferentialExpressionOutput.gff3 SMART/Java/Python/TestFiles/testDifferentialExpressionReference.gff3 SMART/Java/Python/TestFiles/testDifferentialExpressionSample1.gff3 SMART/Java/Python/TestFiles/testDifferentialExpressionSample2.gff3 SMART/Java/Python/TestFiles/testGffParser1.gff3 SMART/Java/Python/TestFiles/testPlot.gff3 SMART/Java/Python/TestFiles/testSW.gff3 SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptList1.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptList2.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListGetDifference1.gff3 SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListGetDifference2.gff3 SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeAggregation1.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeAggregation2.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeSenseAntiSenseAway1.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeSenseAntiSenseAway1_modif.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeSenseAntiSenseAway2.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeSimple1.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListMergeSimple2.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListSelfMerge1.gff3 SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListSelfMergeDifferentClusters1.bed SMART/Java/Python/TestFiles/testTranscriptListsComparatorCompareTranscriptListSelfMergeSense1.bed SMART/Java/Python/TestFiles/testTranscriptNormalize.gff3 SMART/Java/Python/TestFiles/test_distance.bed SMART/Java/Python/TestFiles/test_minoverlapp.bed SMART/Java/Python/__init__.pyc SMART/Java/Python/cleanGff.pyc SMART/Java/Python/genes.gtf SMART/Java/Python/getRandomRegions.pyc SMART/Java/Python/test/MockGetLetterDistribution.py SMART/Java/Python/test/Test_F_Clusterize.py SMART/Java/Python/test/Test_F_ClusterizeByTags.py SMART/Java/Python/test/Test_F_CollapseReads.py SMART/Java/Python/test/Test_F_CombineTags.py SMART/Java/Python/test/Test_F_FindOverlapsOptim.py SMART/Java/Python/test/Test_F_GetDifferentialExpression.py SMART/Java/Python/test/Test_F_GetFlanking.py SMART/Java/Python/test/Test_F_GetRandomSubset.py SMART/Java/Python/test/Test_F_GetSizes.py SMART/Java/Python/test/Test_F_RestrictFromCoverage.py SMART/Java/Python/test/Test_F_clusterizeBySlidingWindows.py SMART/Java/Python/test/Test_F_compareOverlapping.py SMART/Java/Python/test/Test_F_convertTranscriptFile.py SMART/Java/Python/test/Test_F_coordinatesToSequence.py SMART/Java/Python/test/Test_F_findTss.py SMART/Java/Python/test/Test_F_getExons.py SMART/Java/Python/test/Test_F_getLetterDistribution.py SMART/Java/Python/test/Test_F_getRandomRegions.py SMART/Java/Python/test/Test_F_getReadDistribution.py SMART/Java/Python/test/Test_F_getWigData.py SMART/Java/Python/test/Test_F_getWigDistance.py SMART/Java/Python/test/Test_F_getWigProfile.py SMART/Java/Python/test/Test_F_mapperAnalyzer.py SMART/Java/Python/test/Test_F_mappingToCoordinates.py SMART/Java/Python/test/Test_F_mergeSlidingWindowsClusters.py SMART/Java/Python/test/Test_F_mergeTranscriptLists.py SMART/Java/Python/test/Test_F_plot.py SMART/Java/Python/test/Test_F_plotCoverage.py SMART/Java/Python/test/Test_F_qualToFastq.py SMART/Java/Python/test/Test_F_restrictSequenceList.py SMART/Java/Python/test/Test_F_selectByTag.py SMART/Java/Python/test/Test_F_trimSequences.py SMART/Java/Python/test/Test_FindOverlapsOptim.py SMART/Java/Python/test/Test_FindOverlaps_optim.py SMART/Java/Python/test/__init__.py SMART/Java/Python/test/timeResults.R SMART/Java/Python/test3.gff3 SMART/Java/Python/testInstall.py SMART/Java/Python/testPC_unnamed transcript_coverage.png SMART/Java/Python/testPC_unnamed transcript_overlap.png SMART/Java/Python/tmpFile26845.R SMART/Java/Python/tmpFile26845.Rout SMART/Java/Python/tmpFile26845.dat
diffstat 124 files changed, 0 insertions(+), 111390 deletions(-) [+]
line wrap: on
line diff
Binary file SMART/Java/Python/.RData has changed
--- a/SMART/Java/Python/.Rhistory	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1 +0,0 @@
-install.packages("ggplot2")
--- a/SMART/Java/Python/.gitignore	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1 +0,0 @@
-/CleanTranscriptFile.py
Binary file SMART/Java/Python/CompareOverlapping.pyc has changed
Binary file SMART/Java/Python/CompareOverlappingSmallQuery.pyc has changed
Binary file SMART/Java/Python/CompareOverlappingSmallRef.pyc has changed
--- a/SMART/Java/Python/Cpp/Makefile	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,18 +0,0 @@
-#------------------------------------------------------------------------------
-OBJS=inputFileParser.o ncListCreator.o findOverlaps.o
-PROGRAM=findOverlaps
-CC=g++
-CFLAGS = -Wall -g
-#------------------------------------------------------------------------------
-
-
-all: $(PROGRAM)
-
-$(PROGRAM): $(OBJS)
-	$(CC) $(OBJS) -o $(PROGRAM)
-
-%.o: %.cpp
-	$(CC) $(CFLAGS) -c $<
-
-clean:
-	rm -rf $(OBJS) $(PROGRAM)
--- a/SMART/Java/Python/Cpp/findOverlaps.cpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,19 +0,0 @@
-#include <string>
-#include "inputFileParser.hpp"
-#include "ncListCreator.hpp"
-using namespace std;
-
-int main (int argc, char* argv[]) {
-    if (argc < 4) {
-        cout << "Usage: findOverlaps input1 output\n";
-        exit(0);
-    }
-    string inputFileName1 = string(argv[1]);
-    string inputFileName2 = string(argv[2]);
-    string outputFileName = string(argv[3]);
-    NCListCreator creator = NCListCreator(inputFileName1);
-//  InputFileParser ifp(inputFileName1, outputFileName);
-//  ifp.parse();
-    return 0;
-}
-
--- a/SMART/Java/Python/Cpp/genomicInterval.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,47 +0,0 @@
-#ifndef GENOMIC_INTERVAL_HPP
-#define GENOMIC_INTERVAL_HPP
-
-#include "interval.hpp"
-#include <stdio.h>
-#include <stdlib.h>
-#include <string>
-#include <sstream>
-
-class GenomicInterval: public Interval {
-
-    public:
-        string chromosome;
-
-        GenomicInterval(string chromosome = "", unsigned int start = 0, unsigned int end = 0): Interval(start, end), chromosome(chromosome) { }
-
-        bool onSameChromosome(const GenomicInterval &i) const {
-            return (chromosome == i.chromosome);
-        }
-
-//      friend bool operator==(const GenomicInterval &i1, const GenomicInterval &i2) {
-//          return ((i1.onSameChromosome(i2)) && (Interval::i1 == Interval::i2));
-//      }
-
-//      friend bool operator<(const GenomicInterval &i1, const GenomicInterval &i2) {
-//          return ((i1.onSameChromosome(i2)) && (Interval::i1 < Interval::i2));
-//      }
-
-        friend ofstream& operator<<(ofstream &stream, const GenomicInterval &i) {
-            stream << i.chromosome << '\t' << i.start << '\t' << i.end << '\n';
-            return stream;
-        }
-        
-        void parseFromLine(string &line) {
-            string strStart, strEnd;
-            istringstream iss(line);
-            getline(iss, chromosome, '\t');
-            getline(iss, strStart,   '\t');
-            getline(iss, strEnd,     '\t');
-            start = atoi(strStart.c_str());
-            end   = atoi(strEnd.c_str());
-            //cout << "read " << chromosome << ":" << start << ".." << end << endl;
-        }
-
-};
-
-#endif
--- a/SMART/Java/Python/Cpp/inputFileParser.cpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,134 +0,0 @@
-#include <algorithm>
-#include <set>
-#include <vector>
-#include <sstream>
-#include "inputFileParser.hpp"
-
-static const unsigned int MAX_SIZE = 10000;
-
-InputFileParser::InputFileParser(string inputFileName, string outputFileName): inputFileName(inputFileName), outputFileName(outputFileName) {
-    outputFilePrefix = outputFileName.substr(0, outputFileName.find_last_of('.'));
-}
-
-
-void InputFileParser::parse() {
-    ifstream file;
-    string line;
-    file.open(inputFileName.c_str());
-    if (file.is_open()) {
-        GenomicInterval genomicInterval;
-        while (file.good()) {
-            getline(file, line);
-            if (line.size() > 0) {
-                genomicInterval.parseFromLine(line);
-                addToList(genomicInterval);
-            }
-        }
-        syncFiles();
-        file.close();
-    }
-    else {
-        cout << "Unable to open file" << inputFileName;
-    }
-    merge();
-}
-
-
-void InputFileParser::addToList(GenomicInterval &genomicInterval) {
-    Interval interval (genomicInterval);
-    IntervalsType *intervals;
-    SortedIntervalsTypes::iterator iter = sortedIntervals.find(genomicInterval.chromosome);
-    if (iter == sortedIntervals.end()) {
-        intervals = new IntervalsType;
-        sortedIntervals[genomicInterval.chromosome] = intervals;
-    }
-    else {
-        intervals = iter->second;
-    }
-    //cout << "pushing " << interval.start << "-" << interval.end << endl;
-    intervals->push_back(&interval);
-    if (intervals->size() >= MAX_SIZE) {
-        writeTmpFile(genomicInterval.chromosome);
-    }
-}
-
-
-void InputFileParser::writeTmpFile(string &chromosome) {
-    SortedIntervalsTypes::iterator iter = sortedIntervals.find(chromosome);
-    IntervalsType *intervals = iter->second;
-
-    sort(intervals->begin(), intervals->end());
-    string fileName = getTmpName(chromosome);
-    ofstream file(fileName.c_str(), ios::out | ios::binary);
-    for (unsigned i = 0; i < intervals->size(); i++) {
-        cout << "writing " << (*intervals)[i]->start << "-" << (*intervals)[i]->end << endl;
-        (*intervals)[i]->writeBinary(file);
-    }
-    file.close();
-    ++counter[chromosome];
-    
-    sortedIntervals[chromosome] = NULL;
-    delete intervals;
-}
-
-
-void InputFileParser::syncFiles() {
-    for (SortedIntervalsTypes::iterator iter = sortedIntervals.begin(); iter != sortedIntervals.end(); iter++) {
-        string chromosome = iter->first;
-        writeTmpFile(chromosome);
-    }
-}
-
-
-string InputFileParser::getTmpName(const string &chromosome, unsigned int i) {
-    stringstream s;
-    s << outputFilePrefix << outputFilePrefix << "_tmp_" << chromosome << "_" << i << ".tmp";
-    return s.str();
-}
-
-
-string InputFileParser::getTmpName(const string &chromosome) {
-    return getTmpName(chromosome, counter[chromosome]);
-}
-
-
-void InputFileParser::merge() {
-    ofstream outputFile(outputFileName.c_str());
-    for (SortedIntervalsTypes::iterator iter = sortedIntervals.begin(); iter != sortedIntervals.end(); iter++) {
-        merge(iter->first, outputFile);
-    }
-}
-
-
-void InputFileParser::merge(const string &chromosome, ofstream &outputFile) {
-    ifstream *files = new ifstream[counter[chromosome]];
-    set<NumberIntervalType *> intervals;
-    for (unsigned int i = 0; i < counter[chromosome]; i++) {
-        string fileName = getTmpName(chromosome, i);
-        files[i].open(fileName.c_str());
-    }
-    for (unsigned int i = 0; i < counter[chromosome]; i++) {
-        if (files[i].good()) {
-            Interval interval;
-            interval.parseBinary(files[i]);
-            NumberIntervalType ni = NumberIntervalType(&interval, i);
-            intervals.insert(&ni);
-        }
-    }
-    while (! intervals.empty()) {
-        NumberIntervalType *ni = *intervals.begin();
-        GenomicInterval gi(chromosome, ni->first->start, ni->first->end);
-        outputFile << gi;
-        intervals.erase(intervals.begin());
-        if (files[ni->second].good()) {
-            Interval interval;
-            interval.parseBinary(files[ni->second]);
-            NumberIntervalType nni = NumberIntervalType(&interval, ni->second);
-            intervals.insert(&nni);
-        }
-    }
-    for (unsigned int i = 0; i < counter[chromosome]; i++) {
-        files[i].close();
-    }
-    delete[] files;
-}
--- a/SMART/Java/Python/Cpp/inputFileParser.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,45 +0,0 @@
-#ifndef INPUT_FILE_PARSER_HPP
-#define INPUT_FILE_PARSER_HPP
-
-#include <string>
-#include <vector>
-#include <map>
-#include "genomicInterval.hpp"
-
-typedef vector<Interval *> IntervalsType;
-typedef map<string, IntervalsType *> SortedIntervalsTypes;
-typedef map<string, unsigned int> CounterType;
-typedef pair<Interval *, unsigned int> NumberIntervalType;
-
-static bool operator<(const NumberIntervalType &i1, const NumberIntervalType &i2) {
-    if (i1.first < i2.first) return true;
-    return ((i1.first == i2.first) && (i1.second < i2.second));
-}
-
-class InputFileParser {
-
-    private:
-        SortedIntervalsTypes sortedIntervals;
-        CounterType counter;
-
-        void addToList(GenomicInterval &genomicInterval);
-        void writeTmpFile(string &chromosome);
-        void syncFiles();
-        string getTmpName(const string &chromosome, unsigned int i);
-        string getTmpName(const string &chromosome);
-        void merge();
-        void merge(const string &chromosome, ofstream &outputFile);
-
-    public:
-        string inputFileName;
-        string outputFileName;
-        string outputFilePrefix;
-
-        InputFileParser(string inputFileName, string outputFileName);
-
-        void parse(); 
-
-};
-
-#endif
-
Binary file SMART/Java/Python/Cpp/inputFileParser.o has changed
--- a/SMART/Java/Python/Cpp/interval.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,45 +0,0 @@
-#ifndef INTERVAL_HPP
-#define INTERVAL_HPP
-#include <iostream>
-#include <fstream>
-using namespace std;
-
-typedef unsigned int Position;
-
-class Interval {
-
-    public:
-        Position start;
-        Position end;
-
-        Interval(unsigned int start = 0, unsigned int end = 0): start(start), end(end) { }
-
-        Interval(Interval &i): start(i.start), end(i.end) { }
-
-        bool include(Interval &interval) {
-            return ((start <= interval.start) && (end >= interval.end));
-        }
-
-        void writeBinary(ofstream &stream) {
-            stream.write(reinterpret_cast<const char*>(&start), sizeof(Position));
-            stream.write(reinterpret_cast<const char*>(&end),   sizeof(Position));
-        }
-
-        bool parseBinary(ifstream &stream) {
-            stream.read(reinterpret_cast<char*>(&start), sizeof(Position));
-            stream.read(reinterpret_cast<char*>(&end),   sizeof(Position));
-            return (! stream.eof());
-        }
-
-        friend bool operator==(const Interval &i1, const Interval &i2) {
-            return ((i1.start == i2.start) && (i1.start == i2.end));
-        }
-
-        friend bool operator<(const Interval &i1, const Interval &i2) {
-            if (i1.start < i2.start) return true;
-            return ((i1.start == i2.start) && (i1.end > i2.end));
-        }
-
-};
-
-#endif
--- a/SMART/Java/Python/Cpp/ncList.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,20 +0,0 @@
-#ifndef NC_LIST_HPP
-#define NC_LIST_HPP
-
-#include "table.hpp"
-
-class NCList {
-
-    private:
-        Table *h, *l;
-
-
-    public:
-
-        NCList (Table *h, Table *l): h(h), l(l) {}
-
-
-};
-
-#endif
-
--- a/SMART/Java/Python/Cpp/ncListCreator.cpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,179 +0,0 @@
-#include "ncListCreator.hpp"
-
-NCListCreator::NCListCreator(string inputFileName): inputFileName(inputFileName) {}
-
-string NCListCreator::getFileName(string chromosome) {
-    return inputFileName.substr(0, inputFileName.find_last_of('.')) + "_" + chromosome + ".bed";
-}
-
-void NCListCreator::splitFile () {
-    Chromosomes chromosomes;
-    GenomicInterval interval;
-    map <string, ofstream> splittedFiles;
-    map <string, ofstream>::iterator it;
-    ifstream file;
-    string line, fileName;
-    string chromosome;
-    file.open(inputFileName.c_str());
-    if (file.is_open()) {
-        while (file.good()) {
-            getline(file, line);
-            if (line.size() > 0) {
-                interval.parseFromLine(line);
-                chromosomes.insert(interval.chromosome);
-                fileName = getFileName(interval.chromosome);
-                it = splittedFiles.find(interval.chromosome);
-                if (it == splittedFiles.end()) {
-                    ofstream outputFile;
-                    outputFile.open(fileName.c_str(), ios::out | ios::binary);
-                    interval.writeBinary(outputFile);
-                    splittedFiles[chromosome] = outputFile;
-                }
-                else {
-                    it->second << line << "\n";
-                }
-            }
-        }
-        file.close();
-        for (it = splittedFiles.begin(); it != splittedFiles.end(); it++) {
-            it->second.close();
-        }
-    }
-    else {
-        cout << "Unable to open file" << inputFileName;
-    }
-}
-
-void NCListCreator::run() {
-    for (Chromosomes::iterator it = chromosomes.begin(); splittedFiles != chromosomes.end(); splittedFiles++) {
-        buildLists(*it);
-    }
-}
-
-void NCListCreator::buildLists(string chromosome) {
-    createTables(chromosome);
-    labelLists();
-    computeSubStart();
-    computeAbsPosition();
-    cleanFiles();
-    transfer(chromosome);
-}
-
-void NCListCreator::createTables(string chromosome) {
-    initLists(chromosome);
-    h = new Table(H_CELL_SIZE, nbLists);
-    t = new Table(T_CELL_SIZE, nbLines);
-    l = new Table(L_CELL_SIZE, nbLines);
-    fillTables(chromosome);
-}
- 
-void NCListCreator::initLists (string chromosome) {
-    nbLists = 0;
-    nbLines = 0;
-    ifstream file;
-    file.open(getFileName(chromosome).c_str(), ios::in | ios::binary);
-    Interval currentInterval, previousInterval;
-    if (file.is_open()) {
-        while (file.good()) {
-            if (currentInterval.parseBinary(file)) {
-                nbLines++;
-                if (previousInterval.include(currentInterval)) {
-                    nbLists++;
-                }
-            }
-            previousInterval = currentInterval;
-        }
-    }
-    file.close();
-}
-
-void NCListCreator::fillTables (string chromosome) {
-    ifstream file;
-    file.open(getFileName(chromosome).c_str(), ios::in | ios::binary);
-    Interval currentInterval, previousInterval;
-    unsigned int i = 0;
-    if (file.is_open()) {
-        while (file.good()) {
-            if (currentInterval.parseBinary(file)) {
-                t->write(currentInterval.start, i, 0);
-                t->writeHere(currentInterval.end);
-                t->writeHere(-1);
-                t->writeHere(-1);
-            }
-            i++;
-        }
-        file.close();
-    }
-    t->write(SENTINEL, LIST, -1);
-    l->write(SENTINEL, LIST,  0);
-    t->write(SENTINEL, NEW,  -1);
-}
-
-void NCListCreator::labelLists () {
-    unsigned int nextL = 0, thisL, length;
-    unsigned int p;
-    Interval current, parent;
-    for (unsigned int i = 0; i < nbLines; i++) {
-        p = i - 1;
-        t->moveTo(p, 0);
-        parent.readBinary(t->file);
-        t->moveTo(i, 0);
-        current.readBinary(t->file);
-        while ((p != SENTINEL) && (! parent.include(current))) {
-            p = t->read(p, PARENT);
-            t->moveTo(p, 0);
-            parent.readBinary(t->file);
-        }
-        thisL = t->read(p, LIST);
-        if (thisL == SENTINEL) {
-            thisL = nextL;
-            nextL++;
-            length = 0;
-            t->write(p, LIST, thisL);
-        }
-        else {
-            length = h->read(thisL, LENGTH);
-        }
-        t->write(i, PARENT, p);
-        h->write(thisL, LENGTH, length+1);
-    }
-}
-
-void NCListCreator::computeSubStart () {
-    unsigned int total = 0;
-    for (unsigned int i = 0; i < nbLists; i++) {
-        h->write(i, START, total);
-        total += h->read(i, LENGTH);
-        h->write(i, LENGTH, 0);
-    }
-}
-
-void NCListCreator::computeAbsPosition () {
-    Value s, e, pt, hp, pl, nb, lp;
-    for (unsigned int i = 0; i < nbLines; i++) {
-        s = t->read(i,   START);
-        e  = t->read(i,  END);
-        pt = t->read(i,  PARENT);
-        hp = t->read(pt, LIST);
-        pl = t->read(pt, NEW);
-        nb = h->read(hp, LENGTH);
-        lp = h->read(hp, START) + nb;
-        t->write(i,  NEW,    lp);
-        l->write(lp, START,  s);
-        l->write(lp, END,    e);
-        l->write(lp, LIST,   SENTINEL);
-        l->write(lp, PARENT, pl);
-        h->write(lp, LENGTH, nb+1);
-        if (nb == 0) {
-            l->write(pl, LIST, hp);   
-        }
-    }
-}
-
-void NCListCreator::cleanFiles () {
-    t->destroy();
-}
-
-void NCListCreator::transfer (string chromosome) {
-    ncLists[chromosome] = NCList(h, l);
-}
--- a/SMART/Java/Python/Cpp/ncListCreator.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,57 +0,0 @@
-#ifndef NC_LIST_CREATOR_HPP
-#define NC_LIST_CREATOR_HPP
-
-#include "ncList.hpp"
-#include "table.hpp"
-#include "genomicInterval.hpp"
-#include <set>
-#include <map>
-
-typedef set<string> Chromosomes;
-typedef map<string, NCList *> NCLists;
-
-static const unsigned int H_CELL_SIZE = 2;
-static const unsigned int L_CELL_SIZE = 4;
-static const unsigned int T_CELL_SIZE = 5;
-
-static const unsigned int START   = 0;
-static const unsigned int END     = 1;
-static const unsigned int LIST    = 2;
-static const unsigned int PARENT  = 3;
-static const unsigned int NEW     = 4;
-static const unsigned int LENGTH  = 1;
-
-
-class NCListCreator {
-
-    private:
-        string inputFileName;
-        Table  *h, *l, *t;
-
-        string getFileName(string chromosome);
-        void buildLists(string chromosome);
-        void createTables(string chromosome);
-        void initLists(string chromosome);
-        void fillTables(string chromosome);
-        void labelLists();
-        void computeSubStart();
-        void computeAbsPosition();
-        void cleanFiles();
-        void transfer(string chromosome);
-        unsigned int nbLists, nbLines;
-
-
-    public:
-        Chromosomes chromosomes;
-        NCLists ncLists;
-
-        NCListCreator (string inputFileName);
-
-        void splitFile ();
-        void run ();
-
-};
-
-#endif
-
-
--- a/SMART/Java/Python/Cpp/table.hpp	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,84 +0,0 @@
-#ifndef TABLE_HPP
-#define TABLE_HPP
-
-#include <iostream>
-#include <fstream>
-#include <string>
-#include <stdio.h>
-using namespace std;
-
-typedef unsigned int Value;
-static const unsigned int SENTINEL = -1;
-
-class Table {
-    private:
-        int sentinel;
-        Value *values;
-
-    public:
-        string fileName;
-        unsigned int width;
-        unsigned int height;
-        fstream file;
-
-        Table (string fileName, unsigned int width, unsigned int height): sentinel(-1), fileName(fileName), width(width), height(height) {
-            file.open(fileName.c_str(), ios::out | ios::in | ios::binary);
-            Value v = 0;
-            for (unsigned int i = 0; i < width * height; i++) {
-                writeHere(v);
-            }
-            file.flush();
-            values = new Value[width];
-        }
-
-        ~Table () {
-            delete[] values;
-        }
-
-        void moveTo (unsigned int col, unsigned int line) {
-            if (col == SENTINEL) {
-                sentinel = line;
-            }
-            else {
-                sentinel = -1;
-                file.seekp((col * width + line) * sizeof(Value));
-            }
-        }
-
-        void write (Value v, unsigned int col, unsigned int line) {
-            moveTo(col, line);
-            writeHere(v);
-        }
-
-        void writeHere(Value v) {
-            if (sentinel >= 0)
-                values[sentinel] = v;
-            else
-                file.write(reinterpret_cast<const char*>(&v), sizeof(Value));
-        }
-
-        
-        Value read (unsigned int col, unsigned int line) {
-            moveTo(col, line);
-            return readHere();
-        }
-
-        Value readHere () {
-            if (sentinel >= 0) {
-                return values[sentinel];
-            }
-            else {
-                Value v;
-                file.read(reinterpret_cast<char*>(&v), sizeof(Value));
-                return v;
-            }
-        }
-
-        void destroy () {
-            file.close();
-            remove(fileName.c_str());
-        }
-
-};
-
-#endif
--- a/SMART/Java/Python/Cpp/testIn.bed	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,25 +0,0 @@
-arm_2R	15844993	15845110
-arm_2R	15845130	15845145
-arm_2R	15845456	15845471
-arm_2R	15845688	15845696
-arm_2R	15846253	15846278
-arm_2R	15847272	15847281
-arm_2R	15847296	15847324
-arm_2R	15847709	15847717
-arm_2R	15848021	15848030
-arm_2R	15848720	15848728
-arm_2R	15848918	15848963
-arm_2R	15849011	15849050
-arm_2R	15849065	15849104
-arm_2R	15849151	15849164
-arm_2R	15849748	15849756
-arm_2R	15849785	15849827
-arm_2R	15849861	15849978
-arm_2R	15849998	15850013
-arm_2R	15850181	15850209
-arm_2R	15850295	15850322
-arm_2R	15850357	15850376
-arm_2R	15850673	15850690
-arm_2R	15850717	15850760
-arm_2R	15850788	15850816
-arm_2R	15850961	15850974
--- a/SMART/Java/Python/Cpp/testOut.bed	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,26 +0,0 @@
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	15850961	15850974
-arm_2R	0	0
Binary file SMART/Java/Python/GetUpDownStream.pyc has changed
--- a/SMART/Java/Python/TestFiles/SR1.fastq	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,5000 +0,0 @@
-@HWI-EAS337_3:7:1:415:1217/1
-GATGTGCAGACTTTTCACGCAGGACTACATCACTGT
-+HWI-EAS337_3:7:1:415:1217/1
-WWWVVVWPWWWVWWWWVVVVKVPWWVVWVWUUQUTQ
-@HWI-EAS337_3:7:1:208:1489/1
-GGAAACATATGCACATAAACGTTGAAATCATGCTTA
-+HWI-EAS337_3:7:1:208:1489/1
-WWWWWWWWWWWWWWWWWVWWVWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:278:1153/1
-GAGAAAACCTGTAATAAATACTGAGAGAAAGTAGGG
-+HWI-EAS337_3:7:1:278:1153/1
-WWWWWWWWWWWWWWWWWWWWWWVWVVVWWVUUUUUR
-@HWI-EAS337_3:7:1:1178:755/1
-GGTGAGAGTGGTTGGTTGATGGTAAAACCATTGAAT
-+HWI-EAS337_3:7:1:1178:755/1
-WWWWWWWWWVWWWVVWWVVWVVVVWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:277:1259/1
-GGGTGACAAAGAAAACAAAAGGGACATGGTACTTGG
-+HWI-EAS337_3:7:1:277:1259/1
-WWWWWWWWWWWWWWWWWWWWWWVWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:447:1231/1
-GACTTGTGGAAGAGTTGGAATGGAAAGCTGGAGCCT
-+HWI-EAS337_3:7:1:447:1231/1
-WWWWWWWWWWWVWVWWWVWWWVVVVVVVVVURUSUU
-@HWI-EAS337_3:7:1:300:1199/1
-GTTTTTGCATATAGATCTCTTTGTAAAGATATCCAT
-+HWI-EAS337_3:7:1:300:1199/1
-WVWWWWWWWWWWWVWWWWWWWWQWVVVTWWUUUURU
-@HWI-EAS337_3:7:1:247:1210/1
-GATAGCTTTGACTATAGGACTTTTATGTATGTGTTG
-+HWI-EAS337_3:7:1:247:1210/1
-WWWWWWWWWWWWVWWWVVWWWWWWWWTVVWRULUUR
-@HWI-EAS337_3:7:1:1154:1517/1
-GAATGTTGCAGACCTTACTCCTACCTATGAAGCACA
-+HWI-EAS337_3:7:1:1154:1517/1
-WWWWWWWVWWVWWWWWWWWWWWWWVWVWVWUSUUUU
-@HWI-EAS337_3:7:1:164:1869/1
-GTTTGATAGGAATTTATTTCTTCTTCGACATCCACC
-+HWI-EAS337_3:7:1:164:1869/1
-WWWWWWWWVVWWWWWWWWWWWWWWWWQWWWUUUUUU
-@HWI-EAS337_3:7:1:415:1194/1
-GATGGTTGACACATTAAGAACATTCTCACCGGTCTC
-+HWI-EAS337_3:7:1:415:1194/1
-WWWWWWWWWWWWWWWWWVWVWVWWWWWWWVSUUUUU
-@HWI-EAS337_3:7:1:645:1892/1
-GATAGTAAGCACCCCTCACTTCCAACCCAAAGATTG
-+HWI-EAS337_3:7:1:645:1892/1
-WWWWWWWWWWWWWWWWWVWWWWWVVWVWWVUUUUUU
-@HWI-EAS337_3:7:1:33:1446/1
-GTTATTCTTTCTTTCTCAAATGGATGCAGTAATGCA
-+HWI-EAS337_3:7:1:33:1446/1
-WWWWWWWWWWWWWWWWWWWWWUQWWVVWQWUUUSUU
-@HWI-EAS337_3:7:1:1194:1427/1
-GAAAAATCACATTTTTTTGTTTGATAAAAACCCAGA
-+HWI-EAS337_3:7:1:1194:1427/1
-WWWWWWWWVWVWWWWWWWVWWWUWWWWWWWUUUUSU
-@HWI-EAS337_3:7:1:624:1913/1
-GACATCTTCAACTCCGGAGTTTTGAGTAACATTATA
-+HWI-EAS337_3:7:1:624:1913/1
-WWWWWWWWWWVWWWWVVVVWWWWVVVWWVWUUUUUU
-@HWI-EAS337_3:7:1:437:1202/1
-GTACTTATGATGAAACTGAGATCAACTACCACCTCC
-+HWI-EAS337_3:7:1:437:1202/1
-WWWWWVWWWVWVWWWWWWWWVWWWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1386:1787/1
-GTTTAGCTAGTATTAAGGCTAGAAATGGATATGATG
-+HWI-EAS337_3:7:1:1386:1787/1
-WWWWWWWWWWWWWWWWVVWWWVWVVWVVVWUUSUUO
-@HWI-EAS337_3:7:1:227:1155/1
-GATAGCAGCAAGGTTATTGGAATCTAAGCAATCTAC
-+HWI-EAS337_3:7:1:227:1155/1
-WWVWWVWWVVWVVIWVWVVUWVVVVWVTVVUUUUSU
-@HWI-EAS337_3:7:1:472:1025/1
-GAAGTGATACTCATAAAACTATTTAGAAAGTTAATT
-+HWI-EAS337_3:7:1:472:1025/1
-WWWWWWWWWWWWWWWVWVWWWWWWVVWWWVUUUUUU
-@HWI-EAS337_3:7:1:220:1482/1
-GCTATATGAGAATTCAGGCCACTTGTAGTTCGATAA
-+HWI-EAS337_3:7:1:220:1482/1
-WWWWWWWWWVWWWWWWWVWWWWWWWWVVWWURUUUU
-@HWI-EAS337_3:7:1:1699:1966/1
-GATGAAGGATACTACAAAAAAAAGGGTTATTTTGTG
-+HWI-EAS337_3:7:1:1699:1966/1
-WWWWWWWWWWWWWWWWVWVWWWWWWWVWWWUUUSUR
-@HWI-EAS337_3:7:1:547:1084/1
-GTGGTCAGGTCCTCTTCAAGTGATACAATGTTCCCC
-+HWI-EAS337_3:7:1:547:1084/1
-WWWWWWWWWWWWWWWWWWVVWVWWWWWWWVUUUUSU
-@HWI-EAS337_3:7:1:464:1097/1
-GAAATTGAAGCTAGTTATTGACAGTTTACCAAGTTA
-+HWI-EAS337_3:7:1:464:1097/1
-WWWWWWWWWWWVWWVWWWWWWWWVVWWWWVUUUUUR
-@HWI-EAS337_3:7:1:171:1480/1
-GATAATACTATTAGCACATCAGCCTCTAGATGAGAC
-+HWI-EAS337_3:7:1:171:1480/1
-WWWWWWWWWWWWWVWWWWWWWVWWWWWWTVUUUUUU
-@HWI-EAS337_3:7:1:293:1251/1
-GTGGTAGTGAGCTCCGTGGTGAACAAGATGACGGAA
-+HWI-EAS337_3:7:1:293:1251/1
-WWWWWWWVWVWWWWVVWWVVVVVVWVVVVVRPUURR
-@HWI-EAS337_3:7:1:647:1863/1
-GGGTTTCAGATTAGTAAGTTATAGTGAAAAAATATA
-+HWI-EAS337_3:7:1:647:1863/1
-WWVWWWWWVWWWWVWWVVWWWWWWWVWVVWUUUUUU
-@HWI-EAS337_3:7:1:263:1275/1
-GCTACGTCTGCTCTAACTCCTAATATGATCCTGTAT
-+HWI-EAS337_3:7:1:263:1275/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWQVWWUUOUUU
-@HWI-EAS337_3:7:1:1112:215/1
-GGTGTTGATTTCACAAGGAGGAATACTCATCTAAAA
-+HWI-EAS337_3:7:1:1112:215/1
-WWVWWVVWVVWWWVWWVUWVVVWWWVWTVWUUUUUU
-@HWI-EAS337_3:7:1:319:1275/1
-GTTATAGTTCTTGACAACAAAGTACAGAGGTGGTCC
-+HWI-EAS337_3:7:1:319:1275/1
-WWWWWWWWWWWWVWWWWWWWWWWWWWVWVWUUSUUU
-@HWI-EAS337_3:7:1:1310:1480/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGTAA
-+HWI-EAS337_3:7:1:1310:1480/1
-WWWWWWWWWWVVWWVWWVVVUWTRVVVRVPUCUMJO
-@HWI-EAS337_3:7:1:1203:1470/1
-GTGATATCTTTAACTAATTCTTCACGCATCTTTTCT
-+HWI-EAS337_3:7:1:1203:1470/1
-WWVWWWWWWVWWWWVWWWVVWWWWVVWWWVUSUUUU
-@HWI-EAS337_3:7:1:415:1242/1
-GACACATTATAAAATGATTAACAGACAGAAAGTACC
-+HWI-EAS337_3:7:1:415:1242/1
-WWWWVWWWWWWWWWWWWWVWWTWVWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1160:1471/1
-GTAGTTGTGGAGAATGGTGCTTGCTTGGGTTGTTTA
-+HWI-EAS337_3:7:1:1160:1471/1
-WWVVWVWWWVWVWWUVVVVJWUUVWWTTTVURUSSO
-@HWI-EAS337_3:7:1:42:1475/1
-GTTAAATGAGTTTAATGAATTAAATTAGTCTATATT
-+HWI-EAS337_3:7:1:42:1475/1
-WWWWWWWWWVWWWWWWWWWWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:155:1439/1
-GAAGAGAAGCCAGATACTCAGTCTCATGGTGGCGAA
-+HWI-EAS337_3:7:1:155:1439/1
-WWWWWWWWVWWWVWWWWWWWVWWWWWWVTVSSUUUR
-@HWI-EAS337_3:7:1:1164:1447/1
-GGAGAGGAAAGTGAAATTTAGGTTTAGACTTCGTTT
-+HWI-EAS337_3:7:1:1164:1447/1
-WWWWWWWWWWWWWWWWWWWWVVWWWVVVVWUURUUU
-@HWI-EAS337_3:7:1:277:1169/1
-GGTTAAGCACAGCTGCACCAGCCAAAGCAGCAGAGC
-+HWI-EAS337_3:7:1:277:1169/1
-WWWWWWWWWWWWWWVWWWWVWWWWVVWVVWUUUUUU
-@HWI-EAS337_3:7:1:359:1249/1
-GCTACATGTTTATGTGAGAAATATTATTTCAGTTGT
-+HWI-EAS337_3:7:1:359:1249/1
-WWWWWWWWWWWWWVWVWVWWWWWWWVWWWWUQUURU
-@HWI-EAS337_3:7:1:1230:1425/1
-GAATTCTGCGGCTAACTGTGGCATCGTGCAGCTGAT
-+HWI-EAS337_3:7:1:1230:1425/1
-WWWWWWWWWWWWVWVWWVWVWWWWWVWWWVUUSURU
-@HWI-EAS337_3:7:1:1526:1772/1
-GGATAATTCATCATAAAATAGACCTTAGGGCAGTAG
-+HWI-EAS337_3:7:1:1526:1772/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1171:720/1
-GTTGATTGCGGAATAATATTTGCTTTTTTAGTTTTC
-+HWI-EAS337_3:7:1:1171:720/1
-WWWWWWWVWWWWWWWWVWWWWVWWWWWWWVCUUUUR
-@HWI-EAS337_3:7:1:1663:896/1
-GTTGGGTTGGTTGAGCGAGAGGATTTTGCATCTGGT
-+HWI-EAS337_3:7:1:1663:896/1
-WWWWWWWWWVWWWWVWWWWWVWVWWWWWVVUUUUSU
-@HWI-EAS337_3:7:1:382:1159/1
-GTGATAGGACCATTCCATAGTTTAGATGTATAATTG
-+HWI-EAS337_3:7:1:382:1159/1
-WWWWWWVWWWWWWWWWWWVVWWWWVVWTVVUURUUR
-@HWI-EAS337_3:7:1:113:1855/1
-GAATTTCAGCTTGCAAACTGTTTGGCTTTCCATTCA
-+HWI-EAS337_3:7:1:113:1855/1
-WWWWWWWWVWWWVWWWWWWVWWWVUWWWWVUUUUUR
-@HWI-EAS337_3:7:1:1356:1757/1
-GTACTGAAAGATATGATAATATACATTGTTTGACTT
-+HWI-EAS337_3:7:1:1356:1757/1
-WWWWWWWWWWWVWWWWWWWWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:124:757/1
-GATACATAACACAATCAGTTGATCGAAACAAAACCA
-+HWI-EAS337_3:7:1:124:757/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1211:751/1
-GAAAGGTTAAGGCAAGGCCTGCTTAGTAAACAGGGA
-+HWI-EAS337_3:7:1:1211:751/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:524:840/1
-GTGTAGTTGGCTTCATATCAATTGACGGATGTTTCA
-+HWI-EAS337_3:7:1:524:840/1
-WWWWWWWWWVWWWWWWWWWWWWWWWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:478:1078/1
-GTTAAGTGTGGAAATGAGAAGTTCTAATAGTACTTG
-+HWI-EAS337_3:7:1:478:1078/1
-WWWWWWWWWVVWWWWVWWVWVWWWWWVWVQUUUUUO
-@HWI-EAS337_3:7:1:1250:656/1
-GAAGTTTTTTTAACGAGTGCACACGTTAGAACTCGC
-+HWI-EAS337_3:7:1:1250:656/1
-WVVWWWWWWWWWWWVWUWVWWWWWVWWWVVURUURU
-@HWI-EAS337_3:7:1:1301:1484/1
-GTTGCGGAAGGAGCAAAGGCATTGTATGTAGTGTCA
-+HWI-EAS337_3:7:1:1301:1484/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1036:1425/1
-GGTTGTCAAGCGTTCAGCTCGAGATATATAATGTGA
-+HWI-EAS337_3:7:1:1036:1425/1
-WWWWWWWWWVWVWWWWVWWVWVVVWVWVWVUUSUSU
-@HWI-EAS337_3:7:1:165:1435/1
-GAGCAAAAGGGGTTGTGACTCTTGAAGAGCTGAAGA
-+HWI-EAS337_3:7:1:165:1435/1
-WWWWWWWWWWWWWWWWVWWWWWWUWWVWTWUSUUUU
-@HWI-EAS337_3:7:1:612:13/1
-GGTAACATAGAGGAGGAAATATGGTGAAAACTTGAA
-+HWI-EAS337_3:7:1:612:13/1
-WWWWWWWWWVWVWWVVWWWWWWVVWVVVVWUUUUUR
-@HWI-EAS337_3:7:1:485:1045/1
-GTAACTTTATTTTATAATTTTTGATTTTTATCCGAA
-+HWI-EAS337_3:7:1:485:1045/1
-WWWWWWWWWWWWWWWWWWWWWWQWWWWWWWCUUQUU
-@HWI-EAS337_3:7:1:609:1117/1
-GCAATTACAATAACAGGAAATACATCTAGCAGACTT
-+HWI-EAS337_3:7:1:609:1117/1
-WWWWWWWWWWVWWWWWWWWWWWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:1182:1510/1
-GGGAACCTAAAAGGCAAAATGAATTGAGTCTGTATT
-+HWI-EAS337_3:7:1:1182:1510/1
-WWWWWWVWWVWWWWWWWWWWWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1530:1678/1
-GTTTTCAAACACAAACTACTTCTCCTAAAGCGGAAG
-+HWI-EAS337_3:7:1:1530:1678/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVVUSRUUR
-@HWI-EAS337_3:7:1:1745:324/1
-GATTAATTATTTGAAGTCATTCCTACTCATTCATTC
-+HWI-EAS337_3:7:1:1745:324/1
-WWWWWWWWWWWWWWWVVWWWWWWWVWWWVWUUUUUU
-@HWI-EAS337_3:7:1:429:1239/1
-GGAATTGCATCTTTGATGGTAAGTTGTGTATCCTGT
-+HWI-EAS337_3:7:1:429:1239/1
-WWWWWWWWWWWWWWVWWUVWWVVWWVWVWVUUUUKU
-@HWI-EAS337_3:7:1:232:1413/1
-GAAATATTAAATCAAGTTGATCAAAACACAAGTGAT
-+HWI-EAS337_3:7:1:232:1413/1
-WWWWWWWWWVWWWWVVWWVWWWVWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:297:1179/1
-GGATTTATGAGTTGCAACTAATGAGGTACAATATTC
-+HWI-EAS337_3:7:1:297:1179/1
-WWWVWWWWVWWWWVWWWWWWWWVWVTWVWWUUUUUU
-@HWI-EAS337_3:7:1:625:1863/1
-GTCAGTAATCTCGTTAGTGTGAGAGAAACAATTCTA
-+HWI-EAS337_3:7:1:625:1863/1
-WWWWWWWWWWWWVWWVVWVWVWVVVWWWVVUUUSUU
-@HWI-EAS337_3:7:1:130:1853/1
-GGTTGGGTGGGTAGAGCGGAGGTTGGAAGAGAGTTT
-+HWI-EAS337_3:7:1:130:1853/1
-WWWWWWWWWWWWWWWWWWVWWWVVQVCVWVUQUJUU
-@HWI-EAS337_3:7:1:736:505/1
-GCGTCTTTGCATAGATCAGAATTCAGATGTGACATT
-+HWI-EAS337_3:7:1:736:505/1
-WWWWWWWWWWWWWWVWWWVWWWWWVVWVWVSUUUUU
-@HWI-EAS337_3:7:1:281:1207/1
-GAAAATCACAAAAGGGGGTTGAGGAGCAATCCTTCC
-+HWI-EAS337_3:7:1:281:1207/1
-WWWWWWWWWWWWWWWWWWWWWVVVWVVWVWUUUUUU
-@HWI-EAS337_3:7:1:69:689/1
-GTTTGTATCACCCCATTACAATATGAGTTAACCAGG
-+HWI-EAS337_3:7:1:69:689/1
-WWWWWWWWWWWWWWWWWWWVVWVWVVVWWVUUUUSR
-@HWI-EAS337_3:7:1:600:1107/1
-GAAATTTAGAATAACGATTTAAACTGATAATACTAA
-+HWI-EAS337_3:7:1:600:1107/1
-WWWWWWWWWWWWWWWVWWWWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:214:1554/1
-GAAGGATTACACTATCCTGTTCTTTCCCTGAATAAC
-+HWI-EAS337_3:7:1:214:1554/1
-WWWWWWWVWWWWWWWWWWWWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:345:1266/1
-GTCACGTTTGTTTTGTTCTCTCTTCTTCTTTTTTTT
-+HWI-EAS337_3:7:1:345:1266/1
-VWWVWWWVWVWVWWQWWVWVWVVWVCWVVWUUUUUU
-@HWI-EAS337_3:7:1:1141:1435/1
-GATCTGATTTTAGTTTTTGGAAGATGCAGATCAAAG
-+HWI-EAS337_3:7:1:1141:1435/1
-WWWWWWWWWWWWWWWWWWUVVWVWWVVVVWUUUUUR
-@HWI-EAS337_3:7:1:741:656/1
-GAAAATAAATAGATTTTTAAATGTGATGAATGAATG
-+HWI-EAS337_3:7:1:741:656/1
-WWVWWWWWWWWWWWWWWWWWWWVWVVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1268:1529/1
-GCAAGTGCAAATTTTCTTATGATTCTGAGAATATTC
-+HWI-EAS337_3:7:1:1268:1529/1
-WWWWWWWWWWWWWWWWWWWWUWWWWWVWVWUUUUUU
-@HWI-EAS337_3:7:1:1172:191/1
-GGTTGTAAAACTAATTTGTAGTATGTGTTCTTTGTG
-+HWI-EAS337_3:7:1:1172:191/1
-WWWWWWWWWWWWWWWWWWWWVWWWTWVWWWUUURUR
-@HWI-EAS337_3:7:1:1170:753/1
-GGATATAGAAGAATCATGTAGCCAATACATTTTAGT
-+HWI-EAS337_3:7:1:1170:753/1
-WWWVSSWVWVWVSKQSQWVQSWVVVWOHVHUUTCSU
-@HWI-EAS337_3:7:1:69:1528/1
-GATTATTTATCCCATCAAGGGATAAGTTATCTCATA
-+HWI-EAS337_3:7:1:69:1528/1
-WWWWWWWWWWWWWWWWWWVVWWWWWVWWVWUUUUUR
-@HWI-EAS337_3:7:1:1293:1519/1
-GGCAATATTTGGAGAAGGGTAAGCTCTGATCCCATT
-+HWI-EAS337_3:7:1:1293:1519/1
-WWWWVWWWWWWVWVWVVVWVWVWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1139:1498/1
-GTTTCAGATGACACATTCCTATTATTATTGCGATTC
-+HWI-EAS337_3:7:1:1139:1498/1
-WWWWWWVWWVWWWWWWWWWWVWWVWWWWWQUQUUUR
-@HWI-EAS337_3:7:1:470:619/1
-GTTTAAGGGCTTTGTGGTCATTTCACTAAGCTAATT
-+HWI-EAS337_3:7:1:470:619/1
-WWWWWWVVVWWWWWWVVWWWWWWVVVWVVVUUUUUU
-@HWI-EAS337_3:7:1:373:2009/1
-GTGAAAGCTCAAACATGTACTCCTGGTCAAATCAAT
-+HWI-EAS337_3:7:1:373:2009/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVVWWTUUUUUU
-@HWI-EAS337_3:7:1:1254:1464/1
-GATTTCATTGCTAGAATTGAAACTAGTATAGATAAA
-+HWI-EAS337_3:7:1:1254:1464/1
-WWWVWWWSWWWWWVWWWWVWVVWWWWWWWWTUUUUU
-@HWI-EAS337_3:7:1:549:868/1
-GTAGGAATCACGTTTAGTAGGTAGAAGACCCTGCAT
-+HWI-EAS337_3:7:1:549:868/1
-WVWWWWWWWWWWWVWVWVVVVWWWVVWVVVUUUUUU
-@HWI-EAS337_3:7:1:364:1210/1
-GAAGAAGATCATCGGCGACCTTAATCCGCCACCCCA
-+HWI-EAS337_3:7:1:364:1210/1
-WWWWWWWWWWWWWWWWWVVWVWWVVVVVVVPRSSRG
-@HWI-EAS337_3:7:1:553:889/1
-GAGGAGTCACTGTCTCATTGAGAAATCTGTTTGTTT
-+HWI-EAS337_3:7:1:553:889/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWWWUUSUUU
-@HWI-EAS337_3:7:1:144:757/1
-GGTATGCACAAGACAAATGGATACTCACAACTGTTG
-+HWI-EAS337_3:7:1:144:757/1
-WWWWWWWVWWVWWVWVVWWWVWWWWVWWWVUUUUUR
-@HWI-EAS337_3:7:1:355:1152/1
-GTAACGTTTATGGAATCTACATAATTCATTATTAGA
-+HWI-EAS337_3:7:1:355:1152/1
-WWWWWWWWWWVWVWWWVWWWWWWWWWWWWWUUUUSU
-@HWI-EAS337_3:7:1:1748:310/1
-GAATTAGCTCATTTGAAAAATACATAGTGTGAGAAA
-+HWI-EAS337_3:7:1:1748:310/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWTVVVSUQUUU
-@HWI-EAS337_3:7:1:37:1418/1
-GTCTCGTATGAAGTGATATCGGACGTCAATGTGCTT
-+HWI-EAS337_3:7:1:37:1418/1
-WWWWWWWWWVWWVWVWWWWWUWWWVVVVVVUOSUSU
-@HWI-EAS337_3:7:1:203:1371/1
-GTCAAACTACATCGTATAAAATGGAATGGAGGAGTA
-+HWI-EAS337_3:7:1:203:1371/1
-WWWWWWWVWWWWWWVWWWWWWWVVWWWVTWSSUUUU
-@HWI-EAS337_3:7:1:1177:1504/1
-GAGTCATTCATAGGCTGGACAAGATCAAGATATCTT
-+HWI-EAS337_3:7:1:1177:1504/1
-WWWWWWWWWWWWVVWWVVWVVVVWWVRVVVUUUUUU
-@HWI-EAS337_3:7:1:1115:793/1
-GTGAGGGTAGTTGTTGGCTTTTTGTTGTATCAAAAG
-+HWI-EAS337_3:7:1:1115:793/1
-WWWWWWWWWVWWVWWVVWWWWWWQWWQWVWUUSURO
-@HWI-EAS337_3:7:1:300:1224/1
-GAGCTCATTATTTATGTGTATGTCAAGGACTTCGAG
-+HWI-EAS337_3:7:1:300:1224/1
-WWWWWWWWWWWWVWWVWVWWWUWWWVTVVVUUUQUO
-@HWI-EAS337_3:7:1:752:443/1
-GGAGTAGGATCATGAATCCAGATTCCATGTATAAAT
-+HWI-EAS337_3:7:1:752:443/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWVWUUUUUU
-@HWI-EAS337_3:7:1:418:1258/1
-GTTGATCTTTTTGTTTTTCTTATTCTGGTAACCAAG
-+HWI-EAS337_3:7:1:418:1258/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWJTWWUUUUUR
-@HWI-EAS337_3:7:1:1150:707/1
-GATGTTGCTGTGTTGCATATTGATGCACCAAAAGAC
-+HWI-EAS337_3:7:1:1150:707/1
-VVWWVWVWWVVVWWVVVVWWWVVWTVVVVVUUUUSF
-@HWI-EAS337_3:7:1:288:1309/1
-GTAATGTCTGCGTACACACCTCCCTTCCTAAACCTC
-+HWI-EAS337_3:7:1:288:1309/1
-WWWWWVWWWVWVWWWVWWWWWWWWWVWWVVRUUUUU
-@HWI-EAS337_3:7:1:48:979/1
-GTGAAGAAGGAAAAACTGTAGATACCAAGCTTTTTG
-+HWI-EAS337_3:7:1:48:979/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVWUUUUUR
-@HWI-EAS337_3:7:1:1152:1444/1
-GAACTTGCCTACTGACATAGGCGGAACAAATTCATA
-+HWI-EAS337_3:7:1:1152:1444/1
-WWWWWWWWWWWWWWWWVWWWWWVWVWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1216:652/1
-GAGAAATGATATTCAGAATCTAACATCATAAGTTTC
-+HWI-EAS337_3:7:1:1216:652/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1286:1534/1
-GCTGAGCTAACTTAGCAATCTCATTTGGAACAGAAG
-+HWI-EAS337_3:7:1:1286:1534/1
-WWWWWWWWWWWWWWVWWVWWWWWWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:539:835/1
-GATTCAAGCTACCATGAAAGACATCATGTCCTTACT
-+HWI-EAS337_3:7:1:539:835/1
-WWWWWWWWWWWWWWVWWVVWWWVVVVWWRVUUUUUU
-@HWI-EAS337_3:7:1:1143:224/1
-GTGAAGAAGAAGAAGAAGAAGAAGGAAAAGAATTCA
-+HWI-EAS337_3:7:1:1143:224/1
-WWWVWWSWWWWVVWVWVVWWVVVVWWWSWVUUUOUU
-@HWI-EAS337_3:7:1:1166:181/1
-GTTTGTTTCCTTTTAGTTTATTCTTTGTCATCATGA
-+HWI-EAS337_3:7:1:1166:181/1
-VVWWVWVVWWWVWVVQWVWWVWVWWWQVVWUURSQU
-@HWI-EAS337_3:7:1:669:30/1
-GCAAGCACTTTTACCTTTACTAATATGAGGTAGTAG
-+HWI-EAS337_3:7:1:669:30/1
-WWWWWWVVWWWWWVWWWWWVWVVWWVVVWWUUUUUR
-@HWI-EAS337_3:7:1:631:1894/1
-GGTATGATATCACTTGAAGAAGATAAACAGATGAAG
-+HWI-EAS337_3:7:1:631:1894/1
-WWWWWWWWWWWWVWWWVVVWWVWWWVVWVVUUUUUR
-@HWI-EAS337_3:7:1:99:1883/1
-GGTTACTGTTGTTGCTGCGATTAGCAGTTCCCGTGG
-+HWI-EAS337_3:7:1:99:1883/1
-VWWWWWWVVWVVWUWWVVUWWWWQVWKQWOSRSURR
-@HWI-EAS337_3:7:1:1174:1531/1
-GGTGATCCTTCACTCCTTGGTCTTGAAGAAGTTTTG
-+HWI-EAS337_3:7:1:1174:1531/1
-WVVWWWVWVVWVWWWVVWWVWWWVVVVVWVSUUUUK
-@HWI-EAS337_3:7:1:1358:1770/1
-GTATGTTCATTTCCTCGTGACTGTGAGTAGAACATT
-+HWI-EAS337_3:7:1:1358:1770/1
-WWWWWVWVWWWWWWWWVWWWVWVWVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:991:1624/1
-GATTTGTCGTCAGTTAGAGGTCATCGGTAGGATGAT
-+HWI-EAS337_3:7:1:991:1624/1
-WWWWWWWWPVWWWWWWVVVSWWWWVSVWVVQFUULU
-@HWI-EAS337_3:7:1:65:1436/1
-GGTACAGGTGATCCCTTATAAAACACAGGACATGGA
-+HWI-EAS337_3:7:1:65:1436/1
-WWWWWWWWWVWWWWWWWWWWWWWWWWWVVWUUUUSU
-@HWI-EAS337_3:7:1:102:1419/1
-GTTAATTTTACAGGGTTATTCAACATTTGAGGTAAC
-+HWI-EAS337_3:7:1:102:1419/1
-WWWWVWWWWWWWVVWWWWWWWWWWWWWWVWQUUUUU
-@HWI-EAS337_3:7:1:582:1116/1
-GAATCAGAATCTGAATCAGATTCTGTCGCCATCTGA
-+HWI-EAS337_3:7:1:582:1116/1
-WWWWWWWWWWWWWWVWWWVWWWWWVWWVVVUUUUSR
-@HWI-EAS337_3:7:1:419:1182/1
-GGACAGCGACTGTTCAATCGAATATTTATCAAGTAT
-+HWI-EAS337_3:7:1:419:1182/1
-WWWWWWWWWWWWWWWWWWWVWVWTWVWVVVUUURUU
-@HWI-EAS337_3:7:1:479:1056/1
-GACTTAAGGTGTCAAATAATACCAAAACTCTAGGTC
-+HWI-EAS337_3:7:1:479:1056/1
-WWWWWWWWWWWWWWWWWWWWWWWVVVVVWWUUUUUU
-@HWI-EAS337_3:7:1:1040:182/1
-GAAAAGGGCAAACTCCTAAATCCCAGTTCGAAGCTG
-+HWI-EAS337_3:7:1:1040:182/1
-WWWWWWWWWWWWWVWWWWWVWVWVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:538:1054/1
-GAAACAGTTTCTCAACCTCCAGAAATTAATGATAAG
-+HWI-EAS337_3:7:1:538:1054/1
-WWWWWVWWWWWWWWWWWWWWVVVVVWWWWWUUUUUR
-@HWI-EAS337_3:7:1:9:1489/1
-GATGATGATATTGTACATTGTGTGGGAGCAGAGCGG
-+HWI-EAS337_3:7:1:9:1489/1
-WWWWWWWWWWWWVWWWWWWUWVWVVQVVVWSUSUSR
-@HWI-EAS337_3:7:1:4:1451/1
-GAAATAACGATGACATAATATGCTTGTCTGCGACCT
-+HWI-EAS337_3:7:1:4:1451/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWWWTUUUUUR
-@HWI-EAS337_3:7:1:141:1433/1
-GGTAGTGAAATTCATGCCTGTGTTGTGAAGCTTGGT
-+HWI-EAS337_3:7:1:141:1433/1
-WVWWVWVWVWWVWWWVWVWVWQWWUWQVVTUUUSQU
-@HWI-EAS337_3:7:1:1539:1723/1
-GAAAATTATTTCATCCCAAATAGTGTTATAGTGGAT
-+HWI-EAS337_3:7:1:1539:1723/1
-WWWWWWWWWWWWWWWWWWVWWWVWVWWWWWSURRUU
-@HWI-EAS337_3:7:1:536:1087/1
-GGACGTTTTCACCATTTATGCATTATTTTACATATT
-+HWI-EAS337_3:7:1:536:1087/1
-WWWWWWWWWVWWWWWWWWWVWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1378:1773/1
-GGAGAGTTCGAGCAACGTAGCCAAATAGATGGAAAA
-+HWI-EAS337_3:7:1:1378:1773/1
-WWWWWWWWWWWVWWWWWWVWWWWVWWVWVWUUUUUU
-@HWI-EAS337_3:7:1:1106:822/1
-GAGTGCTTTTAAAGCTCCACTTGATCCAAATACTGC
-+HWI-EAS337_3:7:1:1106:822/1
-WWWWWWWWWWWWVVWWWWVWWWVWWVVVVVUUUURR
-@HWI-EAS337_3:7:1:942:795/1
-GTGGCCTAAATGTACAGCAGTAATCCTTCATGCTTA
-+HWI-EAS337_3:7:1:942:795/1
-WWWWWWWWWWWWWWWWWWWVWWWWWWWWWWUUUUUR
-@HWI-EAS337_3:7:1:1053:1567/1
-GTTTGAGTTATAATTTATGTGATTTTTATTTTTTTT
-+HWI-EAS337_3:7:1:1053:1567/1
-WWWWVWWWWWWWWWWWWWVWUWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1656:111/1
-GTTTTCACCATTTATGCATTATTTTACATATTTAAA
-+HWI-EAS337_3:7:1:1656:111/1
-WWWWWWWWWWVWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:861:1934/1
-GTAGAGGAGGTAGGCTTGGGGGTCCCTTTATGGTAA
-+HWI-EAS337_3:7:1:861:1934/1
-WWWWWWWVWWWWWWVWWUWJWVKRVWRDVVUOUCUR
-@HWI-EAS337_3:7:1:607:896/1
-GGTATGATTTGATCGGTTAATTTTTTCAATTTCAAT
-+HWI-EAS337_3:7:1:607:896/1
-WVWWWWWWWWVWWWWWWWWWWWWVWWVVVWUUUUCU
-@HWI-EAS337_3:7:1:1038:218/1
-GGTTAATGGAAATTTCTTTGACGAAAGGGATTCACT
-+HWI-EAS337_3:7:1:1038:218/1
-WWWWWWWWVWWWWWWWWWWVWWUWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:734:405/1
-GATAGAGCAAAATGTAATAGAGGATTTTTATAGTTG
-+HWI-EAS337_3:7:1:734:405/1
-WWWWWWVWWWWWWVWWWWWVWWVVWWWWWVUUKUUR
-@HWI-EAS337_3:7:1:1308:674/1
-GAAATTTAAGGCATGAACCTATTAAATAGTATAACT
-+HWI-EAS337_3:7:1:1308:674/1
-WWWVWWWWWVVWWWWWWVWWWWWWVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:268:1484/1
-GTCGGCAGCAGCAATAGTAAGCAGTTCCTTCATATT
-+HWI-EAS337_3:7:1:268:1484/1
-WWWWWWWWVWWWWVVWWVVWWWVVVVWVWWUSUUUU
-@HWI-EAS337_3:7:1:1533:1717/1
-GGAAGTTCTTTGGCATTCTTGGTGTACCATAATCAT
-+HWI-EAS337_3:7:1:1533:1717/1
-WWWWWWWWWWWWWWWWWWWWVVWUWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:381:1237/1
-GTATATGTATTGCTGGTTACTCTTCTGTCTCCTGAT
-+HWI-EAS337_3:7:1:381:1237/1
-WWVWWWVWWWWVWVVVVWWWWVWWVWQVVWRSUOLU
-@HWI-EAS337_3:7:1:195:1195/1
-GTATTTTTATATGTATGGAAATCAGAAGCGTATCCA
-+HWI-EAS337_3:7:1:195:1195/1
-WWWWWWWWWWVWVWWWVVWWWWWWVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:1307:1522/1
-GAGACAGCCAATGGAACTGCCTTTAGAGGGACGAGT
-+HWI-EAS337_3:7:1:1307:1522/1
-WWWWWWWWWWWWWWWWWWWWWWWWVTWVVVUUUUUU
-@HWI-EAS337_3:7:1:1221:1420/1
-GTGAAGCAGAATCAATACTTAGCCTCTTAGGGTCCC
-+HWI-EAS337_3:7:1:1221:1420/1
-WWWWWWWWWWWWWWVWWWWWWVWWWWWWWTSRUUUR
-@HWI-EAS337_3:7:1:573:1364/1
-GTTACGTGCACACACGAGACACGATGGGGATGAGTG
-+HWI-EAS337_3:7:1:573:1364/1
-WWWWWWWVWVWWWVWVVWVWVWWVWWVWTVUURUUR
-@HWI-EAS337_3:7:1:385:1270/1
-GGATTGTTCTCATTGGATTGACAGTATAGTAATATA
-+HWI-EAS337_3:7:1:385:1270/1
-WWVWWWWWWWWWWWWVWWWVWVWTVVWVVVUUUUUU
-@HWI-EAS337_3:7:1:395:1182/1
-GCGTCTTTGCATAGATCAGAATTCAGATGTGACATT
-+HWI-EAS337_3:7:1:395:1182/1
-WWVWWVVWVWWWWWWWWWWVWWWWWVVWVVSUUUUU
-@HWI-EAS337_3:7:1:207:1838/1
-GTGACCACCATTCAACTTTTAAAAAATAAATTTTAA
-+HWI-EAS337_3:7:1:207:1838/1
-WWWVWVSWWWVVWWVWWWWWWWWVVWWWWVUTUQUU
-@HWI-EAS337_3:7:1:1394:1670/1
-GGTTTGAATGGTGCATTTTTATCACTGGGGTTGGAG
-+HWI-EAS337_3:7:1:1394:1670/1
-WWWWWWWWWWVWVWWWWWWWWWWVWWTVKTUUUSRR
-@HWI-EAS337_3:7:1:1229:1513/1
-GCATCCACTAGTTAAAGAAGCACAATCCAGACAAGT
-+HWI-EAS337_3:7:1:1229:1513/1
-WWWWWWWWWWWWWWWVVWWWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:183:485/1
-GTTTCATTATTTGATTAAAAACTTAACGTTAGGGTT
-+HWI-EAS337_3:7:1:183:485/1
-WVWVWWWVWWWWUWWVWWWWWWWVWWWVWWURSSUU
-@HWI-EAS337_3:7:1:141:2029/1
-GTGGTTGTGGCAAGAATTGTCATCACTTACATTGTA
-+HWI-EAS337_3:7:1:141:2029/1
-WWWWWWVWVWWWVVWVWWVVVVWVVWVVWVUUURUJ
-@HWI-EAS337_3:7:1:1141:725/1
-GTTCCTTCTGAACCTAATATTTCCCTTGAAGTAATC
-+HWI-EAS337_3:7:1:1141:725/1
-WWWWWWWWWVWWWWWVWWWWWWWWVWWVVWUUUUUU
-@HWI-EAS337_3:7:1:535:1063/1
-GCAGCTGGAAGAGTGACAGAATAGAAGGTATAGCTG
-+HWI-EAS337_3:7:1:535:1063/1
-WWWWWWWWWWWWWVWWWWWWVWWVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:34:1851/1
-GTGGGTGAAGATATTTCTGAAGCGTATCCAGGTTGG
-+HWI-EAS337_3:7:1:34:1851/1
-WWWWWWWWWVWWWWWWWWVWWVWUWWWWWVSQUUSO
-@HWI-EAS337_3:7:1:835:438/1
-GTACATAAATGGTTGCGTAGAGAAACTGACAGAGCT
-+HWI-EAS337_3:7:1:835:438/1
-WWWWWWWWWWWVWWWWWWVWVWWWWWWTVVUUUUUU
-@HWI-EAS337_3:7:1:577:1069/1
-GATGATACTGCTTCTGAAACTAGTAGCAATTTCAGT
-+HWI-EAS337_3:7:1:577:1069/1
-WWWWWWWWWWWWWWVWWWVWVVVVWWWWWWUUUUQU
-@HWI-EAS337_3:7:1:160:1465/1
-GCGGCATCAAAGAACTAGATGGAGTGGGTATTGTTT
-+HWI-EAS337_3:7:1:160:1465/1
-WWWWWWWSWWWWWWWSWWWWWWQVVVVVVVTTQTUH
-@HWI-EAS337_3:7:1:859:453/1
-GAAAATGACAATCATTATTTGGATCAGTGTTTAAGA
-+HWI-EAS337_3:7:1:859:453/1
-WVWWWWWWWWWWWWWWWWWWWQVWWWVVQWUUUUSR
-@HWI-EAS337_3:7:1:640:1139/1
-GAAGGATGTGGAGATCTTAATAGCCAAGGCTGTGTC
-+HWI-EAS337_3:7:1:640:1139/1
-WWWWWWWWWWWWWVWWWWWWWWUWWVVWVVUUSSUO
-@HWI-EAS337_3:7:1:852:679/1
-GAATAGTAAGGCGACACAAGGCAACACAGAAAAAAC
-+HWI-EAS337_3:7:1:852:679/1
-WWWWWWWWWWWWWWWWWWVWWVVVWVVVWVUUUUUU
-@HWI-EAS337_3:7:1:1633:1841/1
-GAAATACGCTGAAATTTTGAGTTGAAAAATTCCATT
-+HWI-EAS337_3:7:1:1633:1841/1
-VWWVVVVWVWWWTVWWVWVWVWWTWWWVWVUUSUSU
-@HWI-EAS337_3:7:1:662:862/1
-GGTATTTATAAGTTCAAATGAGGTATGGGTTGTGAA
-+HWI-EAS337_3:7:1:662:862/1
-WWWWWWWWWWWVWWWWWWWVVTVWWWVTTVUSUUUU
-@HWI-EAS337_3:7:1:498:810/1
-GGTTGTGCTGTATTAATTACAGAGGGACTGGTGTTC
-+HWI-EAS337_3:7:1:498:810/1
-WWWWWWVWWVWWWWWWWWVWWVVUQTVVWVUUSUUO
-@HWI-EAS337_3:7:1:93:1408/1
-GTATCTCATAGTATGCTCAATCTTGCGAATTCATTA
-+HWI-EAS337_3:7:1:93:1408/1
-WWWWWWWWWWVWWWWWWWWWWWVWVWVWWWUSUUUO
-@HWI-EAS337_3:7:1:646:839/1
-GTTATAATTACTAATGGACCATTAACTCCTAGTACT
-+HWI-EAS337_3:7:1:646:839/1
-WWWWWWVWWWWWWWWVUWWWWWVWVVWVVWURUUUU
-@HWI-EAS337_3:7:1:1339:1470/1
-GGCAAGATGGAGTTGAAGGAACCAATTGTCCAATTA
-+HWI-EAS337_3:7:1:1339:1470/1
-WWVWVWWNWWWVWWVNSVVVWSJSVWVVVPUHUUUP
-@HWI-EAS337_3:7:1:1215:1443/1
-GCACACAGTTAGCGAAATGTCAACCATATTCTACCA
-+HWI-EAS337_3:7:1:1215:1443/1
-WWWWWWWWWWWWWWWVVWWWWWWWWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:1545:1712/1
-GGGTAGAGTAAAGGCTTATTTTTTTAATTTTTTATT
-+HWI-EAS337_3:7:1:1545:1712/1
-WVWWWWWWWWWWWWWWWVVWWWVWWWRWWWUUUUUJ
-@HWI-EAS337_3:7:1:1187:651/1
-GTTTCTCAAAGCGAAGAACTCTAAAACTGGTGTGTG
-+HWI-EAS337_3:7:1:1187:651/1
-WWWVWVWWWWWWWWWWWWWWVVWVVVVWWWSUUUUU
-@HWI-EAS337_3:7:1:466:1062/1
-GACGTGGATGATGGGAGTAGGGGCAGCAAAGACGGG
-+HWI-EAS337_3:7:1:466:1062/1
-WWWWWWWWWWWWWWWWWWWWVVWVVWTVWVUSUUUU
-@HWI-EAS337_3:7:1:148:1875/1
-GAGGACTCAACTAAAAAGGCCACTTTGAAAGAGAAA
-+HWI-EAS337_3:7:1:148:1875/1
-WWWWWWWWWWWWWWWWVWWWWWWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:1301:1449/1
-GAAATGTAGAACAGCCACCATTGCCACCTGGTCTGC
-+HWI-EAS337_3:7:1:1301:1449/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWVWWWURUUUU
-@HWI-EAS337_3:7:1:188:758/1
-GTTTAGTTGTGAATTGTCTAAGGAAGCAGTTCCCAT
-+HWI-EAS337_3:7:1:188:758/1
-WWWWWWWWVWWWWWWWWWWWVUVWWTWWVWUUUUUU
-@HWI-EAS337_3:7:1:515:855/1
-GTTGACGTGGAAGAATCTTATTGGTTAGGGCCCCAC
-+HWI-EAS337_3:7:1:515:855/1
-WWWWWWWWWVWWWWWWWWWVWWVVVWVVVQSUUUSR
-@HWI-EAS337_3:7:1:1726:1977/1
-GAGTGGGAACTGAAACTTTGTCAAGGCAATGGAAGG
-+HWI-EAS337_3:7:1:1726:1977/1
-WWWWWWWWWWWVWWWWWWWWWWWVVVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1601:1500/1
-GAAATGTATGTACACTTTTGTGTGTCATATGTATGT
-+HWI-EAS337_3:7:1:1601:1500/1
-WWWWWWWWWWWWWWWWWWWVWVWUWVWWVWQUUUQU
-@HWI-EAS337_3:7:1:1477:1673/1
-GGTAGGAAGAGCAAGATGAGGTTAGGGAATCCGGTG
-+HWI-EAS337_3:7:1:1477:1673/1
-WWVWWWWWVWVWWWWWVWWWWWWVWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:368:1413/1
-GAAAGGATGTCATATCAAAGTTATGAAACAGCTTAG
-+HWI-EAS337_3:7:1:368:1413/1
-WWWWWWWWWWWWWWWWVWWVWWWWVWVWWWUUUUUU
-@HWI-EAS337_3:7:1:328:1643/1
-GAAATCAGTTTTTCTAGGTTAACAGCATTTTCTTTC
-+HWI-EAS337_3:7:1:328:1643/1
-WWWWWWWWWWWWWWWWVQWWWWWWVWVWWWUUUUUR
-@HWI-EAS337_3:7:1:626:1888/1
-GAGCCTCCACTAACGAAAAGGAAAAAATGGAGGAAC
-+HWI-EAS337_3:7:1:626:1888/1
-WWWWWWWWWWWWWWWWVVWVWVVVWVWWVVUUUUUU
-@HWI-EAS337_3:7:1:295:305/1
-GAAAAATATATTCATAATAACTTAGATCTAAAACAA
-+HWI-EAS337_3:7:1:295:305/1
-WWWWWWWWWWWWWWWWWWWWWWWWUWWWWWUUUUUU
-@HWI-EAS337_3:7:1:271:1512/1
-GATGTTTTCTAATAAAATTCTCCATGAACCCTTGAC
-+HWI-EAS337_3:7:1:271:1512/1
-VWWWWWWWWWWWWWWWWWVWWUVVWQWVVVUUUSUR
-@HWI-EAS337_3:7:1:129:1811/1
-GAAAGAAACAATAGATGTTTTGAGAATATTACTAAT
-+HWI-EAS337_3:7:1:129:1811/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1258:1501/1
-GACCCCCATTCCTAGACCATCACCTCCATTCCAAAA
-+HWI-EAS337_3:7:1:1258:1501/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWVWWWUUUUUR
-@HWI-EAS337_3:7:1:39:1650/1
-GAGTTAAATTTGAGTTGGTGTACAAAGCTTAGGAGA
-+HWI-EAS337_3:7:1:39:1650/1
-WWWWWWWWWWWVWVWWVQWVWWWWWVTVWWUSSUSR
-@HWI-EAS337_3:7:1:1441:1773/1
-GTAAGAGTTATCATGATTACAAATTTGCTAAATCAT
-+HWI-EAS337_3:7:1:1441:1773/1
-WVWWWWWWWWWWWWWVWWVWWWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:31:1659/1
-GGGGCAAAAGAGTTGAAAGATTTCAGACCAATAGTC
-+HWI-EAS337_3:7:1:31:1659/1
-WWWWWWWWWWWWWWWWWWVWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:55:1858/1
-GGAAATATCGAATACTGATAGGAACAGATGATAAAC
-+HWI-EAS337_3:7:1:55:1858/1
-WWWWWWWWWWWWWWWWWWWWVVWVWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:1140:1414/1
-GGTAACACCTATGTAATTATTGCAAAAGAACCTAGG
-+HWI-EAS337_3:7:1:1140:1414/1
-WWWWWVWWVWWWWWWWWUWWWUWVVVWVWWUSUUUO
-@HWI-EAS337_3:7:1:32:2023/1
-GGGTGACAAAGAAAACAAAAGGGACATGGTACTTGG
-+HWI-EAS337_3:7:1:32:2023/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:145:1390/1
-GAAGGTAGAGAGACTGTTTCCAATAGACCCTCGGGT
-+HWI-EAS337_3:7:1:145:1390/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWVWUUUUSR
-@HWI-EAS337_3:7:1:22:1197/1
-GTTAAATAGCATTAAGTTCCCATTATCCACAGTTTC
-+HWI-EAS337_3:7:1:22:1197/1
-WWWWWWWWWVWWWWWWWWWWWWWWWWWVVWUSUUUU
-@HWI-EAS337_3:7:1:519:780/1
-GTAAAGGATATACAAGTTTGAATATTTAAGCTTTTG
-+HWI-EAS337_3:7:1:519:780/1
-WWWWWWWWWWWWWWWWWWWXWWWWWWWWVTUUUUUL
-@HWI-EAS337_3:7:1:1160:1426/1
-GACTTAGGTAAGTTAAGCTTCAAATAGGAGTTCTGC
-+HWI-EAS337_3:7:1:1160:1426/1
-WVWWWWWWWWWVWWWVVVTWWVVWWVVTWVUUUUUR
-@HWI-EAS337_3:7:1:522:1101/1
-GGAAATGACATGGTCTTTTTCTGGGAGGATAGCTGG
-+HWI-EAS337_3:7:1:522:1101/1
-WWWWWWWWWWWWWVWWWWWWWWUVVWVVVWUUUURR
-@HWI-EAS337_3:7:1:172:1019/1
-GTTACTTATACCAGTAGAGAGTTCATGCCATACATG
-+HWI-EAS337_3:7:1:172:1019/1
-WVWWWWWWWWWWWVWWWWWWWVVWWWWWVWUUUSUU
-@HWI-EAS337_3:7:1:614:49/1
-GAGAGAGAGAGGAGATACTTCGATATAGTACTTGTT
-+HWI-EAS337_3:7:1:614:49/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:275:1422/1
-GGAAACAGTCTCTCTACCTTCTTACTCACTCTCGTC
-+HWI-EAS337_3:7:1:275:1422/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1545:1519/1
-GACAATTTTTTCCGTGGGATTTAAATTATCTGGTAA
-+HWI-EAS337_3:7:1:1545:1519/1
-WWWWWWWWWWWWWWWVVWVWWWWVWWWWWVUUQUUU
-@HWI-EAS337_3:7:1:1340:1744/1
-GTGGGAGTTAGCTTAACATACATTGACCATGAGAGC
-+HWI-EAS337_3:7:1:1340:1744/1
-WWWWWWWWWWWWWWWWWWWWVVWWWVVVVVUUUSUU
-@HWI-EAS337_3:7:1:300:1184/1
-GTGAAATACTAAATCCTCCAGATTCTGATGCTTTCT
-+HWI-EAS337_3:7:1:300:1184/1
-WVWVWWWWVVWWWWVWWWWSVSWVVVWVWVUUUUUU
-@HWI-EAS337_3:7:1:1483:1691/1
-GCTTCTCCAAATGGATTTGTCACTGCTAGAGCAAAA
-+HWI-EAS337_3:7:1:1483:1691/1
-WWWWWWWWWVWWWVVWWWVWWWWWVWWWTVRUUUUU
-@HWI-EAS337_3:7:1:1557:1677/1
-GAAGAAGTGGTACCACAATTGGCTAAGTTGCTTTTG
-+HWI-EAS337_3:7:1:1557:1677/1
-WWWWWWWWWWWWWWWWVWWWVVWWWWVVWVUUUUUO
-@HWI-EAS337_3:7:1:72:1850/1
-GATTGAATAAGACTTAGATTCTTTCCCCCAAGTGCC
-+HWI-EAS337_3:7:1:72:1850/1
-WWWWVWWWWWWWWWWWVWWWWWWWWWVVWWUSUSUR
-@HWI-EAS337_3:7:1:1588:421/1
-GATTCAGATAAATCTGTAAGAGAATGCTTAACCAAC
-+HWI-EAS337_3:7:1:1588:421/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:648:1905/1
-GATGAAATGTTTTCATCTCTAGAGACATTGCTTTCC
-+HWI-EAS337_3:7:1:648:1905/1
-WWWWWWWWWWWWWWWWWWWWWVWVVVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1142:1702/1
-GGTATGTTTAATAAAAGTTTCATGCTAATAATTTGC
-+HWI-EAS337_3:7:1:1142:1702/1
-WWWWWWWWWWWWWWVWVWWWUWWVWWWWWWUUUUQR
-@HWI-EAS337_3:7:1:696:763/1
-GTTTAGGGTTTAGGGTTTAGGGTTTAGGGTTTAGGG
-+HWI-EAS337_3:7:1:696:763/1
-WWWWWWVWVWWVVWWVWWVWVVVWWVVVTWUUURUR
-@HWI-EAS337_3:7:1:1380:27/1
-GGTTATTTTTTGTATGTTTGAGCAAACAATCTCCTA
-+HWI-EAS337_3:7:1:1380:27/1
-WWWWWWWWWWWSWWWVWWWVWQWWWVVVVWUUUUUO
-@HWI-EAS337_3:7:1:275:1354/1
-GTATATGGATAGTGGCTGCTCTAAACATATGACTGG
-+HWI-EAS337_3:7:1:275:1354/1
-WWWWWWWVWWWVWVVWWVOVQVVVVJTVVVCRRSRR
-@HWI-EAS337_3:7:1:525:1282/1
-GTTGTATGGAAGAACTTAGTGTTGGAGTCACCTTCA
-+HWI-EAS337_3:7:1:525:1282/1
-WWSWWSWVVWWVVLVVVWSKQVKSVWKVVVQUUUUQ
-@HWI-EAS337_3:7:1:190:1416/1
-GGGATTTAATCTAATTCTTGGAGAATTCATGATGAA
-+HWI-EAS337_3:7:1:190:1416/1
-VVSVWVSWVVVVSVVWKWWVVWKWWVWVQVSUTQUU
-@HWI-EAS337_3:7:1:1730:372/1
-GATAAATTAGATATCTATGGAAAAAATAACGATGTA
-+HWI-EAS337_3:7:1:1730:372/1
-VWVWWWWWWWWWWUWWWVWVWWVWVVVWWVUSUUSU
-@HWI-EAS337_3:7:1:1262:1508/1
-GAACAGTTGGGGAGTTCTTGATTCACTGTTTAATGT
-+HWI-EAS337_3:7:1:1262:1508/1
-WWVWWWWWWWWWVWWWWWWWVWWWWVWWVWUSRUUU
-@HWI-EAS337_3:7:1:351:1186/1
-GTGGGAAATCATAGGATTTGCACCCGGCAGTTGATT
-+HWI-EAS337_3:7:1:351:1186/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1678:1991/1
-GTTGAGTTATAGTTTATTGATCCTCTTTCTAGCATC
-+HWI-EAS337_3:7:1:1678:1991/1
-WWWWWVWWWWWWWWWWWWWWWWVWWWWWVWUJUUUU
-@HWI-EAS337_3:7:1:1445:1754/1
-GAGTGGAGACAAATATTACTACTATTACAACAACAA
-+HWI-EAS337_3:7:1:1445:1754/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWVVUUUUUR
-@HWI-EAS337_3:7:1:1579:459/1
-GTTTGATGTGAAGTATAAGGTATAATAGTCTTATAT
-+HWI-EAS337_3:7:1:1579:459/1
-WWWWWWWWWWWWVWWWWWVVWWWWVWWVVWUUUUUU
-@HWI-EAS337_3:7:1:241:1311/1
-GATGTATTTGTACTTTTTTCCTTAAAAATATACATT
-+HWI-EAS337_3:7:1:241:1311/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:140:451/1
-GGTAAAATATGTTTTTCATGTTTTGGGGCTTGTTTG
-+HWI-EAS337_3:7:1:140:451/1
-WWWWWWWWWWWWWWWWWWWUWWWWQQQTVWUKUUUH
-@HWI-EAS337_3:7:1:1203:1515/1
-GGCATGGGATTCCTTTGTCTATCACTTAAGATAGAG
-+HWI-EAS337_3:7:1:1203:1515/1
-WVVVWWWVWWVWVWWUWWVWVVVWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:1255:751/1
-GTCAAGCATGTAAGTTCATATTTTGGAGGTATGGTT
-+HWI-EAS337_3:7:1:1255:751/1
-WWWWWWWWWWWWWWWWWWWWWWWWTTWWWVUUSUUU
-@HWI-EAS337_3:7:1:1275:737/1
-GACGGAAGAGATGTAGTCTCTTCATAAAAATGAGAC
-+HWI-EAS337_3:7:1:1275:737/1
-WWWWWWWWWWWWWQWWWWWWWWWVWVVVVVUUUUUU
-@HWI-EAS337_3:7:1:274:1486/1
-GTTTGTTGATTTATTGTCTTTCAAGGTTTGCAGTTG
-+HWI-EAS337_3:7:1:274:1486/1
-WWWWWWWWWWWWWWWUWWWWWWVVVVWWWVUUQUUC
-@HWI-EAS337_3:7:1:644:33/1
-GAGATGACTGAGAGTAGGGTTTTTGAGATCTTATAT
-+HWI-EAS337_3:7:1:644:33/1
-WWWWWWWWWVWWWVWWVWVWWWWWUWTVWVUUUUUU
-@HWI-EAS337_3:7:1:1264:1448/1
-GAGCAAAAGGGGTTGTGACTCTTGAAGAGCTGAAGA
-+HWI-EAS337_3:7:1:1264:1448/1
-WWWWWWWWWWWWWWWWWWWWWWWVVVWVWVUUUUUU
-@HWI-EAS337_3:7:1:1710:1919/1
-GTTTCAGAGGTGAAGACACTCGAAAAACATTTACAG
-+HWI-EAS337_3:7:1:1710:1919/1
-WWWWWWVWWWWWWWWWWWWWWWVWVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:1187:1977/1
-GTTTTGATAAAATTTGTGTAATTGCTCCTGTGAAGC
-+HWI-EAS337_3:7:1:1187:1977/1
-WWWWWWWWWWWWWWWVWVWWWVWVVVVVWTUSSUQF
-@HWI-EAS337_3:7:1:192:1476/1
-GCATATATATACGTAGAATACAACTGAAGCACCTCC
-+HWI-EAS337_3:7:1:192:1476/1
-WWWWWWWWWWWWVWWVWWWWWWWWWVWWVVUUUUUU
-@HWI-EAS337_3:7:1:1204:194/1
-GATCATCTTGTAAGTTTCACCATCCACCTGACTGGA
-+HWI-EAS337_3:7:1:1204:194/1
-WWWWWWWWWWWWWVWWWWWWWWWWWVWWVTUUUUUU
-@HWI-EAS337_3:7:1:665:1130/1
-GTTTATGAGTACTGACTTTGTGATTACCGTTGCTTG
-+HWI-EAS337_3:7:1:665:1130/1
-WSWWVWVVVWWWSVSVVSWVQQWWWWVQSQSROQUO
-@HWI-EAS337_3:7:1:831:1103/1
-GTTAGTGTTGCAAAGTTTGCTCGACGTCAGGGTATT
-+HWI-EAS337_3:7:1:831:1103/1
-WWWWWWWWVWWWWWWVWWVWWWVVWWVWVWQUUUUU
-@HWI-EAS337_3:7:1:1254:1491/1
-GTCTATGTGGCAGTGGAACCTTATTGGCATACAATG
-+HWI-EAS337_3:7:1:1254:1491/1
-WWWWVWWWWWWWWVTVWWVWWWVWWTVVVVUSUUUU
-@HWI-EAS337_3:7:1:1275:1427/1
-GGAGCATGGGTTTACGCTGTCTTTATCGGAGATGTT
-+HWI-EAS337_3:7:1:1275:1427/1
-WWWWWWWWWWWWWWWWWWVVWWWWVWWTWVUUUUUU
-@HWI-EAS337_3:7:1:42:1990/1
-GGATTGAGATTACAGTTTCACTTCTTACCTCATAAT
-+HWI-EAS337_3:7:1:42:1990/1
-WWVWWWWVWWWWWWWWWWWWWUWVWVWVVWUSUUUU
-@HWI-EAS337_3:7:1:1319:766/1
-GGATCTCAATGCTGCAATCTTACAGAGGAGTGCTGC
-+HWI-EAS337_3:7:1:1319:766/1
-WWWWWWWWWWWWWWWWVWWWWWWVVVVWWVUSUUUU
-@HWI-EAS337_3:7:1:1567:1795/1
-GGAAACAGTAACAGGAGAAGAAGTGTTAGGGTTTAT
-+HWI-EAS337_3:7:1:1567:1795/1
-WWWWWWWWWWWWWWVWVVWVVWVVVVWWVVUMUUUU
-@HWI-EAS337_3:7:1:216:392/1
-GAAGATTTTTTAATCTTGTGGTCTTAAACGTGTCAC
-+HWI-EAS337_3:7:1:216:392/1
-WWWWWWWWWWWWWWWWWVWVUWWWWVVWWQUSUUUU
-@HWI-EAS337_3:7:1:38:1803/1
-GTGAAATCACAAACATATGGCAAAAAATCAGGTATG
-+HWI-EAS337_3:7:1:38:1803/1
-WWWWWWWWWWWWWWWWWWVWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:425:1196/1
-GAGCAGAGATCACAGTGCAGTGCTAAAGCAGGATTG
-+HWI-EAS337_3:7:1:425:1196/1
-WWWWWWWWWWWWWWVTWWVWWWVWWVVVVVUUUUUU
-@HWI-EAS337_3:7:1:181:410/1
-GAAATAATGAAATGAGGGGGGAAGTAATTAGGATTT
-+HWI-EAS337_3:7:1:181:410/1
-VWWWWWWVVWVWWWWVVVVWWWWVWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1065:1826/1
-GATTGCTTATTTATGCCTTCTATGGACAGGGAATAA
-+HWI-EAS337_3:7:1:1065:1826/1
-WWWWWWWWWWWWWWVWVWWWWVWVVWWWVWUUUUUU
-@HWI-EAS337_3:7:1:79:1444/1
-GAATATTGATCTCTGCTCTAGATGTTTTCTTTCCGA
-+HWI-EAS337_3:7:1:79:1444/1
-WWVWWWWWWWWWWWVWWWWVVWVVWWWWWWUUUUQR
-@HWI-EAS337_3:7:1:1634:1526/1
-GAAGATATGACTACTCGAAGGGCTTTTGCTAGAAGG
-+HWI-EAS337_3:7:1:1634:1526/1
-WWWWWWWWVWWWWWWWVWWWVVVWWWWTVWUUUURR
-@HWI-EAS337_3:7:1:462:1320/1
-GTTTTGATTTAATTATTATTTATTATTTTTTTCTTT
-+HWI-EAS337_3:7:1:462:1320/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUCUU
-@HWI-EAS337_3:7:1:532:1095/1
-GGTCTGGCTATTTGATTTCCACCTGCTACCCCCGCA
-+HWI-EAS337_3:7:1:532:1095/1
-WWWVWWWWWWVWWVVVWWVWWVVVTVVWVVUUUSUJ
-@HWI-EAS337_3:7:1:27:305/1
-GATTGATTCAGTAATTGAGTTAACCTCTGAAAGAGA
-+HWI-EAS337_3:7:1:27:305/1
-WWWVVWWWWWVWWWWVVWVWWWWWVWVWQVUUURRU
-@HWI-EAS337_3:7:1:832:1960/1
-GAGGTACATCCAGTACTTCACTTTGTTTTGGCAAAG
-+HWI-EAS337_3:7:1:832:1960/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWWWKQUUUUP
-@HWI-EAS337_3:7:1:1312:645/1
-GCACAATCACATATTCAAGGGTGCAGCTAAAGTTGA
-+HWI-EAS337_3:7:1:1312:645/1
-WWVWWWWWWWWWWWWWWWVVVWVWWVWWVVUUUUQU
-@HWI-EAS337_3:7:1:1107:226/1
-GCAGAAAAAACGAATTTGTTTTGGCCCCCACTTCGT
-+HWI-EAS337_3:7:1:1107:226/1
-WWWWWWWWWWWWVVWWWVWWWWVQVVWWVVUUUURU
-@HWI-EAS337_3:7:1:274:1287/1
-GAGGATTTGCCTAGAGGTGCTTTTGTTTGTGAATAT
-+HWI-EAS337_3:7:1:274:1287/1
-WWWWWWWWWWWWWVVVVWWWWWWWVWWWVWRUUUUU
-@HWI-EAS337_3:7:1:1772:270/1
-GGAAATACTAACTANANNNNNNNNNNNNNNNNNNNN
-+HWI-EAS337_3:7:1:1772:270/1
-WWVVWWWWWVWVWWCVCCCCCCCCCCCCCCCCCCC@
-@HWI-EAS337_3:7:1:1704:1373/1
-GGTAAAGCTGATTTGTGGAAACCTTCGAATTGTTTG
-+HWI-EAS337_3:7:1:1704:1373/1
-WWWWWWWVWWWSWWWWSVVWWWWWWWVVOWUSSUUQ
-@HWI-EAS337_3:7:1:241:903/1
-GGTAATGTACCAAGTCGAATGAGCAAATTCAATATG
-+HWI-EAS337_3:7:1:241:903/1
-WWWWWWWWWWWWWVWWVWWWVWWWWWWWVWUUUUUR
-@HWI-EAS337_3:7:1:404:1924/1
-GTCGATGCAACTCGAACACTTGGATTGCAAACACTC
-+HWI-EAS337_3:7:1:404:1924/1
-VWWWWWWWWWWWWWWWWWWWWWVWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:23:1455/1
-GGGGAATTGTTATGCTTTAAACTAATGGGAAAAGAA
-+HWI-EAS337_3:7:1:23:1455/1
-WWWWWWWWWWWWWVWVWWWVWVVWWWTVTWUUUUUU
-@HWI-EAS337_3:7:1:980:182/1
-GTGTGCTATAGCACATGAAAATTGTCGAAATGGGGG
-+HWI-EAS337_3:7:1:980:182/1
-WRWWVWVWWWSVWWWWWVWVVWWVVVWWOVUUOUUU
-@HWI-EAS337_3:7:1:177:1048/1
-GTTGATTCATTTGTTGCTCAAGATTTTACATTGTTA
-+HWI-EAS337_3:7:1:177:1048/1
-WWWWWWWWWWWWWWWVWWWWVUVWWWWWWVUUQUUU
-@HWI-EAS337_3:7:1:1638:2028/1
-GGAAGGAATGGATGTTCCAGTTTAGGTTTTGGCTTA
-+HWI-EAS337_3:7:1:1638:2028/1
-WWWWWWWWWWWWWWUWVVTVVWWTVQTVWTKMURUR
-@HWI-EAS337_3:7:1:1185:1415/1
-GAAAATTTAGTCACAGAAATATCTGAAAGGGAGACA
-+HWI-EAS337_3:7:1:1185:1415/1
-WWWVWWWWWWWWWWWVWVVWVWWWWVWVVVSUUUUU
-@HWI-EAS337_3:7:1:1563:1484/1
-GATGTTGATCTCTCATCTTTTAATGATGCTGATGAT
-+HWI-EAS337_3:7:1:1563:1484/1
-WWWWWWWWWWWWWWWWWWWWWWVWVVWQVWRUUQUU
-@HWI-EAS337_3:7:1:319:1221/1
-GACACTTGACAATTTGCTCACATTCTCGCGACACTT
-+HWI-EAS337_3:7:1:319:1221/1
-WWWWWWWWWWWWWWWKWWWVWVWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:1627:340/1
-GTCATTTTCAAATTTAGCAATATTCTGAAAAAATAA
-+HWI-EAS337_3:7:1:1627:340/1
-WWWVWWWWWWWVWWWWVWWVWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:420:1925/1
-GTAGAGGAGGTAGGCTTGGGGGGTCTGGAGGGGTTT
-+HWI-EAS337_3:7:1:420:1925/1
-WLWVSVSVWWVWVWVVWVVQWVWNWVSVPVSUHHQQ
-@HWI-EAS337_3:7:1:454:1878/1
-GATGATACCTTTTTATGGTAGCTTGGATTGGTGAAT
-+HWI-EAS337_3:7:1:454:1878/1
-WWWVWWWVWWWWWWVVVVTWUVWWQVVVWQQSSSUU
-@HWI-EAS337_3:7:1:524:1872/1
-GAAAAGCTAAATGGAAGGTCAAATGGTTTACAAGTT
-+HWI-EAS337_3:7:1:524:1872/1
-WWWWWWWWWWWWWVWWVWWWWWWWVWVWWVUUUUUU
-@HWI-EAS337_3:7:1:344:1181/1
-GATTTCTAACAAATGTTGCATCTTCGTGTGATCCTG
-+HWI-EAS337_3:7:1:344:1181/1
-WVWVWVWVWVWWWVWVWVVWWVVVVTVOVOSURUUJ
-@HWI-EAS337_3:7:1:798:483/1
-GTTGAGCTTTCTTATCAAATTACTACTAGCAAACAA
-+HWI-EAS337_3:7:1:798:483/1
-WWWWWWWWWWWWWWWWVWVWWWWWWVWVTVUUUUUU
-@HWI-EAS337_3:7:1:665:1360/1
-GATAACAGGTATGATTGGTCAGAAGATAGAGATAGG
-+HWI-EAS337_3:7:1:665:1360/1
-WWWWWWWWWWWWWWWWVVWWWVWWVVWWVVUUUUUR
-@HWI-EAS337_3:7:1:235:1418/1
-GATCTCATGATAGCGAAATACCCAGTTATGGTAAGA
-+HWI-EAS337_3:7:1:235:1418/1
-WWWWWWWWVWWWVWVWWVWWWWVWVWWWWVSUUURU
-@HWI-EAS337_3:7:1:1526:1485/1
-GAAAAATAAATATTTCCTTTCTAAGAAGCCTTAATC
-+HWI-EAS337_3:7:1:1526:1485/1
-WWWWWWWWWWWWWWWWWWWWWWVWVVWVWVUUUUUU
-@HWI-EAS337_3:7:1:579:1743/1
-GGTATTCTTAGGAAAAAGTTGATCCACTGAGATCAC
-+HWI-EAS337_3:7:1:579:1743/1
-WWWWWWWWWWVVWWWVWVWWVWWWWWWWVVSUUUUO
-@HWI-EAS337_3:7:1:1764:1561/1
-GTTACCTAGTAAGAAAGACCGAAAGACACCTTTTGA
-+HWI-EAS337_3:7:1:1764:1561/1
-WWWWWWWWWWWWVWWWWWWWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1168:1486/1
-GCTGAGTTAGGCCTTAACTCGTTGTCAACTCTCCAT
-+HWI-EAS337_3:7:1:1168:1486/1
-WWWWWWWWWWVWWWWWWWWWVWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:1194:1518/1
-GGATTCAATTTTACAGGCAGAATCACCGAAAAGTTA
-+HWI-EAS337_3:7:1:1194:1518/1
-WWVVWWWWWWWWWWWWVWWWVWWWVWVWVVURUUUU
-@HWI-EAS337_3:7:1:1720:2014/1
-GTAGAGGAGGTAGGCTTGGCGGTTCTGTAGATGTTT
-+HWI-EAS337_3:7:1:1720:2014/1
-WWWWVWWWWWVVVWVVWVWPVWLQVVVVTWPJOLSU
-@HWI-EAS337_3:7:1:149:1569/1
-GGGGATAAGGAAGCATCAAACACTGAAAGAGTATAG
-+HWI-EAS337_3:7:1:149:1569/1
-WWWWWWWWWVWWWWWWWWWWWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:594:1077/1
-GTTAGTCCTTGTGGTAATGCATCAATTATGGTGAAT
-+HWI-EAS337_3:7:1:594:1077/1
-WWWWWWWWWWWWWTWWWWWWWWVVVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:527:1038/1
-GTGATGTGGTCATGTTGCACCAAATATCATTCATAG
-+HWI-EAS337_3:7:1:527:1038/1
-WWWWWWWWWWWWWWWWVVVWWWVWWWWWWWUUUUUR
-@HWI-EAS337_3:7:1:1694:1598/1
-GATTAATTCTATGCAAGAAGAACTTCATCAATTTGA
-+HWI-EAS337_3:7:1:1694:1598/1
-WWWWWWWWWWWWXWWWXWWWWWWWWWVWWVUUUUSU
-@HWI-EAS337_3:7:1:1658:1466/1
-GGGTGTGGGCTAAGAATAGAGTTGGCTGGCAATGAG
-+HWI-EAS337_3:7:1:1658:1466/1
-WWVWWWVVVWWWVVWVWWVVVWWVVWWVTVUUUUSR
-@HWI-EAS337_3:7:1:194:653/1
-GTTGGAAAAGGAGGTTCCGTGAAACACCTTGGAACA
-+HWI-EAS337_3:7:1:194:653/1
-WWWWVWWWVWWWWWVWVVVKWVWUWVVVTWUSUUUU
-@HWI-EAS337_3:7:1:750:496/1
-GATCCTCATTCCAGTCTTATCAACTGTGAAGCCACA
-+HWI-EAS337_3:7:1:750:496/1
-VWSSWVWVVWWSWVWWWSVWQWVWWVVQVVQKSUTU
-@HWI-EAS337_3:7:1:406:152/1
-GTAGAGGAGGTAGGCTTGGTGGTTTTGTAGATGTTT
-+HWI-EAS337_3:7:1:406:152/1
-WWWWWWWWWVVWWVVWWVVQVVUVCWJVCQQUKSUU
-@HWI-EAS337_3:7:1:1675:1812/1
-GTAGAGGAGGTAGGCTTGGTGGGCCCTCTTTGGTAA
-+HWI-EAS337_3:7:1:1675:1812/1
-WWWWWWWWWWVVWWVWWQVVVVJPVVTMVLUMRFMO
-@HWI-EAS337_3:7:1:1649:1397/1
-GTATCATGTTGTGTTGAATTCATAAAACCTGAAAGT
-+HWI-EAS337_3:7:1:1649:1397/1
-WWWWWWWWWWWWVWWVWWWVVWWWWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:347:1642/1
-GTTGGGTATGAGGTTTGAAGATTCTCCGAATGGTGG
-+HWI-EAS337_3:7:1:347:1642/1
-WWWWWWWWWWVWVWWWVWWVWWWWWVVWVVUUUUSR
-@HWI-EAS337_3:7:1:467:1394/1
-GTTGGATTAAATTAGCACGAAGATGAAAGAAAATAT
-+HWI-EAS337_3:7:1:467:1394/1
-WWWWWWWWWWWWWWVWWWVVWVWWVWVWVVUUUUUU
-@HWI-EAS337_3:7:1:150:1963/1
-GAGATACACAAGAGCTTCTAATGACTTTGGAATTTG
-+HWI-EAS337_3:7:1:150:1963/1
-WVVWSWVVWVWVWSWVWWWVVWVVVWVQSVUTSTRQ
-@HWI-EAS337_3:7:1:65:1618/1
-GTGCTTGAAGTATATGTTCTTTAAAAAGCATCTGAA
-+HWI-EAS337_3:7:1:65:1618/1
-WVWVWWWWWWWWWWWVWWWWWWWWWWVTWVUUURUU
-@HWI-EAS337_3:7:1:1720:1358/1
-GAAATAGTAATGAGTTGCCACAAGACATTGATGAAA
-+HWI-EAS337_3:7:1:1720:1358/1
-WWWWWVVWWVWWWVWWWWWWVVVVWVTWVWUURUUU
-@HWI-EAS337_3:7:1:160:734/1
-GTGCGATTTCTGATATTTTTATATGGAGTAGGTGAA
-+HWI-EAS337_3:7:1:160:734/1
-WWWWWWWWVVWVWWWWWWWWWWWWUQWQVWUSURUU
-@HWI-EAS337_3:7:1:702:489/1
-GATGTACCACGTTTCAGTCAGTTCAAGTACCATCAT
-+HWI-EAS337_3:7:1:702:489/1
-WWWWWWWWWWWWWWWVVWWWVWWVWVWWVUUUUURU
-@HWI-EAS337_3:7:1:321:1436/1
-GAAGGAGATGATACCTTTTTATGGTAGCTTGGATTT
-+HWI-EAS337_3:7:1:321:1436/1
-WWWWWWWWWWWWWWWWWWWWWWVQVWVVVWQSSUUC
-@HWI-EAS337_3:7:1:25:1368/1
-GTATTATCCAATAAAGACGGTATTGATAACCCTGAA
-+HWI-EAS337_3:7:1:25:1368/1
-WWWWWWWWWWWWWWWVWWWVVWWWQQVVWOUUOQCU
-@HWI-EAS337_3:7:1:73:487/1
-GAAATAGGATGACGATTTACTATGATTAATAGTTAA
-+HWI-EAS337_3:7:1:73:487/1
-WWWWWWWWWWWWWWVWWWWWWWWVVWWWWWUSUUUU
-@HWI-EAS337_3:7:1:1132:361/1
-GTAAATATAGATAAGTACTGCTATTAAGGATAGAAC
-+HWI-EAS337_3:7:1:1132:361/1
-WWWWWSWWWVWVWWWWVVVSWVWWWWVWVVUUUSUU
-@HWI-EAS337_3:7:1:462:843/1
-GTTTCAAAATCATAAATGTGAAAGTTTAATCATAGC
-+HWI-EAS337_3:7:1:462:843/1
-WVSWWVVWVVWVWWWWWSVWWWWVVWWVVVUQUUUU
-@HWI-EAS337_3:7:1:56:462/1
-GAGGCGTGTTGGCTTCAACATCAAGAAAAATGAGTG
-+HWI-EAS337_3:7:1:56:462/1
-WWWWWWWWWWVVWWWVVWVWWWVVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:984:223/1
-GTTTTCCTGAGAGGTTTGAACCTTTTTTTAATGTTA
-+HWI-EAS337_3:7:1:984:223/1
-WWWWWWWWVWVWVVWWWWWWWWWWWWWWWVUUQUUR
-@HWI-EAS337_3:7:1:1755:122/1
-GGTGTACATGTGGTTCGTTAAAGAGATTTTAAAACT
-+HWI-EAS337_3:7:1:1755:122/1
-WWWWWWWWWVWVUWWWUWWWVVQVUVWWWWUSSURU
-@HWI-EAS337_3:7:1:17:489/1
-GACAATCCTGCTTTAGCACTGCACTGTGATCTCTGC
-+HWI-EAS337_3:7:1:17:489/1
-WWWWWWWWVVWWWWWVWWWWVWWWWVVVVWUUUUKU
-@HWI-EAS337_3:7:1:280:1315/1
-GGCAGTGTATTGTGGGTTGGACCCTTTTAAGCATAG
-+HWI-EAS337_3:7:1:280:1315/1
-VVWWWWWWVRWVWVVVVVVVSWWVWWWWRVQUUUUO
-@HWI-EAS337_3:7:1:350:1081/1
-GTGAGTAATATCGTTCATATCAAAAGTTAAAGAACA
-+HWI-EAS337_3:7:1:350:1081/1
-WWWWWWWWWWWWWWWWWWVWWWWWWVVWWVUSUUUU
-@HWI-EAS337_3:7:1:74:644/1
-GTGAGTTTCAGGGTGTTGTGTTTTTACGATGTGGGT
-+HWI-EAS337_3:7:1:74:644/1
-WWWWWWWWWWVVVWVWWVWUWWWWWWWVWWKUUISU
-@HWI-EAS337_3:7:1:624:1138/1
-GAAATTGTGATGGGCCGCCTGTTTGGGGGTTTAGTG
-+HWI-EAS337_3:7:1:624:1138/1
-WWWWWWWWWWVWWVWTVWWWWWWWVVTVVVUUSSUR
-@HWI-EAS337_3:7:1:1277:1678/1
-GGGATATCACTGAGTTGTAACTTGTAAGGCAGTTTT
-+HWI-EAS337_3:7:1:1277:1678/1
-WWWWWWWWWWWWWWWWWWVWWWWWWWVVQVUUUUUU
-@HWI-EAS337_3:7:1:1045:849/1
-GAGTCTATAATAGGTATATTAATGATGTTATTGTAA
-+HWI-EAS337_3:7:1:1045:849/1
-WWWWWWWWWWWWWXWWWWWWWWWWWWVWWVUUJUOR
-@HWI-EAS337_3:7:1:80:1413/1
-GTCAGCAGCTTTTGGGATACAATATCTGATGCAAAG
-+HWI-EAS337_3:7:1:80:1413/1
-WWWWWWWWWWWWWVWWWWWWWWWWWWWVWWSUUUUR
-@HWI-EAS337_3:7:1:1570:451/1
-GAAACTTGAATAAAAATGAAAGTTGACATCTAGCTA
-+HWI-EAS337_3:7:1:1570:451/1
-WVWWWVWWWWVWWWWWWWWWWWVWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:1253:1422/1
-GATGTAAAGGCTTTTCTGAACTCCTCTGGTTTATTT
-+HWI-EAS337_3:7:1:1253:1422/1
-WWWWVWWWWWWWWWWVWVWWWWVWVWWWVVUUUUUU
-@HWI-EAS337_3:7:1:655:1329/1
-GAATGATATTGGAAACAATTAACTTTATACTTCCCA
-+HWI-EAS337_3:7:1:655:1329/1
-WWWWWWWWWWWVWWWWWWWWWWWWWWWWWVUUUUUR
-@HWI-EAS337_3:7:1:787:457/1
-GGGACATTGATAGCCTGTGCCGTCAAGAAAAAGTAT
-+HWI-EAS337_3:7:1:787:457/1
-WWWWWWWWVWWWVWWWWWWWWWVWWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:675:1091/1
-GAAAACTATAATTTTGTTCTTGATATACTTGACCAG
-+HWI-EAS337_3:7:1:675:1091/1
-WWWWWWWWWWVWWWWVWWWWWVWWWWWWWWRUUUUR
-@HWI-EAS337_3:7:1:1319:746/1
-GATGATAACAAAGGTGTCAGCGTGGGTTTGGCTGAA
-+HWI-EAS337_3:7:1:1319:746/1
-WWWWWWWWWWWWWWWWWWWVWVWVVVVWWTSUUUOR
-@HWI-EAS337_3:7:1:1766:1444/1
-GAAAAGAGGTACATGCTTTACCAAGTTATGGGCCTT
-+HWI-EAS337_3:7:1:1766:1444/1
-WWWWWWWWWWWWWWVWWWWWWWVVVWWVWOSSUUUU
-@HWI-EAS337_3:7:1:813:479/1
-GGGCTGTGATTGTTTCCATGTAGATTTGCAGGTATG
-+HWI-EAS337_3:7:1:813:479/1
-WWWWWWWVWWWVWWWWWWWVWVQVWWWTVVRQUSUO
-@HWI-EAS337_3:7:1:1268:736/1
-GAGTAGAATCTCTTTCATGATGCTTTTATTATGCTA
-+HWI-EAS337_3:7:1:1268:736/1
-WWWWWWWWWWWWWWWWWWTWWUVWWWWVWWUUJUUM
-@HWI-EAS337_3:7:1:1707:1498/1
-GTTTCAGATTCACTAGTGTGGGACGTTGTAGAAAAG
-+HWI-EAS337_3:7:1:1707:1498/1
-WWWWWWVWWWWWWWVVWWWVUVWWVWWTWVSUUUUO
-@HWI-EAS337_3:7:1:1219:1676/1
-GAGCAAAAGGGGTTGTGACTCTTGAAGAGCTGAAGA
-+HWI-EAS337_3:7:1:1219:1676/1
-WWWWWWWWWWWWWWWUWWWWWWWVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:1711:300/1
-GTAATTGTTGTTTTTATTGTTCCCAATATGCCTGAG
-+HWI-EAS337_3:7:1:1711:300/1
-WWWWWWWWWVWWWWWWWWUWWWWWVWWVWVUUUUUR
-@HWI-EAS337_3:7:1:1324:702/1
-GTGATGTTGTTAGCAGCAATAAGCATATCATTAACA
-+HWI-EAS337_3:7:1:1324:702/1
-WWWWWVWWWWWVVWWVVWWVWVVVWWVWVVUUUUUU
-@HWI-EAS337_3:7:1:1602:299/1
-GAAGAAATTAGATTGTAGTGAGTGAATCCATTAATT
-+HWI-EAS337_3:7:1:1602:299/1
-WWWWWWWWWWWWWWVWWVWVWVWVWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:412:1505/1
-GTTGAGTCGATGTATATTATTGGGAAGTTAAGCTTA
-+HWI-EAS337_3:7:1:412:1505/1
-WVVWWWVWWWWVWWWWWWVWWUVQVQVVWVURUUUR
-@HWI-EAS337_3:7:1:567:1125/1
-GTTGTATGTCAAATTCTCAAAATGTTAGTTTTGGCT
-+HWI-EAS337_3:7:1:567:1125/1
-WWWWWWWVWWWWWWWVWWWWWWWVWWVVWWUUQSPU
-@HWI-EAS337_3:7:1:995:859/1
-GGATGTTCTCTCTTCCGTCACTCAATCGTTTAGTCT
-+HWI-EAS337_3:7:1:995:859/1
-WWWWWWWWWWWWWWWWWWWVWWWVVWVVVWUURUUU
-@HWI-EAS337_3:7:1:297:1428/1
-GCGATCAAAATCTCTTTGTTTTTTTGGATTTCTTGT
-+HWI-EAS337_3:7:1:297:1428/1
-WWWWWWWWWWWWWWWWWVWWWWWWWTJVWWUUUUCK
-@HWI-EAS337_3:7:1:1623:299/1
-GTAGATAAATAAAAGGTCGTTTGGTAGACCGTATTA
-+HWI-EAS337_3:7:1:1623:299/1
-WWVWWWWWWWWVWWVWVWWWWWVVVVVWVVURUUUU
-@HWI-EAS337_3:7:1:88:492/1
-GTTTGGTTATGTTTCTCGGACCCTCCAAAAATATCA
-+HWI-EAS337_3:7:1:88:492/1
-WWWWWVWWVWVVVWWWWQVVWWVWWWWTVQUUUUUR
-@HWI-EAS337_3:7:1:1641:894/1
-GATATCTATCTCCTTAATTAATATCTCAGTCTTACA
-+HWI-EAS337_3:7:1:1641:894/1
-WVWWWWWVWWWQWWWWWWVWWWVVWWWWVVUUUUQQ
-@HWI-EAS337_3:7:1:1714:321/1
-GATATCTGAATAGCCTGCACTTGGGAACCACAATCC
-+HWI-EAS337_3:7:1:1714:321/1
-WWVWVWWWWWVWWVWWWWWWVWVVVVWWVVUUUSUU
-@HWI-EAS337_3:7:1:1755:1413/1
-GTTTGTGATAGAGAACAAAACAACGAGCGAGCGTCT
-+HWI-EAS337_3:7:1:1755:1413/1
-WWWWWWWWWWVWWWVWWVWWVWWVWVVVVVUUUUUU
-@HWI-EAS337_3:7:1:229:1393/1
-GAATATTATTATTTCTAATCTTATATAATCTTAAAT
-+HWI-EAS337_3:7:1:229:1393/1
-WWVWWWVWVWWWWWWWWWWWWWWWWWWWWVUUUUSU
-@HWI-EAS337_3:7:1:617:1889/1
-GTCGCAACTTGTCTTTTGGTGCATCAATATGCAACA
-+HWI-EAS337_3:7:1:617:1889/1
-VVWWWWVWWWWVWWWVWVVTVWVVQQVVVWSSULUR
-@HWI-EAS337_3:7:1:1741:1537/1
-GAAAATATGTCTTGAGAGGTTCATACTCTTCATCAA
-+HWI-EAS337_3:7:1:1741:1537/1
-WWWWWWWWWWWWWVWWWVWWWWVWVVWVWWUUUUSR
-@HWI-EAS337_3:7:1:510:812/1
-GTAAAATTGGAAATGAGATACCTCTGGTACTTCTCA
-+HWI-EAS337_3:7:1:510:812/1
-WWWVWVWWWVWWWWWWVWWWVWWWWVVVVVUUUUUR
-@HWI-EAS337_3:7:1:1595:1808/1
-GTATCAGTAGTAATACATGTCCAAGCAATAATCCAG
-+HWI-EAS337_3:7:1:1595:1808/1
-WWWWWWWWWVWWWWWWWWVWWVWWVWWWWVUUUUUR
-@HWI-EAS337_3:7:1:653:883/1
-GAATGATTATGTTATGATTCCTCTTATTTAATGATA
-+HWI-EAS337_3:7:1:653:883/1
-WWSWWWWWVWWWWWVWVWWWWWWVVWWWVVSUUSUU
-@HWI-EAS337_3:7:1:1738:1910/1
-GGTTCATTTTCAAATTTAATTTGTTATTTCCACCCT
-+HWI-EAS337_3:7:1:1738:1910/1
-WWWWWVWWWWWWWWWWWWWWWWVWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1606:334/1
-GTTTCCATTATTTGAAAGAAAGCGCGCTATGATGGC
-+HWI-EAS337_3:7:1:1606:334/1
-WWWWWWWWWVWWWVWWVQWWWUWWVWWWWWUUUUUR
-@HWI-EAS337_3:7:1:79:393/1
-GAAGATATGCCTAGGGAGTGCATTATTGATTTTAAA
-+HWI-EAS337_3:7:1:79:393/1
-WWWWWWWWWWWWWVVWWVWWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:569:1887/1
-GACAAGACACTAATACCAATGAGTGATTTGTTACAT
-+HWI-EAS337_3:7:1:569:1887/1
-WWWWWWWWWWWVVWWWWWVWWVWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:769:170/1
-GTTGAGGTATCTAAACGTTCACTATCAATATTAAAG
-+HWI-EAS337_3:7:1:769:170/1
-WVWWWWWVWWWWWWVWWVVVVWVVWFVVVWSUUUUU
-@HWI-EAS337_3:7:1:1481:1647/1
-GGTATATGTTTCTATTGATGATTAGTTGATAGCAGC
-+HWI-EAS337_3:7:1:1481:1647/1
-WWWWWWWWWWWWWWWWUWWVWWWWUWWTWWURUUQU
-@HWI-EAS337_3:7:1:595:1852/1
-GAGTATATTTAAACTTTTCCATTGAATCTTTTATTC
-+HWI-EAS337_3:7:1:595:1852/1
-WWWWWWWWWWWWWWWWWWWWVWWVVVWWWWUUUUUR
-@HWI-EAS337_3:7:1:211:1401/1
-GTTTGACTAAAGACGAGGCACTTGAAGAGATTGACA
-+HWI-EAS337_3:7:1:211:1401/1
-WVWWVWWVWWVVWWVWWVWVWVVVWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:429:1897/1
-GTGGTAAAGATGTTGACGATGAAGAGATTTTTTTTT
-+HWI-EAS337_3:7:1:429:1897/1
-WWWWWWWVWWWVWWVWWVWWVWWVVVVWWWUUUUUU
-@HWI-EAS337_3:7:1:453:855/1
-GAATATGTGACCTCTTCAAGGAGATCAATGCTATTA
-+HWI-EAS337_3:7:1:453:855/1
-WWWWWVWWWWWWWWWWWWWVVWVQVWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1243:1502/1
-GTCATCATTTAAAGAAGTGTTTGATAATTCAGAGAT
-+HWI-EAS337_3:7:1:1243:1502/1
-WWWVWWVWWWWWWVWWVWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:553:1345/1
-GATATTCCGAGGGCAAGCATCTGCCTATACAAGCTG
-+HWI-EAS337_3:7:1:553:1345/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWVWVWUUUUUR
-@HWI-EAS337_3:7:1:163:1540/1
-GAATAACTTGTTAGCAGGATGTGACTTTACTAGCTC
-+HWI-EAS337_3:7:1:163:1540/1
-WWWWWWWWWWWWWVWWVVWWVWVWVWWWWVUULUUU
-@HWI-EAS337_3:7:1:1743:1932/1
-GATTAAAGATTAGAAACTACAAAGGAAACTTCAAAT
-+HWI-EAS337_3:7:1:1743:1932/1
-WWWWVWWWWWWWVWWWWWWWWWWWWVVWWWUUUUUU
-@HWI-EAS337_3:7:1:841:1071/1
-GACAAGTATACATGCCAGTATTCGTTGATTCTCAAT
-+HWI-EAS337_3:7:1:841:1071/1
-WWWWWWWWWWWWWWWWVWWWWWWVWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:818:1026/1
-GTCTTCTTCTTCTTCAGGTCCAATAAGCTCAATAAT
-+HWI-EAS337_3:7:1:818:1026/1
-WWWWWWWWWWWWWWWVVUWWWWVWWVVVWVUUUURU
-@HWI-EAS337_3:7:1:20:434/1
-GGAAGTGATTTTGTTCTAAGAATGGCAGCTCCCCTT
-+HWI-EAS337_3:7:1:20:434/1
-WWWWWWVWWWWWVWWWWWVVWWWUVWVVTVOSCSSU
-@HWI-EAS337_3:7:1:34:1819/1
-GTTATTGCAGCTGGTGTAACCTGCATTTTTTGGGTG
-+HWI-EAS337_3:7:1:34:1819/1
-WWWWWWWWWWWWVWWVWWWWWWVWWWWWWWUQSSUP
-@HWI-EAS337_3:7:1:1663:1506/1
-GGTTTAGTTGCTTTGAAGAAGTACGTTTTAATAAGG
-+HWI-EAS337_3:7:1:1663:1506/1
-WWWSWWWWWWWWWWVWWSVWSWWWVWWWWWUUUUSQ
-@HWI-EAS337_3:7:1:265:1426/1
-GTTGATAGTGATGAACTGTAGATATTGATGATGAAA
-+HWI-EAS337_3:7:1:265:1426/1
-VWSVSWWVWSNWSQVWSVWVSWWVWVNLQCQUCUHS
-@HWI-EAS337_3:7:1:1210:763/1
-GAAGAGTATAGGTATGCATCTGTAGGGTATGAGATA
-+HWI-EAS337_3:7:1:1210:763/1
-VWVWWVVWWWWWWVWWWWWVWWVVVVVVVWUUUUUR
-@HWI-EAS337_3:7:1:1184:215/1
-GAGAAAGTTGACACAGACAACAAAGCATAATGGGAA
-+HWI-EAS337_3:7:1:1184:215/1
-WVWVWVVVVVWVWVWTWWVWWUWVVWVOWVUIQUOR
-@HWI-EAS337_3:7:1:1413:1689/1
-GTGAGGTTCACATGGTTGGTCTCAAGTTCGAATGCA
-+HWI-EAS337_3:7:1:1413:1689/1
-WWWWWWWWWWWWWWVVWWWWWWVWVWWWWTUUUUUR
-@HWI-EAS337_3:7:1:1700:1939/1
-GATTGTTGATAAAAATTATGAACAATCGATTCAGGG
-+HWI-EAS337_3:7:1:1700:1939/1
-WWWWWWWVWWWWWWWWWWWWWWWWWWWWVWUUUSSR
-@HWI-EAS337_3:7:1:63:1484/1
-GAATTTGTATAAAATAAGAAAGAGAGAAAGACAAAA
-+HWI-EAS337_3:7:1:63:1484/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:87:683/1
-GAAAAAGTAGTGTTTTCAACCAAACCCATAAGGATC
-+HWI-EAS337_3:7:1:87:683/1
-WWWWWWWXWWXWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:65:1462/1
-GGTTCAAATTTTCCAACCAACCCTTGTTCTGATCCC
-+HWI-EAS337_3:7:1:65:1462/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWWSUUUUU
-@HWI-EAS337_3:7:1:208:1419/1
-GGTGATCCTTCACTCCTTGGTCTTGAAGAAGTTTTG
-+HWI-EAS337_3:7:1:208:1419/1
-WWWVWWWWWWWWWWWWWWVTWWWWUVVTVVUUUUUO
-@HWI-EAS337_3:7:1:1701:2029/1
-GTTATAAGTGATGGGGATGGAGGAAGGTGATGCATT
-+HWI-EAS337_3:7:1:1701:2029/1
-WVVWWWWVWVWVVVVWWVWUVVUVVVVVVVUSPSUU
-@HWI-EAS337_3:7:1:502:1076/1
-GCAGATATGACTATTCAGGGTATGGGCGGTCCACCG
-+HWI-EAS337_3:7:1:502:1076/1
-WWWWWWVWWWWWWVVWVVWVVWVVTVVWVVSSPMUU
-@HWI-EAS337_3:7:1:887:1017/1
-GTGGATTTTTGGATGGTCCGGCAAGACTGCGGCAGC
-+HWI-EAS337_3:7:1:887:1017/1
-WVWWVWVWWWVWWWVVWWWUVWVVVVWVVVUUUUUL
-@HWI-EAS337_3:7:1:630:1119/1
-GAATGACAACCCATGTTGCTTGATCTGAAAATGGGC
-+HWI-EAS337_3:7:1:630:1119/1
-WWSWWWWWWWWWWVVQWVWWWSVQWWVWVWUUUUUU
-@HWI-EAS337_3:7:1:215:1378/1
-GTAGCACCCTTCAGTTAGTCGAAGAGGTCATCAATT
-+HWI-EAS337_3:7:1:215:1378/1
-WWWWWVWWWWWWVWVWWVWWVWWVWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:397:1518/1
-GAATGTCTTATAATGACTTAATGAATTTAATGAATT
-+HWI-EAS337_3:7:1:397:1518/1
-WVWWWWWWWWWWWWWWWWWWWWVWWWWWWWURUUUU
-@HWI-EAS337_3:7:1:1687:323/1
-GATTTCTTCTCATTTATCCCAATTACATGGTACTTG
-+HWI-EAS337_3:7:1:1687:323/1
-WWWWWWWVWWWWWWWWWWWWVVWWWWVWVWUUUUUR
-@HWI-EAS337_3:7:1:179:1301/1
-GTTGTCTAGAAGAGTTTCTTGGACCAGTGCATGGTG
-+HWI-EAS337_3:7:1:179:1301/1
-WWWWWWWWWWWVWVWWWWWWUUWWWWTWTVUUSSUR
-@HWI-EAS337_3:7:1:375:1044/1
-GGTGGGGTATTCTATGACTCGAGGTCATTCATTTTT
-+HWI-EAS337_3:7:1:375:1044/1
-WWWWWWWWSWWWWWWWWWWWVVVWVWVWWVUUUUUO
-@HWI-EAS337_3:7:1:702:224/1
-GTCAAACTGAAGAGAACTCACCAAGACCCACACCCC
-+HWI-EAS337_3:7:1:702:224/1
-WVWWWWWWVWVVTQFJDGIIJVCDGGNNCGRILCJC
-@HWI-EAS337_3:7:1:294:1259/1
-GGCATATATTAACAAATCAAATCTTTTTGCAGCTGG
-+HWI-EAS337_3:7:1:294:1259/1
-WVVVVVWSWWVWSWVWVVWVVWKVWVVOQVUKUUSQ
-@HWI-EAS337_3:7:1:523:1123/1
-GAGTAAAACTTCTGCCAATAAATCTGCCCACACCTG
-+HWI-EAS337_3:7:1:523:1123/1
-WWWWWWWWWWWWWVWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1351:461/1
-GAAAAAAATTGGCATATCTTCAAAGCAGTCCTTAGT
-+HWI-EAS337_3:7:1:1351:461/1
-WWWWWWVWWWWWWWWWWWWWWWWWVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:667:1907/1
-GATGGCTCAAGCTGACTCAACTGGGATGTTCATATG
-+HWI-EAS337_3:7:1:667:1907/1
-WWWWVWWVWWWWWWWWWWWWVWVVTVWWVVUUUUUU
-@HWI-EAS337_3:7:1:1089:170/1
-GTTATAGGAGGCTGGTGCCAGGGACTTTCCAAAGAA
-+HWI-EAS337_3:7:1:1089:170/1
-WWWWVWVWWVVVVVVVUVVVWVVVSVVVVVUUURUM
-@HWI-EAS337_3:7:1:314:1338/1
-GTAGAACTTGATATCTGTGATTTTAATGTCATATTG
-+HWI-EAS337_3:7:1:314:1338/1
-WWWWWWWWWWWWWWWWVWVWWWWWWWWTWVUUUUUK
-@HWI-EAS337_3:7:1:588:1669/1
-GATTGATAAAAATGGGATGTGATGATGATTAGCGTC
-+HWI-EAS337_3:7:1:588:1669/1
-WWWWWWWWWWWWWWWWWWVWVWWWVWWVWWUUUSUR
-@HWI-EAS337_3:7:1:660:1289/1
-GGCAAACAAAGTAAGCAGAACGAAAAATTACGATTT
-+HWI-EAS337_3:7:1:660:1289/1
-WWWWWWWWWWWWWWWWWWWWWWVWWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:624:800/1
-GTTCTGGTGTCATTAGTCATCACTTAGAGAGAAAAT
-+HWI-EAS337_3:7:1:624:800/1
-WWWWWWWWVWWWWWWVWWWWWVWWWVVRVVUUUUUU
-@HWI-EAS337_3:7:1:114:494/1
-GTTGTACCCCCCCATGACAATTACTAGCTGGCATGT
-+HWI-EAS337_3:7:1:114:494/1
-WWWWWWWWWWWWWWWWWWWVWVVWWVVWWVUUUUSU
-@HWI-EAS337_3:7:1:75:784/1
-GTTCATCAGGGTAAACAGCAACCAAGGGTTCAACAT
-+HWI-EAS337_3:7:1:75:784/1
-WWWVWWVWWVVVWWWWWVWWWVWWWVVVWWUUUUUU
-@HWI-EAS337_3:7:1:1630:429/1
-GTGAAAATACCAGTATACTCGATATATCTCCAAGAC
-+HWI-EAS337_3:7:1:1630:429/1
-WWWVWVWWWWWWVWWWWWWWVVWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:803:1148/1
-GGAAAAGTTGCTGTGGCTTTTTTTGGTTTTTTTTAG
-+HWI-EAS337_3:7:1:803:1148/1
-WWWWWWWWWWWWWVVWWWWLVWWTCJTVJVUUJCCO
-@HWI-EAS337_3:7:1:633:1881/1
-GGTTTTAAAGTATAGTAGTAGTTTGTTGTTTCGATT
-+HWI-EAS337_3:7:1:633:1881/1
-WWVWWWWWWWWWWPVVWWWVVVWWVVWWWWUSUSUU
-@HWI-EAS337_3:7:1:168:1070/1
-GATTGAGTGTGGCCAGCCTGCTGCAAAGGTTGAATG
-+HWI-EAS337_3:7:1:168:1070/1
-WWWWWWVWVWWVWWWVWWWVWWVVQVWVVVUSUUUR
-@HWI-EAS337_3:7:1:1725:1904/1
-GGGGTGATTAGGTTTGCTAGGAAGAGAAGTTGATTC
-+HWI-EAS337_3:7:1:1725:1904/1
-WWWWWVWWWWWVWVWWWWWWVWVWVWVVWVUUUUUU
-@HWI-EAS337_3:7:1:461:1511/1
-GGTGATTAAGATCATTTTACCCTGGGAGGTTATATT
-+HWI-EAS337_3:7:1:461:1511/1
-WWVWWWWWWWWWWWWWWWWWVWWWVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:85:849/1
-GTAATTGGACAGAAACCCAAAGGCATGGAAAATTGT
-+HWI-EAS337_3:7:1:85:849/1
-WWWWWWVVWWWVWWVWWWVWVVVWWWVVWWUUUUSU
-@HWI-EAS337_3:7:1:804:1966/1
-GTTAAAGTAATAAAAAAAAAGAAATAGATATATTTT
-+HWI-EAS337_3:7:1:804:1966/1
-WWWWWWVWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:7:1479/1
-GAATCACCAATTTAATGCACAAAGAGGAAAAAAGAG
-+HWI-EAS337_3:7:1:7:1479/1
-WWWWWWWWWWWWWVWWVWWWWWVWVVWWWWUUUUUU
-@HWI-EAS337_3:7:1:611:1911/1
-GTCCGTAACCTGCATTATAACCTGTTTGTACCTTAT
-+HWI-EAS337_3:7:1:611:1911/1
-WWWWWWWWWWWWWVWWWWWWWWWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:500:931/1
-GAATGTGTGGAAAAGGGTTTCACATTATATATCTCG
-+HWI-EAS337_3:7:1:500:931/1
-VWWWWWWWWVWWWWVWVWWWVWVVVWVWWWUUUUUK
-@HWI-EAS337_3:7:1:1229:1476/1
-GGGAAGGATTGAATGGATGTCCATTCTCTGGAAATG
-+HWI-EAS337_3:7:1:1229:1476/1
-WWVWSWVWVVVVWVVVVWSVNVVVVVVOVOOUUIKS
-@HWI-EAS337_3:7:1:1200:1484/1
-GACATTCTCCTGGGGTCATTGATTCAGCTTTTGAGG
-+HWI-EAS337_3:7:1:1200:1484/1
-WWWSVWVVWWWWWVVWWSWWQRWVVVWFOKCUSSUQ
-@HWI-EAS337_3:7:1:238:1370/1
-GAAATTTTGATGTGGTGCTCGAACTTTCCGAAACCT
-+HWI-EAS337_3:7:1:238:1370/1
-WWWWWWWWWWWVWVUWVWWWUWWWWWWWWQUUUUUU
-@HWI-EAS337_3:7:1:605:1464/1
-GATGTGAAATGTATTTTGAACTTTTGGGGATCTTGG
-+HWI-EAS337_3:7:1:605:1464/1
-WWWWWWWWWWWWWWWWWVVWWWWWWKVTQVUUUUSR
-@HWI-EAS337_3:7:1:74:1956/1
-GTCTTAAGTTTTCAAGTTAAGCAAAGAGTAAAGATT
-+HWI-EAS337_3:7:1:74:1956/1
-VVVWWWVVVWWWWWWUVWWVVWWWWTVVVWUUUUUU
-@HWI-EAS337_3:7:1:970:1352/1
-GTATATTTTCAACAACACATGATCATTCCTATACTA
-+HWI-EAS337_3:7:1:970:1352/1
-WWWWWWWWWWWWWWWWWWWWVWWWVWWVVWUUUUUR
-@HWI-EAS337_3:7:1:1558:1713/1
-GTTGAGACAGGTTCTTTAGGACCAGGTTTCTCATTT
-+HWI-EAS337_3:7:1:1558:1713/1
-WWWWVWWWWWWWWWWWWWVVVWWVVVWWWVUSUUUU
-@HWI-EAS337_3:7:1:418:1956/1
-GATCCAATAAACTGCATGGAGCCATTAGGACTCTAA
-+HWI-EAS337_3:7:1:418:1956/1
-WWWWWWWWWWWWWVWWWVVWVWWWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:572:1873/1
-GAGCTTGCAACAAGTGAAAGACATTGAATTGCATAT
-+HWI-EAS337_3:7:1:572:1873/1
-VWWWWWWWWVVWWWWWWVWWVVWWVWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1216:1504/1
-GTAAAAATGGTACAGGTGATCCCTTATAAAACACAG
-+HWI-EAS337_3:7:1:1216:1504/1
-WVWVVWWWVWVWWWVWTWSWWVVWWVWVVWUUUURU
-@HWI-EAS337_3:7:1:263:1838/1
-GAATTCAGTTGCCATAGAGTAACAATGCTTCAAATG
-+HWI-EAS337_3:7:1:263:1838/1
-WWWWWWWWWWWWWWWWVWVWWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:293:1621/1
-GGTATCTACGATAAGTGTTCTCTTGAATTCTAGAAG
-+HWI-EAS337_3:7:1:293:1621/1
-WWWWWWWWWVWWWWVWWWWWWWWWVVWWWWUUQSUR
-@HWI-EAS337_3:7:1:445:1092/1
-GTGTGTTTGCAATTTTGCAAGGGTTAGTTCATTAGC
-+HWI-EAS337_3:7:1:445:1092/1
-WWWWWWWWVWWWWWWWVWWWVVUWWWVWWWSUUUKU
-@HWI-EAS337_3:7:1:1099:687/1
-GTATTGAGTATTTTGATATCTTTAAGTTTTAAGACT
-+HWI-EAS337_3:7:1:1099:687/1
-WWVWWWWWWWWWWWVWWVWWWWWVWQWWWWUUQUUU
-@HWI-EAS337_3:7:1:1722:1848/1
-GAAACTACCTCTCTACCTACCAAGATAGGGGTAGGG
-+HWI-EAS337_3:7:1:1722:1848/1
-WWWWWWWWWWWVWWWWWWWWWVVWVVWWVWUUUUUU
-@HWI-EAS337_3:7:1:1704:104/1
-GACAATGTTTCTAATAGAGTGTTATTGGAACTGACT
-+HWI-EAS337_3:7:1:1704:104/1
-WWWWWWWWWWWWWWWWVWVWVWWVWWQTVVUUQUUU
-@HWI-EAS337_3:7:1:364:1654/1
-GCAGCAATACTGTGTTTATTCTCTTCATCCAGAAGA
-+HWI-EAS337_3:7:1:364:1654/1
-WWWWWWVWWWWWWWWWWWWWWWWWWVWWWVUSUUUU
-@HWI-EAS337_3:7:1:243:203/1
-GTAGGCTGTAGCAAGTCAACTGTTAGAAAAAGTGCC
-+HWI-EAS337_3:7:1:243:203/1
-WWWWWWWWVWWVWWWMVWWVWVVWWVVWWVUUORPR
-@HWI-EAS337_3:7:1:844:206/1
-GTTTCAATGCAACAAAGCCAGATTTTACAAGTTATT
-+HWI-EAS337_3:7:1:844:206/1
-WWWWWWWVVWWWWWWWVWWWVWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:286:1551/1
-GACTTATATGATACTTTGTAAACTTGATTCATGAAG
-+HWI-EAS337_3:7:1:286:1551/1
-WWWWWWWWWWWWWWWWWVVVVVWVWVWWVVUURUUU
-@HWI-EAS337_3:7:1:675:744/1
-GATTATCAACTAAGCTCTGAAGGAAATTAAACTGGA
-+HWI-EAS337_3:7:1:675:744/1
-WWWWWWWWWWWWWWWWWWVVVWWWVVVWWVUUUUUU
-@HWI-EAS337_3:7:1:218:779/1
-GATTTTTTCAACCCACTTCAAATCCAACCTCAAATT
-+HWI-EAS337_3:7:1:218:779/1
-WVWWWWWWWWWWWWVWWWWWWWWWWWVWWWUUSSUU
-@HWI-EAS337_3:7:1:124:1447/1
-GAAACAACCCGAACCCCATTCTCTCTTTTGTGCTGA
-+HWI-EAS337_3:7:1:124:1447/1
-WVWWWWWSWSWWWWWVWVSWWVVWWWWVWQQUUUUU
-@HWI-EAS337_3:7:1:319:232/1
-GTTATCAAAAAGGGATATACATTCTTTGTTTAACGA
-+HWI-EAS337_3:7:1:319:232/1
-WWWWWWWWWWWVWWWWWWWWWWWWWWWVWWUUUUQU
-@HWI-EAS337_3:7:1:849:1321/1
-GTATCATAATATATACCATTGGTCATAGCTCAGTTA
-+HWI-EAS337_3:7:1:849:1321/1
-WWWWWWWWWWWWWWWWWWWVVVVWVWWVWWUSUUUU
-@HWI-EAS337_3:7:1:26:815/1
-GTTTAACTTTGATGTTTATGTTTTGCTAGATTCATG
-+HWI-EAS337_3:7:1:26:815/1
-WWWWWWWWWWWWWUWWWWWUWWWWLWWWQWUUSRUK
-@HWI-EAS337_3:7:1:192:1955/1
-GGAAAATTTATCCTCAACAATTAGGATTTAAGGGTG
-+HWI-EAS337_3:7:1:192:1955/1
-WWWWWWWWWWWWWWWWWWVWWWVVWWWWWWUUUUSR
-@HWI-EAS337_3:7:1:1385:1708/1
-GATTAGTGGCTCACTGACACCATTGTTGTTTGTATC
-+HWI-EAS337_3:7:1:1385:1708/1
-WWWWWWWWVWWWWWWVWWWWWVWWVWWVWWUSUUUR
-@HWI-EAS337_3:7:1:222:1881/1
-GAAGGGCAGTATTGTATGTGTTTTGTATGAAGGTAA
-+HWI-EAS337_3:7:1:222:1881/1
-WWWWWWWWWVWVWWUWVWTUVVVWVWWWQVUUURUR
-@HWI-EAS337_3:7:1:1754:1638/1
-GGAGGTGAAAAGGTTACTTTTGAGTAGCTTTAAAAC
-+HWI-EAS337_3:7:1:1754:1638/1
-WWWWWWWWWWWWWWWWWWWWWVWVWVVWWWUUUUUU
-@HWI-EAS337_3:7:1:1223:1926/1
-GGGATAATCTTCCTGTTGGTGTTAGTCACCAGTACC
-+HWI-EAS337_3:7:1:1223:1926/1
-WWWVWVWWWWWWWWWVWWVTVWWWUWVVVVUUUUUU
-@HWI-EAS337_3:7:1:1261:207/1
-GAGGGGTATCCTATTTATTGATTAGTCTGCCACCAT
-+HWI-EAS337_3:7:1:1261:207/1
-WWWWWWWWWWWWVWWWWWWVWWWWUWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1676:797/1
-GAGTTTATAAGTATTCAAAATTAATAAAATTATAGT
-+HWI-EAS337_3:7:1:1676:797/1
-WWWWWWWWWWWVWWWWWWWWWWWWWWWWWWUUUURU
-@HWI-EAS337_3:7:1:135:981/1
-GTCTTAAATATGTCATTGTCATTTCCACCCAACATA
-+HWI-EAS337_3:7:1:135:981/1
-WWWWWWWWWWWWWWWWWVWWVWWWWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:965:837/1
-GAGGTAGTGGTGGCAATAATGTAGGCAATGTTACTT
-+HWI-EAS337_3:7:1:965:837/1
-WVWWVWWVWVWWVVWWWVVWWVVWWVTVVVRURUUU
-@HWI-EAS337_3:7:1:154:819/1
-GTGAAGAGAATTTTCCGGTACCTTAGAGGTACATCT
-+HWI-EAS337_3:7:1:154:819/1
-WWWWWWWWWWWWVWWWVVVWWWWWWVWVVWUUUUUU
-@HWI-EAS337_3:7:1:686:469/1
-GCTTGGTTACGGGACTAGAGCGAATCGTCTCTTGTG
-+HWI-EAS337_3:7:1:686:469/1
-WWVWWVWWWVVWTVWWVWVWVWWVVVVTVOCUUIOO
-@HWI-EAS337_3:7:1:81:1201/1
-GTAAGAAGTCCAATCGCAGTTGTGCTACAACCTACA
-+HWI-EAS337_3:7:1:81:1201/1
-WWWWWWWWWWWWWWWVWWWWWVWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:918:1415/1
-GAAAGGATTTCAAAGTTTTGTAAAGCAAAAACCATC
-+HWI-EAS337_3:7:1:918:1415/1
-WWWWWWWWWWWWWWWWWWWVWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:444:1486/1
-GTTTTATCTGTGAATTTTTTGATGATTAGTGATGTA
-+HWI-EAS337_3:7:1:444:1486/1
-WWWWWWWWWVVVWWWWWWWWUVWKVWWVQWSUUSUU
-@HWI-EAS337_3:7:1:1618:498/1
-GATTTGAAGACAAAATTTTCATAAGTTGATCCAAAA
-+HWI-EAS337_3:7:1:1618:498/1
-WWWWWVWWWWWWWWWWWWWWWWWVWWWVWWUUUSUU
-@HWI-EAS337_3:7:1:1137:1705/1
-GTTTATACTAAACCAATAACGAGTTCGTTTTGGTAG
-+HWI-EAS337_3:7:1:1137:1705/1
-WWWWWWWWWWWWWWWWWWWWWVVWWWVWWWUSKUUR
-@HWI-EAS337_3:7:1:1653:1662/1
-GAATAGCGAAGTAATGTGAAAAGTGAGTTGAATTAT
-+HWI-EAS337_3:7:1:1653:1662/1
-WWWWWWWWWWWWWWWWWVWWWVVVVVVWWVUUUUUU
-@HWI-EAS337_3:7:1:1724:1989/1
-GAAATAAATAAAATGGAGACTACTTTTTGTATAAAT
-+HWI-EAS337_3:7:1:1724:1989/1
-WWWWVWWWWWWVVVWKVWVVWVVWTWVWWTUUUUUU
-@HWI-EAS337_3:7:1:537:1031/1
-GCAGACTGGAAAGTGAGTACAGTGAGATGGCTAAAA
-+HWI-EAS337_3:7:1:537:1031/1
-WWWWWWWWWWWWWWVWWWWWWWVWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:306:1620/1
-GAACTCGAGAAAGGTTGAGATTTTCCAAGGGTGGTT
-+HWI-EAS337_3:7:1:306:1620/1
-WWWWWWWWWWWWWWWWWWWVWWWWWVWWVVUUUSUU
-@HWI-EAS337_3:7:1:853:388/1
-GTTTGTAGTTGAAAATTTAGAAGTCCTCAGCCGTGC
-+HWI-EAS337_3:7:1:853:388/1
-WWWWWVWWWWVWWWWWWWWUWWTWVVWWWVUUUUSR
-@HWI-EAS337_3:7:1:1578:1955/1
-GCATTATTAATCATAGTAATTAAGAAGATAAACTAA
-+HWI-EAS337_3:7:1:1578:1955/1
-WWWWWWWWWWWWWWWVWWWWWWWUWWTWWWUUUUUU
-@HWI-EAS337_3:7:1:1756:12/1
-GAGTAAGTGTTTTTAAGATATCGAAATCATGTATGT
-+HWI-EAS337_3:7:1:1756:12/1
-WWWWWWWVWWWWWWVVVWWVWWWVVVWVVWUUUUUR
-@HWI-EAS337_3:7:1:1690:2017/1
-GTTACGATATTGTTGGTACTCACTCCTTCTACAATT
-+HWI-EAS337_3:7:1:1690:2017/1
-WVWWWWQWWWWVWWVQVWWWVHVVVWVVWVNUUUUU
-@HWI-EAS337_3:7:1:1686:506/1
-GGAGTGGTAATGTAGTTAGATCAATTAGGTTTTTCC
-+HWI-EAS337_3:7:1:1686:506/1
-WWWWWWWWWWWWWWVWWWVVWWWVWWWQVWUUUUUR
-@HWI-EAS337_3:7:1:583:1749/1
-GTATGTTGGTATTTATTCGTTCCTTGCAGTTCCTTT
-+HWI-EAS337_3:7:1:583:1749/1
-WWWWWWWVVWWWWWWWWWUWWWVWWKWVTWUUSUUU
-@HWI-EAS337_3:7:1:148:1149/1
-GTGAAAAAACGGCTGTCTTACCCTATTCCTTAGCCC
-+HWI-EAS337_3:7:1:148:1149/1
-WWWWWWWWWWWVWWWQQVWCPVVTMVWRVTQFMPS@
-@HWI-EAS337_3:7:1:1054:795/1
-GATTCGATATTTTAGCTTATTTTTTGTTGAACTTTT
-+HWI-EAS337_3:7:1:1054:795/1
-WWWWWWWWWWWWWWVWWWVWWWWWWQWWJVSUUUUU
-@HWI-EAS337_3:7:1:1612:1926/1
-GTGGTTATAGGTTAGTAAACTTTTTTCTTATTTTAT
-+HWI-EAS337_3:7:1:1612:1926/1
-WWWWWWWWWVWWVWVVVWWWVWWWWWVWWTUUUUSU
-@HWI-EAS337_3:7:1:1255:1428/1
-GGATTACCACATTATGTCTTTTCCATAGATGGTAAA
-+HWI-EAS337_3:7:1:1255:1428/1
-WWIVWVWVWWVQVWWWPVWWVWPVVWIQWVUPUSSU
-@HWI-EAS337_3:7:1:743:696/1
-GAAAATGGGGGCATTTGGTAAACTAGGAATAAGACT
-+HWI-EAS337_3:7:1:743:696/1
-WWWWWWWWWWWWWWWWWVWWWWWWWVVWWWUUUUUU
-@HWI-EAS337_3:7:1:102:442/1
-GGTATTCCTTGTTCAGTGTGTGCCTAAGAAAAGCGG
-+HWI-EAS337_3:7:1:102:442/1
-WWWWWWWWWWVWWWWVWVWVWQWWWWVTVVUUSUSR
-@HWI-EAS337_3:7:1:168:1840/1
-GTTGGTTAATCCGAAATAGGAGCAATCCGTGCAAAA
-+HWI-EAS337_3:7:1:168:1840/1
-WWWWVWWWWWWWVWVWWWVVWVWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:709:218/1
-GAGTTATACTTTTTTTCGTTTTTTTTTTTTTTTTTT
-+HWI-EAS337_3:7:1:709:218/1
-WWWWWWWWWWVVWWORJFFILTLLPVVLVQQSNNRQ
-@HWI-EAS337_3:7:1:672:1391/1
-GAGATTGCTTTAGCGATGACGAGCTTCCATGTGAAA
-+HWI-EAS337_3:7:1:672:1391/1
-WWWWWWVVWVWWVTWWVVWVVWVTWVVWVWSURUUR
-@HWI-EAS337_3:7:1:401:2018/1
-GTGGGAGCATCAGAGTATCTTTTTCTCGTAGAACTC
-+HWI-EAS337_3:7:1:401:2018/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVWVQUUUUU
-@HWI-EAS337_3:7:1:1523:442/1
-GTCTTAGTTTTCTTAATTTTTGACCTGAAGTTAAAC
-+HWI-EAS337_3:7:1:1523:442/1
-WWWWWWWWWWWWWWWVWWWWWUWVVWQVWQUUUUSU
-@HWI-EAS337_3:7:1:882:953/1
-GTTAATGATGATGCCTTGGTATAAAAGAAGGCTTGA
-+HWI-EAS337_3:7:1:882:953/1
-WWWWVWVWWVWWWWWWWVVWWWWVWVVVVVUUUUSO
-@HWI-EAS337_3:7:1:956:1068/1
-GCAATCTCTTTGAAGGTCACAAATATAATGATTAAA
-+HWI-EAS337_3:7:1:956:1068/1
-WWWWWWWWWWWWWVVVWWWWWWVWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1154:233/1
-GCAATATGATTGTTGAGGAGTAATCTTTGAAGTTCT
-+HWI-EAS337_3:7:1:1154:233/1
-WWWWWWWWWWWWWWWWWVWVWWWWWWWWTVUUUUUU
-@HWI-EAS337_3:7:1:174:1121/1
-GGATGGACAAAAGGCGCAGAGCGAGAAGCAGCACGT
-+HWI-EAS337_3:7:1:174:1121/1
-WWWSWWWWWVWWWVWWWWWWWWWVWVVWWVUUUUUS
-@HWI-EAS337_3:7:1:856:513/1
-GGAGTTAAGGAGGATGGAAGAATAAAGAGTGATTGT
-+HWI-EAS337_3:7:1:856:513/1
-WWWWWWWWWWWWWWWVWVWWVWWWVVVVWVUUUUUU
-@HWI-EAS337_3:7:1:872:1118/1
-GAGAGTGATAATAGATTTGTTTGAGGCCATCTCAGG
-+HWI-EAS337_3:7:1:872:1118/1
-WWWWWWWWWWWWVWWWWWVWWWTWVQVVVVRUUUUR
-@HWI-EAS337_3:7:1:192:998/1
-GTGGATAGTACTACCTCAGCTGGAGGCAACACAAGT
-+HWI-EAS337_3:7:1:192:998/1
-WWWWWWWVWWWWWWWWWVVWWVVVVTVVVVUUUUSU
-@HWI-EAS337_3:7:1:257:1440/1
-GATTTTCCAGTTGTATCTTTGTTGTCCTTGTGGATT
-+HWI-EAS337_3:7:1:257:1440/1
-VWWWWWWWWWWWWWWWWWWVWWUVWWVWWQURSUUU
-@HWI-EAS337_3:7:1:1529:400/1
-GATGATAAGTTGAATATGTTGTATTTTTCAATGGAA
-+HWI-EAS337_3:7:1:1529:400/1
-WWWWWWWWVWWWWVWWWVWWVWWWWWWWVWSURRUU
-@HWI-EAS337_3:7:1:827:747/1
-GAATTTTACGTAAAAGTTGCGACTTTTATGAAAAGT
-+HWI-EAS337_3:7:1:827:747/1
-WWWWWWWWWVWWWWWVWWVWVWWWWWWVWQUUUUUU
-@HWI-EAS337_3:7:1:130:46/1
-GAGTATGTTGTTCGTTGTTGTTGGTGACAAATTTGG
-+HWI-EAS337_3:7:1:130:46/1
-WWWWWWWWWVWWWVWWVWWUWWUQVQVVVVSUUUKK
-@HWI-EAS337_3:7:1:359:1200/1
-GTCAGGCTGTCGTGTTACTCAAATTCAATTCAGCGA
-+HWI-EAS337_3:7:1:359:1200/1
-VWSWWVVWSVWVWVVWKQSWVVWCHQVOVQUUROQS
-@HWI-EAS337_3:7:1:1727:2033/1
-GCCCATGAGACCAAATTTGTCAATATGGTTAGCTTT
-+HWI-EAS337_3:7:1:1727:2033/1
-WWWWWVWVWWWWWWVWWWWVWTWWVWWWRVUSSUUU
-@HWI-EAS337_3:7:1:1242:644/1
-GTATTGAGGGGTGACTAATTAACTAACTTAAAACGC
-+HWI-EAS337_3:7:1:1242:644/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:1663:1808/1
-GGGCCTGACTAAACCCCAAAAGTTAGCTCAAGAGGG
-+HWI-EAS337_3:7:1:1663:1808/1
-WWWWWWWVWWWVWWWWWVVVVWCTVWWWVVSUUUUU
-@HWI-EAS337_3:7:1:1151:1686/1
-GAAGCAGCTATATCATTTTTCATTTTCTTGGTTGTC
-+HWI-EAS337_3:7:1:1151:1686/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWVRUURUM
-@HWI-EAS337_3:7:1:1685:1353/1
-GAAGGGTCTTATGATGCAGTATACTGATGATTGTGG
-+HWI-EAS337_3:7:1:1685:1353/1
-WWWWWWWWWWWWWWWWWWWWWQWWWVVWWVUUSUUR
-@HWI-EAS337_3:7:1:520:1070/1
-GTCACCATTTGATTTGAATTATGTTTTTATATGATA
-+HWI-EAS337_3:7:1:520:1070/1
-WVWWWWWWWWWWWWWVWWWWWWVVWWWWVWUURUUU
-@HWI-EAS337_3:7:1:1619:1897/1
-GTCTTTACAAACCTAGAATGCAAACATACCATGAGC
-+HWI-EAS337_3:7:1:1619:1897/1
-WWWWWWVWWVWWWWWWWWWVWWWWVWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1759:19/1
-GTCCAAGCAATAATCCAGGGAACTGAAGGTTGAACA
-+HWI-EAS337_3:7:1:1759:19/1
-WWWVWVWWWVWVWWWWVVWVVVVWWVWWVVUSUSUU
-@HWI-EAS337_3:7:1:518:1056/1
-GTTAGGTTCACAAGGTTTTGAATTGAATTGGGAAGA
-+HWI-EAS337_3:7:1:518:1056/1
-WVWWWWWWWWWWVWVWWWWWWWWWVWWWWVRRUUQU
-@HWI-EAS337_3:7:1:1699:1385/1
-GATGTTTATTGGATGAATGTACAAAAGAGGGAATGT
-+HWI-EAS337_3:7:1:1699:1385/1
-WWWWWWWWWWWWWVVWWWWWWWWVWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:1162:339/1
-GGAGTTCTTTGAGTATGTTGAGGCGGTAAAGGTAAC
-+HWI-EAS337_3:7:1:1162:339/1
-WWWWWWWWWWVWWWWWVWWWWUVWVVFCMTRJJJS@
-@HWI-EAS337_3:7:1:68:721/1
-GTGCTAAAAAGTACACATGCCGTGTGGTAATGTAGG
-+HWI-EAS337_3:7:1:68:721/1
-WWWWWWWWWVWWWWWWWWWWWWWVVVWVWTUUUUUU
-@HWI-EAS337_3:7:1:1546:1486/1
-GTTGTTCTTCTCTAATATGCATGCTTCATAGCCCAT
-+HWI-EAS337_3:7:1:1546:1486/1
-WWWVWWWWWWVWWWWWWWUVWWVWWWVVWVRUUUUU
-@HWI-EAS337_3:7:1:879:430/1
-GAGAGATCCTAAAGAGACACAGGAACTAGATCAAAA
-+HWI-EAS337_3:7:1:879:430/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1754:671/1
-GTGAGCCACGGCATATAAAAATTGTAGGTCAATGAG
-+HWI-EAS337_3:7:1:1754:671/1
-WWWWWWWWWWWWWWWWWWWWVWWVVWVVWVUUUUUR
-@HWI-EAS337_3:7:1:14:1473/1
-GGTCTGGCTATTTGATTTCCACCTGCTACCCCCGCA
-+HWI-EAS337_3:7:1:14:1473/1
-WWVWVVWWWWWWWWWWWWWWWWWWVVWVWVUUUUUR
-@HWI-EAS337_3:7:1:425:150/1
-GCAAATGGAGAGTAATCGGAGAAGTTTCTTGGAGGA
-+HWI-EAS337_3:7:1:425:150/1
-WWWWWWWWWWWWWWWWWVVWWWWWWWWVWWSSUUSR
-@HWI-EAS337_3:7:1:773:145/1
-GTAATTTCCAACAGATCACCTTACAATCAATACTAA
-+HWI-EAS337_3:7:1:773:145/1
-WWWWWWWWWWWWVVWWVWWVWWVVWWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1191:747/1
-GATCTAACTTTGCAATTGAAGTTGTTCTTTATCGCA
-+HWI-EAS337_3:7:1:1191:747/1
-VVWWVWWWVWRVVWVWWVVVVVWVVWQWVWUUUUUK
-@HWI-EAS337_3:7:1:103:821/1
-GTAGAGGAGGTAGGCTTGGTGGTTCTGTAGATGTTT
-+HWI-EAS337_3:7:1:103:821/1
-WWWWWWWWVWVWWVVWWUVVVVUVJWKVJKKURUUU
-@HWI-EAS337_3:7:1:1689:453/1
-GAAAAAAACACTCTGATTTGTAAGAGAGAATTTAAC
-+HWI-EAS337_3:7:1:1689:453/1
-WWWWWWWWWWWWWWWVWWVWVVVWWVWWVVUUUUUU
-@HWI-EAS337_3:7:1:259:111/1
-GTGGTGATTTCAGCTGCTAGGCATAGTCCTCAGAAT
-+HWI-EAS337_3:7:1:259:111/1
-WWWWWWWWWWWWWWVWWUWVVVVWVQVVVWUUUUUU
-@HWI-EAS337_3:7:1:577:868/1
-GCTAAGGCTTCTTTTTGCAGTTTCTCCTCTTCATAC
-+HWI-EAS337_3:7:1:577:868/1
-WWWWWWWWVWWWWWWWVVVVWWWWWWWWVVUURUUU
-@HWI-EAS337_3:7:1:1223:332/1
-GGTGTGTTTGGTATGAAGGAAAATGTTTTCATGGAA
-+HWI-EAS337_3:7:1:1223:332/1
-WWWWWWWWWVVWWWVWWVVWWWWWVWWWWWUURSRR
-@HWI-EAS337_3:7:1:1626:1930/1
-GGTATGGGAAGGGTGGTGTATACGCAAACTTTATCC
-+HWI-EAS337_3:7:1:1626:1930/1
-WWVWWWWWWWWWWWWWWVWVWWVVWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1310:342/1
-GTTTATATGATCAGAAACGGATCCAGTTTCAGACAT
-+HWI-EAS337_3:7:1:1310:342/1
-WWWWWWWWVWWWWVWWWWTWWWWVWVVWWVURUUUU
-@HWI-EAS337_3:7:1:629:1071/1
-GAATCACCGTCGGTGCCGTCATCGGTGATGGTGGAC
-+HWI-EAS337_3:7:1:629:1071/1
-WWWWWWWWWWWWWVVWWVVWVVVWWVWDVTUMSUPC
-@HWI-EAS337_3:7:1:1306:1849/1
-GTATCTTCGATTTGAGATCAAACCCAGATTCAATAA
-+HWI-EAS337_3:7:1:1306:1849/1
-WWWWWWWWWWVWWVWVWWWWWWWWWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1169:328/1
-GATTGAATATCTCTCAACTAGAATAGACTCACCAAT
-+HWI-EAS337_3:7:1:1169:328/1
-WWWWWWWWWWWWWWVWWWWWVVWWWWVVWVUUUUUU
-@HWI-EAS337_3:7:1:752:1933/1
-GATTCCAGGCTGTAGTATTTTGGCTGCTGTTTGTCA
-+HWI-EAS337_3:7:1:752:1933/1
-WWWWWWWWWWWWVWWWWWWWWUVVWQOVQVUJQRC@
-@HWI-EAS337_3:7:1:1726:1896/1
-GTTCAAGGCTCGTTTAGTGGTTAAAGGATATTCACA
-+HWI-EAS337_3:7:1:1726:1896/1
-WWWWWWVWWWWWVWWVWVWUVWVVWVTVWVUUSUUR
-@HWI-EAS337_3:7:1:382:233/1
-GAAGAATTTGGTTGTATACTTCTTGATGCCTTTATT
-+HWI-EAS337_3:7:1:382:233/1
-WWWWWWWWWVVWWVVWWWWWWWWWVVWTWWUUUUUU
-@HWI-EAS337_3:7:1:1209:738/1
-GTAATGGTTTATATAGTTTCGTGCTTGTCTGGAAAA
-+HWI-EAS337_3:7:1:1209:738/1
-WVWVWWVVWWVWWWWVWWWWVWVPWWJWVVSUUUUR
-@HWI-EAS337_3:7:1:297:1512/1
-GCTTGAATCCTGGCATGCTGCCTTGTCAAGATCCGA
-+HWI-EAS337_3:7:1:297:1512/1
-WWVWWWWWWWWWWWWWVWWWWWWWVWWWVVUUUUSU
-@HWI-EAS337_3:7:1:51:1303/1
-GACATGTTATTTTTTGATGAAATGTCTTTACCTTAT
-+HWI-EAS337_3:7:1:51:1303/1
-WWWWWWWWVWWWWWWUWWQVWWWUWVWWWVUSUUUU
-@HWI-EAS337_3:7:1:35:1413/1
-GACAAATCATGCCGTATCTGGACAGCTAGACGATGA
-+HWI-EAS337_3:7:1:35:1413/1
-WWVWWVWWWWVWWWVWWVVIWVWVWWWWTWUSUSSU
-@HWI-EAS337_3:7:1:604:1320/1
-GTAGTTTATATGGGCTATTGAATGAGGTAATAATTG
-+HWI-EAS337_3:7:1:604:1320/1
-WWWWWWWWWWWVVWWWWWWVVVWVWVTVVWUUUUUR
-@HWI-EAS337_3:7:1:860:1942/1
-GATATGCTTTTCCTCGAGTCGAGGGCTTATTGGAAA
-+HWI-EAS337_3:7:1:860:1942/1
-WWWWWWWWWWWWWWWWWVWVVWWVVVVWWWUSSUUU
-@HWI-EAS337_3:7:1:144:1541/1
-GTGATTCGTTTTGTTATTTAGTGACGAGTGTTGTCT
-+HWI-EAS337_3:7:1:144:1541/1
-WWWWWWWWWWWWUWWWWWWWQWQWVVWQWVUUKUSU
-@HWI-EAS337_3:7:1:647:256/1
-GGTCTGGCTATTTGATTTTCACCCCCGCCCCTCCCC
-+HWI-EAS337_3:7:1:647:256/1
-WWLWWWWWWVWWWWWWWVFVLDQNCNCCDQHHFJJQ
-@HWI-EAS337_3:7:1:41:1185/1
-GAGTTGACATTCTTTCTGGGGCTGCAAATCAAGCAA
-+HWI-EAS337_3:7:1:41:1185/1
-WWWWWWWWWWWWWWWWWVQVVWWVVWWVWVUUSUUU
-@HWI-EAS337_3:7:1:1484:2035/1
-GTTTGGTAACATGTCTTACGTGATGTCCAAAGGGAA
-+HWI-EAS337_3:7:1:1484:2035/1
-WWWWWWWWWWWWVWWWWWWVWVVWVWWVWVUUUUUR
-@HWI-EAS337_3:7:1:1570:1838/1
-GTACAACACGATTGTACCAAACACATGTAGAAGTAG
-+HWI-EAS337_3:7:1:1570:1838/1
-WWWWWWWWWWVWWWWWWWWVVVVWVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:209:1126/1
-GAAATACAAGATGAACAACACACAAGACTTTCTAGG
-+HWI-EAS337_3:7:1:209:1126/1
-WWWWWWWWWWWWVVVWWWWWWWWVVVWWWWUUUUSR
-@HWI-EAS337_3:7:1:219:655/1
-GGCCATATCAGATGATATAGTTAATGAGCATTTCTA
-+HWI-EAS337_3:7:1:219:655/1
-WWWWWWWWWWWWWWWWWWWVWWWWWVVTWWUUUUUR
-@HWI-EAS337_3:7:1:503:1494/1
-GACAGAATGTTAAAGTGTTCATAAAATTCTTATTAC
-+HWI-EAS337_3:7:1:503:1494/1
-WWWWWWVWWWWWWWVWVVWVWWVWWVWWWWUUUUUR
-@HWI-EAS337_3:7:1:477:1119/1
-GCAAGCTGGGTCGGGCTCGCCGATTAGTTTGGTGGT
-+HWI-EAS337_3:7:1:477:1119/1
-WWWWWWWWWWWWWWWWWWWVWWVVWVWVVVRSUUSF
-@HWI-EAS337_3:7:1:787:664/1
-GAGAAATTGTGGCTCGTACCATTTTTCATTCAGAAT
-+HWI-EAS337_3:7:1:787:664/1
-WWWWWWWWWWVWWWWRRJVVFVWWWCMCVCPSMMRU
-@HWI-EAS337_3:7:1:1677:1383/1
-GTATGGTGAATTGATAGGTTAGCATATTCTGCACTG
-+HWI-EAS337_3:7:1:1677:1383/1
-WWWWWWWWWWWWVWWWWVWWWVWWWWWWWWRUUUUR
-@HWI-EAS337_3:7:1:372:338/1
-GAAATTCCAAATCTTGTTCAACTTTAACTAGAACAA
-+HWI-EAS337_3:7:1:372:338/1
-WWVWWWWWWWWVWWVVWWWWWWWVWVWWWWSUUUUU
-@HWI-EAS337_3:7:1:235:1271/1
-GTTCTTTACTGCAGGTTATCTTGTGTGAAGCAGCTT
-+HWI-EAS337_3:7:1:235:1271/1
-WWWWWWWWWWVWWVWWWVWVWWVWVVTVVJUSSUUU
-@HWI-EAS337_3:7:1:793:463/1
-GTTCCCTTTATCACCACTATCTTGCTTTGATTCTTC
-+HWI-EAS337_3:7:1:793:463/1
-WWVVWWWWWWWWWWWVWWVWWWWVWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1107:1481/1
-GAGCATAATCGGTGTTGGCCTTTTGGGAACCTAAAA
-+HWI-EAS337_3:7:1:1107:1481/1
-WWWWWWWWWWWWWWWWTVWWWVWWQVTVVWUUUUUU
-@HWI-EAS337_3:7:1:1707:116/1
-GAAGTAGATTGTGATTTCATTCTAACAAAAGGTCGA
-+HWI-EAS337_3:7:1:1707:116/1
-WWWWWWWWWWWWVVWWWWWWWVWWTWWWWWUUUUUU
-@HWI-EAS337_3:7:1:40:839/1
-GGTCAATTAAGTTCGTTGGTACTGTTATACCGTTCA
-+HWI-EAS337_3:7:1:40:839/1
-WWWVWWWWWWWVWWVWWUWWVWWVWWVWWVSUUUUU
-@HWI-EAS337_3:7:1:1525:1694/1
-GTGCAATTCATATGTTAACATTTTTATATTATAATT
-+HWI-EAS337_3:7:1:1525:1694/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:555:836/1
-GTAATTTTTATTATTCTTTTCCAAAGAATCAATTAT
-+HWI-EAS337_3:7:1:555:836/1
-WWWWWWWWWWWWWWWWWWWWWWWWVTVVWVUSUUUU
-@HWI-EAS337_3:7:1:1446:438/1
-GGTATTAGTGGCCAAATCAAAAATTCATTAACAAAC
-+HWI-EAS337_3:7:1:1446:438/1
-WWWWWWWWWWVWWVWWWWWVWWVWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:39:687/1
-GCATGGCTTCCATACGTAGTGCATTCAATGTGATAA
-+HWI-EAS337_3:7:1:39:687/1
-WWWWWWWWVWWVWWWVWVWQVVWWWVVWWTUSUUUU
-@HWI-EAS337_3:7:1:542:1307/1
-GAATTTTGTTTATAGATAACTCCACATGAATCTTCT
-+HWI-EAS337_3:7:1:542:1307/1
-WWWWWWWWWWWWWWVWWWWWWWVWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1061:248/1
-GAAAAAAGATTCTTACGCGAGAGTTGAAGAGACGGT
-+HWI-EAS337_3:7:1:1061:248/1
-VWWWWWWWWWWWWWWWVWVVVWVWWTWWVVSUUSUR
-@HWI-EAS337_3:7:1:28:1437/1
-GTTAGTGAAAAATACAAAATGGAATTTTTCAACTCA
-+HWI-EAS337_3:7:1:28:1437/1
-WVVWVWVVWWVWWWWWVVVWWVWWWVWWWVUUSUUU
-@HWI-EAS337_3:7:1:1715:1647/1
-GTCCGCACTCTTGTTCATTTTAGCCATGGAAGGTCT
-+HWI-EAS337_3:7:1:1715:1647/1
-WWWWVWWWWWWWVWVWVWWWWVQWWVVVQVUUSUUU
-@HWI-EAS337_3:7:1:1139:1518/1
-GATTCTCTACAGAGAAAAACTGGCACTTGACTATTC
-+HWI-EAS337_3:7:1:1139:1518/1
-WWWWWWWWWWWWWWWWWWVWWWWWVVWWVVUUUUUU
-@HWI-EAS337_3:7:1:288:1442/1
-GTCTTAACTAGAACTCTTGTTTCTCACACCAGCGAG
-+HWI-EAS337_3:7:1:288:1442/1
-VVWVWVWWVWVWWWWWUWVVWWVWWWTWVWUSUSUU
-@HWI-EAS337_3:7:1:745:905/1
-GTGATCGAAGTGACGATGACATGGACGAGGATGAGG
-+HWI-EAS337_3:7:1:745:905/1
-WWWWWWWWWVWVWWVWWVWWVWVVVVVVWVUUUSUU
-@HWI-EAS337_3:7:1:1162:377/1
-GACTAATCGTGTCATTCAAATTGATAATTTCAGATT
-+HWI-EAS337_3:7:1:1162:377/1
-WWWWWWWWWWWWWWWWWWVWWWVWWWVWWWUUSUUU
-@HWI-EAS337_3:7:1:1133:790/1
-GTTGATCTAGGGTTTTTTAAGTAACTAACCAAATAC
-+HWI-EAS337_3:7:1:1133:790/1
-WWWWWWWWWWWWWWWWWWWVVVWWVWWWVWUUUUUU
-@HWI-EAS337_3:7:1:117:1433/1
-GAACATGAGATTTCATGGTTCTCAACCCACTTCATT
-+HWI-EAS337_3:7:1:117:1433/1
-WWWWVWWWWWWVVWWWWUKWWWWVVWTWWWUUUUUR
-@HWI-EAS337_3:7:1:242:1316/1
-GCAAGAAGGGGTACATTTTGGGAGTTGGCAAAGTAG
-+HWI-EAS337_3:7:1:242:1316/1
-WWWWWWWWWWWWWWWWWWWWVWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:450:850/1
-GGTGATCCTTCACTCCTTGGTCTTGAAGAAGTTTTG
-+HWI-EAS337_3:7:1:450:850/1
-WWVWWWWWWWVWWWVWWWVWWWWWVVPVVVSUUUUR
-@HWI-EAS337_3:7:1:825:183/1
-GTTTATAACGTTCATAAAGAGTGGTATAAAGCTATA
-+HWI-EAS337_3:7:1:825:183/1
-WWWWWWWWWVWWWWWWVWVWVWVVVWWVWWUUUUUU
-@HWI-EAS337_3:7:1:156:945/1
-GTATTATTAGAGTCGTCAAATTTCAATTTCTGAATG
-+HWI-EAS337_3:7:1:156:945/1
-WWWWWWWWWVWVWWVWWWVWWWWWVVWWWOURUUUR
-@HWI-EAS337_3:7:1:355:1628/1
-GCTTTTTGAGGGCTCCACTTTACTATTCGGCCATTT
-+HWI-EAS337_3:7:1:355:1628/1
-WWWWWWWVWWVVVWWWWWWWWWWWWWWWVTUUUUUU
-@HWI-EAS337_3:7:1:158:1322/1
-GGACTGTGAGTGATGGCAACAAAATTGAAAGAGTGA
-+HWI-EAS337_3:7:1:158:1322/1
-WWWWWWVWWWWVWWWWWWWWWWVWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1332:1533/1
-GTAGTAATAATTATTGTGGAGAATTTGGAGTTGGAG
-+HWI-EAS337_3:7:1:1332:1533/1
-WWWWWWWVWLVNVWWWCWVVVVVWWWVPVVUUUPPS
-@HWI-EAS337_3:7:1:5:1075/1
-GGGAAAGATATCTGGAAAACACTTTGGGAATTTATT
-+HWI-EAS337_3:7:1:5:1075/1
-WWWWWWWWWWWWWVWWWWWWWWWJTQVKVVSUCRRU
-@HWI-EAS337_3:7:1:372:1222/1
-GAGTGGGAAGTGAGAGATGACGAGTTATTTCAACTC
-+HWI-EAS337_3:7:1:372:1222/1
-WVVWWWWVWWVVWVWVWWWVVVVWVWCVVVRRUUSU
-@HWI-EAS337_3:7:1:774:1959/1
-GCAGCTAGAAGCGGCAGAATATGCTGATCCATGTTG
-+HWI-EAS337_3:7:1:774:1959/1
-WWWWWWWWVWWWWWWWWWVWWWVWWVVWWVUUSUUR
-@HWI-EAS337_3:7:1:1215:682/1
-GTTAAAGTATCACTACAATTGAATCATGAATCAGGT
-+HWI-EAS337_3:7:1:1215:682/1
-WWWWWWWWWWWWWWWWWWWWVVVWWWWWVVUUSUUU
-@HWI-EAS337_3:7:1:685:179/1
-GATGGAACTGTTTTTTTAAAAAAAAAAAAAAATAAA
-+HWI-EAS337_3:7:1:685:179/1
-WWWWWVWWWWVVVVRWVQWWWFTKWWWWWWRMCSUR
-@HWI-EAS337_3:7:1:1704:1820/1
-GTTAAATGAAAGAAAATTATGAAAAAAGCTATCATA
-+HWI-EAS337_3:7:1:1704:1820/1
-VWWWVWWVWVWVVWVVWWWWVWVWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:404:1544/1
-GTAAGGAAGTAAAAACTAGTATCAAGCCATTAAAAC
-+HWI-EAS337_3:7:1:404:1544/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:1723:81/1
-GATTTTAAGCATTGTTTCGTGTTATACTGTATCTTT
-+HWI-EAS337_3:7:1:1723:81/1
-WWWWWWWWWWWWWWWWWWVWVWWVWWVWTWUUUUUU
-@HWI-EAS337_3:7:1:300:1349/1
-GTTTATCCAAAGTACCCATGGAGATCAAATTCTTTA
-+HWI-EAS337_3:7:1:300:1349/1
-WWWWWWWWWWWVWWWWWVWVVVVWWWWWVWUUUUUU
-@HWI-EAS337_3:7:1:447:637/1
-GTTATAACTTGTTACCTAGCATTTTTGTTGAAGGCG
-+HWI-EAS337_3:7:1:447:637/1
-WWWWWWWWWWWWWWWWWWVWVWWWWWJWWQUUROUJ
-@HWI-EAS337_3:7:1:1253:661/1
-GTGAACTTGACCTTGTGTGTTGCTTATTTGTAATGA
-+HWI-EAS337_3:7:1:1253:661/1
-WWWWWWWWWWWWWWWWVWWWWVWWWVWWWQUUSUQJ
-@HWI-EAS337_3:7:1:670:832/1
-GGTTGGTTGGAAAATTTGAACCATCTTCACCATTCG
-+HWI-EAS337_3:7:1:670:832/1
-WWWWWWWWWWWVVWVWWVVWVVVWWWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1742:1532/1
-GTTGTCAGAAATCGTTTGTAGATGTGAAAAAAAGGG
-+HWI-EAS337_3:7:1:1742:1532/1
-WWVWWWWVWWVVWWWWWVWWVWWWWVWVWVUUUUUO
-@HWI-EAS337_3:7:1:1759:230/1
-GGAAAGAGACAGCAACATCAATGAAAAGTCTGACCA
-+HWI-EAS337_3:7:1:1759:230/1
-VVWWWSWVVWWVWWWVVSWVVVWVVVVVOWUTUUFU
-@HWI-EAS337_3:7:1:528:1415/1
-GATTAATTTTCCTGTAAGATCTGGTGAAATGAGAAG
-+HWI-EAS337_3:7:1:528:1415/1
-WWWWWWWWWWWWNXWWWXXWWWWVWVVWWWSUUUUJ
-@HWI-EAS337_3:7:1:823:430/1
-GAGAAGGTGACCTAGAACAGTGCAGCTCATTAGTAG
-+HWI-EAS337_3:7:1:823:430/1
-WWWWWWWWWWWWWWVVWWVWWVWWWWWVVWUUUUUR
-@HWI-EAS337_3:7:1:140:1178/1
-GGTATTGAGTTCCATGAAAAAGCGCTCCGTCACTGA
-+HWI-EAS337_3:7:1:140:1178/1
-WWWWWWVWWWWWWWWVWWWWWVWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:74:1869/1
-GAGTTATTAGAGGTGGCTGGATTAGATGAGACTCAT
-+HWI-EAS337_3:7:1:74:1869/1
-WVVWVWWWPSVVPVNPKPVVCWVLSCVSVLHJCHLU
-@HWI-EAS337_3:7:1:905:1526/1
-GTTATATGAGTTCACTGTAATTCTCTTGAGTTCATT
-+HWI-EAS337_3:7:1:905:1526/1
-WWWWWWWVWVWWWWWWVWWWWWWWWWWVVKUUUUUU
-@HWI-EAS337_3:7:1:1199:845/1
-GAAGTGTTAGAGTCAAAACGTCAAGAAACGTCCAAG
-+HWI-EAS337_3:7:1:1199:845/1
-WWWWWWWWWWVVWWWWWWWWVWWVVVWWVVUUUUSU
-@HWI-EAS337_3:7:1:401:232/1
-GATGGTGGTGGAGGTAATGGTAACAATGTTGGCAGG
-+HWI-EAS337_3:7:1:401:232/1
-WWWWWWWWVWVWVVWWWWWVVWWVVVWWWWUUUUUR
-@HWI-EAS337_3:7:1:58:2006/1
-GGATTGCAGACAAAAGGCGATCAAAAAGACTTCTGG
-+HWI-EAS337_3:7:1:58:2006/1
-WWWWWWWWWWWWWVVWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:85:1214/1
-GGAGTGAAATAAATATTGGTTGGTTGTGTCCGAGGA
-+HWI-EAS337_3:7:1:85:1214/1
-WWWWWWWWWWWWWWWWWWVWWVWWWVWTWWUQUSQU
-@HWI-EAS337_3:7:1:198:779/1
-GATGAATTCAATCGTGTCTCAGCTTGTGAGTCTGCT
-+HWI-EAS337_3:7:1:198:779/1
-WWWWWWWWWWWWWVWWWWWWWVWVWWWVWTUUUSUU
-@HWI-EAS337_3:7:1:1750:769/1
-GGTATGGGGCTAAGCTGATTGGCAATGTAAGCTACC
-+HWI-EAS337_3:7:1:1750:769/1
-WWVWWWWWWWWWWWWWWWWWWWVVVVWWVVUUUUSU
-@HWI-EAS337_3:7:1:539:1726/1
-GAAATAATTGAGTCTTTAACCAAACTAATGCACATT
-+HWI-EAS337_3:7:1:539:1726/1
-WVWWWWWWWVWVWWVVVWWWWWWVWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1321:841/1
-GATCTTTCTTTTTTGCCCATCATTCTGTTTTGAATA
-+HWI-EAS337_3:7:1:1321:841/1
-WWWWWWWWWWWVWVKWWWWWWWWWWWVWWWUQUUUO
-@HWI-EAS337_3:7:1:66:508/1
-GTTTCAGCATCAAAACCTGAACAAACTTCACAATCA
-+HWI-EAS337_3:7:1:66:508/1
-WWWWVWWWWWWWWWWWWWVWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:61:1374/1
-GGTATTATTCTGCACAAGAGTCTGTTGAATTGTTTC
-+HWI-EAS337_3:7:1:61:1374/1
-WWVWWWWWWWWVWWWVWVWVWWWVWWQVWWUKUUUO
-@HWI-EAS337_3:7:1:38:388/1
-GATTTGTGGTGTTTCTAGGATTGTTACAGTTGAACC
-+HWI-EAS337_3:7:1:38:388/1
-WWWWWWWVVWWWWWWWWVVWWWQWWWWVQWUKSUUR
-@HWI-EAS337_3:7:1:67:749/1
-GAGGTGCGTTTTGAGTCGCTCATGTTTTTTTTTTGT
-+HWI-EAS337_3:7:1:67:749/1
-WWWWVVWVWWWWWWVWWVWWVTVKUVOWWWUUSOQU
-@HWI-EAS337_3:7:1:197:1740/1
-GTATACGCACACCCTACCCCTATCTTGGTAGGTAGA
-+HWI-EAS337_3:7:1:197:1740/1
-WWWWWWWWWWWWWWWVWVWWWVWWWWVTWWUSUUSR
-@HWI-EAS337_3:7:1:465:1949/1
-GATACTGTGCTGTTGAATAAGTTGGACTGCTTCTGT
-+HWI-EAS337_3:7:1:465:1949/1
-WWWWWWWWWWWWWWVWWWWWVWWVVWWWVVUUUURU
-@HWI-EAS337_3:7:1:362:1896/1
-GACTGATCTTTATAACTAGCAAAAGGAAAAGACTGA
-+HWI-EAS337_3:7:1:362:1896/1
-WWWWVWWWWWWWWWWWWWWWWWWWVWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1734:1594/1
-GTGGAGGACTTATGGCTTACGTCGCAGGTTCAAGCC
-+HWI-EAS337_3:7:1:1734:1594/1
-WWVVWVWVWWVVWVVWWUTVVVTVVJVTOOUSUOCU
-@HWI-EAS337_3:7:1:1156:692/1
-GGGGCACAAAATTTGTTCAGAATCGCGCTACAAGTT
-+HWI-EAS337_3:7:1:1156:692/1
-WWWWWWWWWVWWWWWWWWWVWWWWVWVWWVUUUUUU
-@HWI-EAS337_3:7:1:578:927/1
-GATTTCAACACACTCTTGCTGAGGATTTTAAGAACA
-+HWI-EAS337_3:7:1:578:927/1
-WWWWWWWWWWWWWWWWWVWWVWVVVWWWWVUQUUUU
-@HWI-EAS337_3:7:1:319:1321/1
-GGATTGATCAACTAGATTTGATTAGATGAAAAGAGA
-+HWI-EAS337_3:7:1:319:1321/1
-WWWWWWWWWWWWWWVWWWWVWWWWVVWWWVUUUUUU
-@HWI-EAS337_3:7:1:69:787/1
-GCATTAGAAGGTATCTTGTTTCAGCTTTAGACTTTT
-+HWI-EAS337_3:7:1:69:787/1
-WWWWWWWWVWVWWWWWWVWWWWWUWWWWVLUUUUUU
-@HWI-EAS337_3:7:1:1750:321/1
-GTATAAATTAGTATAGGATATTGAAAGCAGCATGAG
-+HWI-EAS337_3:7:1:1750:321/1
-WVVVWWVVWWWWWVVWVWWVWWUWVVWVVVURUSUR
-@HWI-EAS337_3:7:1:1669:538/1
-GGTATATTGCTGACAAGCTATCTTACTTACTTTCCT
-+HWI-EAS337_3:7:1:1669:538/1
-WWWWWWWWWWWWWWWWVWWWWWWWVVWWVVUUUUSU
-@HWI-EAS337_3:7:1:1757:1992/1
-GACAATTCCTGCACTAATTAAGGAGAGTTAGTGACT
-+HWI-EAS337_3:7:1:1757:1992/1
-WWWWWWWWWWVWWWWWWWWWWVVWVWVWWVRUUUUU
-@HWI-EAS337_3:7:1:111:1847/1
-GCAGCTCATTAGTAGAAGACCAATACAGTTAAACAA
-+HWI-EAS337_3:7:1:111:1847/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:394:1169/1
-GATCACACCTCTGCTCTAAGTATTTGTGATAGCTTC
-+HWI-EAS337_3:7:1:394:1169/1
-WWVWWWWRWVWWWWWWWVWVWVWWWVVVVWUSUUUU
-@HWI-EAS337_3:7:1:42:1868/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGTAA
-+HWI-EAS337_3:7:1:42:1868/1
-WWWWWVWWWWVWVVVWWQVVVVVVVVVOVOUSQRSR
-@HWI-EAS337_3:7:1:1494:1206/1
-GCAGCTGGTGTAATGAGTGTTGTAGCTGAAAATAGA
-+HWI-EAS337_3:7:1:1494:1206/1
-WWWWWWWWWWWWWWWWVWWWWVVVVVWVVVUUUUSR
-@HWI-EAS337_3:7:1:360:1738/1
-GTAGCAACTGGAATTGGAGATTCTTCATTCAAATGA
-+HWI-EAS337_3:7:1:360:1738/1
-WWWWWWWWWVWVWWWWVWVWWWWWWVWWWVUUUUQU
-@HWI-EAS337_3:7:1:564:1869/1
-GTTCACATGGTTGGTCTCAAGTTCGAATGCAGTAGG
-+HWI-EAS337_3:7:1:564:1869/1
-WWWWWWWWVWWWVWVWVVVWVWWWVVVWVVURUUUR
-@HWI-EAS337_3:7:1:421:211/1
-GAAACAAAAGGCTTTTCAGGGACAAGGAACGCATCT
-+HWI-EAS337_3:7:1:421:211/1
-WWWWWWWWWWWWWWWWWWWVVWWWWVVWWWUUUUUU
-@HWI-EAS337_3:7:1:1707:1813/1
-GACTCCAGGTGGTGCTAGTCTTCCAATAAATGCATA
-+HWI-EAS337_3:7:1:1707:1813/1
-WWWWWWWWWWWWWWWWWWWVWWVVUVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1341:296/1
-GTAATTGTATGACATATATATACACAAAACCACATG
-+HWI-EAS337_3:7:1:1341:296/1
-WVWWWWWWWWVWWWWWWWWWWWWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:319:1481/1
-GTCATCTCCTACTTTAAACTCTTTCCTACCTGTAAT
-+HWI-EAS337_3:7:1:319:1481/1
-WVWWVVVVWVWWWWVVVVWWVWWVWVWVWWUSUUUC
-@HWI-EAS337_3:7:1:142:1838/1
-GTCCACCCCTGTTCTTCTTGTCTTCTCCGACCAGCT
-+HWI-EAS337_3:7:1:142:1838/1
-WWWWWWWWWWWVWWWWWWWVWWWWVWVWKVUUUSUU
-@HWI-EAS337_3:7:1:421:2008/1
-GATGTTTTGGTTTCTAGACTCCCTGAATGACTTATA
-+HWI-EAS337_3:7:1:421:2008/1
-WWWWWWWWVWWWWWWWVWWWWWVWVWWWVWUUUUUR
-@HWI-EAS337_3:7:1:1559:1251/1
-GATTGTCACTTGAAAAGAATAACAAATTAGAACAGG
-+HWI-EAS337_3:7:1:1559:1251/1
-WWWWWWWWWWWWWWWWVWWWWWWWWWWWWTUUUURU
-@HWI-EAS337_3:7:1:57:1971/1
-GGCGGGGAAGTGTTTGAGTATGCGTTGAAGTTGGCT
-+HWI-EAS337_3:7:1:57:1971/1
-WWWWWWWWWWWWWWWVWVWWWVWVWWTVVQUUSSSU
-@HWI-EAS337_3:7:1:1716:1922/1
-GTGTTGCCTGGCACTTGCAAGATTGGCAACAAAACC
-+HWI-EAS337_3:7:1:1716:1922/1
-WWWWWWWWWVVWWWWWVWVVVWWWVVWVVVUUUUUR
-@HWI-EAS337_3:7:1:1749:1460/1
-GGTTTTGAAGTGTGCGATCCAGATTTAGTTGGAGCT
-+HWI-EAS337_3:7:1:1749:1460/1
-WWWWWWWWWVWWWWWWVWWWWVVWWVWQWWUSUURU
-@HWI-EAS337_3:7:1:222:1299/1
-GAAATAAAACGGGAAAGAAACGCTAGTGGAACATAA
-+HWI-EAS337_3:7:1:222:1299/1
-WWWWWWWWWWWVWWWVWWWWVWVWWWRWWVUUUSU@
-@HWI-EAS337_3:7:1:902:144/1
-GTATAAAAAAGTGAAAACAAACAAATGGATTCATAA
-+HWI-EAS337_3:7:1:902:144/1
-WWWWWWWWWWVVWWWWWWWWVVVWVOVVVVUUUUUU
-@HWI-EAS337_3:7:1:1661:1357/1
-GAATGGTTGCCTTGTTCTAGTTTGAACTAAAGGCGT
-+HWI-EAS337_3:7:1:1661:1357/1
-VWWWVWWWVSSWVVVWVSWVWWVQVVVWWVUQUCCU
-@HWI-EAS337_3:7:1:1284:151/1
-GGTAAGTTGAAGAGTTAAAGAATACACCTAAACTAT
-+HWI-EAS337_3:7:1:1284:151/1
-WWWWWWWWWWWVWWWWWWWVWVWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:1706:1649/1
-GTAGAGGAGGTAGGATTGGTGGTCCCTCTATGGTTA
-+HWI-EAS337_3:7:1:1706:1649/1
-WWWWWWWVWWVVWWRWWVVTVVQCVVLJVPURUICO
-@HWI-EAS337_3:7:1:301:1341/1
-GGACTTTGAACGAAAAAGGCATTTCTGGTTCAAAAA
-+HWI-EAS337_3:7:1:301:1341/1
-WWWWWWWWWWWWWWWWWWVWWWWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:1132:84/1
-GAAGGTCCTTTTCATGCCAAAGTTAGCCCATTGATA
-+HWI-EAS337_3:7:1:1132:84/1
-WWWWWVWWWWWWWWWVWVWWWVWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:914:1523/1
-GTTGACACTTCCATGGCTGCAAGCCTGCAATCATCG
-+HWI-EAS337_3:7:1:914:1523/1
-WWWWWWWWWWWWWWVWWWWWVVWVWWVVVVUUMUUU
-@HWI-EAS337_3:7:1:661:829/1
-GATGAAGTTTGATGAACTCCTCTACCTTAGCTTCCC
-+HWI-EAS337_3:7:1:661:829/1
-WWWWWWWWWWVVWVWWWWWWWWWWWWWWTQUUUUUR
-@HWI-EAS337_3:7:1:973:1460/1
-GTTATTGGACAGGTACTCAATAGAGTCATCATGGTG
-+HWI-EAS337_3:7:1:973:1460/1
-WWWWWWWWWWWWVWWWWWWWWWWWVVVWWVUUUUUR
-@HWI-EAS337_3:7:1:197:1458/1
-GACATGGGGTCCCCTTGTCTGATCCCTAGCTGAGCA
-+HWI-EAS337_3:7:1:197:1458/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1160:804/1
-GAATATTGCTGGTTCTAGATATGTGTTCAAAAAAAA
-+HWI-EAS337_3:7:1:1160:804/1
-WWWWWWWWWWVVWWTWWVWVWWVVVVWVVVUUUUUR
-@HWI-EAS337_3:7:1:1667:1426/1
-GAGGTGTATGTCAAGCAACCTCCTGGTTTCGAAGAT
-+HWI-EAS337_3:7:1:1667:1426/1
-WWWWWWWWWWVVWWVWWQWOVVWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:541:1871/1
-GCTATTCAGTTTGTCTGCTGAATATTTAAGTAAGTA
-+HWI-EAS337_3:7:1:541:1871/1
-WWWWWWWWWWWWWWWWVWWVVVWWWWWVVTUUUOUU
-@HWI-EAS337_3:7:1:1187:1503/1
-GGTGATCCTTCACTCCTTGGTCTTGAAGAAGTTTTG
-+HWI-EAS337_3:7:1:1187:1503/1
-WWVWWWWWWWWWWWWWWWVWVVWWVVVVTSUUUUUR
-@HWI-EAS337_3:7:1:1568:1164/1
-GTGGTAATGGTTTCAAATAGAAGGTATAATGGTAAG
-+HWI-EAS337_3:7:1:1568:1164/1
-WWWWWWWWVWWWWWWVWVWVWVVVWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:574:1909/1
-GCGACATGGGGCCTCCGTGATGTCACTTGTCTCAAC
-+HWI-EAS337_3:7:1:574:1909/1
-WWWWWWWWWWWWWWWWWWWVWWWWWWWWTVUUUUSU
-@HWI-EAS337_3:7:1:187:307/1
-GAGTTTTGATACAACAACTTTCAGTTCTAGAGATTG
-+HWI-EAS337_3:7:1:187:307/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWWVUQUUUU
-@HWI-EAS337_3:7:1:1119:1764/1
-GTAAAAAAAAAAAAGCAAAGTTGGCCCTACATTTAA
-+HWI-EAS337_3:7:1:1119:1764/1
-WWWWWWWWWWWWWWWVWWVUVVVWVWWVVVSUUUUU
-@HWI-EAS337_3:7:1:1758:1587/1
-GAACTTCACTTACATTTAAGTGAAACTAATTGTAAA
-+HWI-EAS337_3:7:1:1758:1587/1
-WWWWWWWWWWWWWWWWWWWXWVWWWWWWWWUSUUUU
-@HWI-EAS337_3:7:1:726:740/1
-GAAGCATATGATCACTTTTCTGTGTTTGACATAAAG
-+HWI-EAS337_3:7:1:726:740/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVRUUUQUR
-@HWI-EAS337_3:7:1:207:510/1
-GCACTGAGTAAGCCTGTCCAATACTAATGCTGCTAC
-+HWI-EAS337_3:7:1:207:510/1
-WWWVWWVWWWVWWVWWWVWVVWVVWVVWVVUUUUUU
-@HWI-EAS337_3:7:1:1382:1638/1
-GAGAAAGAAAGAAAGGTGGCAAATTTCACTTTTCGA
-+HWI-EAS337_3:7:1:1382:1638/1
-WWWVWWWWWWWWWWWWVWVWWWWWWWVWWWUUUUSU
-@HWI-EAS337_3:7:1:1084:1408/1
-GATTAACTTAAGTTAAGACTTAAAGGATTAAACATG
-+HWI-EAS337_3:7:1:1084:1408/1
-WWWWWWWWWWWVWWWWVWWWWWWWVVVWWWUUUUUR
-@HWI-EAS337_3:7:1:1747:1652/1
-GGATATGTTGGACAGGTACTTCAAGGGTGAGGATTT
-+HWI-EAS337_3:7:1:1747:1652/1
-WWVWWWVWWVVVWWVWWWWWWWWWVVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1102:148/1
-GTATAATCTACTTTTGAGAAAATCCAACTTGCGTCT
-+HWI-EAS337_3:7:1:1102:148/1
-VWWWWWWWWWWWWWWVWUWWWWWWVVWWWWSUUUUU
-@HWI-EAS337_3:7:1:108:2000/1
-GTTATGCAAATGACCAGATAATGGGCATAGCCAAAT
-+HWI-EAS337_3:7:1:108:2000/1
-WWWWWWWWWWWVWWWWVWWWWWVVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:647:1105/1
-GGCATGGGATTCCTTTGTCTATCACTTAAGATAGAG
-+HWI-EAS337_3:7:1:647:1105/1
-WWWWWVWWWWWWWWWVVWWWWWWVVWVWVVUSUSUU
-@HWI-EAS337_3:7:1:342:1207/1
-GCTAAGTATTCCACGGGTACAACTCTAGCCTCCAAG
-+HWI-EAS337_3:7:1:342:1207/1
-WWWWWWQWVWWWWWVWVWVWWWWVVVVWWVUUUUNS
-@HWI-EAS337_3:7:1:488:1331/1
-GCTAAAAGGCTGTAAAATTTAAGTAAATAGACCTCT
-+HWI-EAS337_3:7:1:488:1331/1
-WWWWWWWWWWWWWWWWVWWWWWWVWWVWWTUUUUUU
-@HWI-EAS337_3:7:1:1303:1495/1
-GGCAAAGTCAAGGTGACTCTACAAGGTTTTGTGGAT
-+HWI-EAS337_3:7:1:1303:1495/1
-WWWWVWWWWWWWWVWWWWWWWVWVVVVWWWUUSUUR
-@HWI-EAS337_3:7:1:1749:368/1
-GAATGCTACTGTGTCTTTACCCATGTAAAAAGTACT
-+HWI-EAS337_3:7:1:1749:368/1
-VSWVWWWWWWWSWVOQSVWVQVSVVWVSWVUUUUSU
-@HWI-EAS337_3:7:1:75:262/1
-GTTTAGAACCAAAAGTAGCATAAAACACAATCTTGA
-+HWI-EAS337_3:7:1:75:262/1
-WWWWWVWWWWWWWWVWWVWWWWWWWWWWWVUUUUSU
-@HWI-EAS337_3:7:1:313:510/1
-GTAGTTCTCCTTTGTTTGGACACATGGGGGGTGGGG
-+HWI-EAS337_3:7:1:313:510/1
-WWWWWWWWWWWWWVWWWVQWWWVVWVVTTVSUUUQR
-@HWI-EAS337_3:7:1:113:163/1
-GAATTAAATTGGTCCATAAAATCTACAAAATCGAAT
-+HWI-EAS337_3:7:1:113:163/1
-WWWWWWWWWWVVWWWWWVWVVWWWWWWWWVUUSUUU
-@HWI-EAS337_3:7:1:273:1806/1
-GATCTTGAGAAAGAAGTCTATGGAGCAACCACCTGG
-+HWI-EAS337_3:7:1:273:1806/1
-WWWWWWWWWWWWWWWVWWWWWWWVWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1251:35/1
-GATGTTTTTTTTTCTATTGTTGATTTCCCTGATCTA
-+HWI-EAS337_3:7:1:1251:35/1
-WWWWWWWWWWWWWWWWWWQWWQVWWWVVVWQUUSUR
-@HWI-EAS337_3:7:1:1536:1250/1
-GAATCTTCTGTTTCGCCACTGCTCTCTTCCTCCGTA
-+HWI-EAS337_3:7:1:1536:1250/1
-WWWWWWWWWVWWWVVWVVWVVVVVTVVFIVUSPUUS
-@HWI-EAS337_3:7:1:1703:886/1
-GAAAGGCTATATCTTGATAACAATAAGCTATCAAAT
-+HWI-EAS337_3:7:1:1703:886/1
-WWWWWWWWVWWWWWWWWVWWWWWWWWVWVVUUUUUU
-@HWI-EAS337_3:7:1:1514:1258/1
-GGACGGGATCAGAGAAGCTAAAAGATATAACAAAGT
-+HWI-EAS337_3:7:1:1514:1258/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1336:45/1
-GTTTAATCTAGTGTGTGACATGTTGATTGTTAGTTT
-+HWI-EAS337_3:7:1:1336:45/1
-WWWWWWWWWWVWVWVWVWWVWVWWVVWWQWURKUUU
-@HWI-EAS337_3:7:1:651:248/1
-GTTTATGATACTTTTCAGTGTCTTTTTTTTTTTTTT
-+HWI-EAS337_3:7:1:651:248/1
-WWWWVWVWVWWWWWWVVMGJFJVVNVVLNNINCNLN
-@HWI-EAS337_3:7:1:612:1821/1
-GTCCGATAGTCCACAAGAACTGTATTTCAGAAAGTT
-+HWI-EAS337_3:7:1:612:1821/1
-WWWWWWWWWWWWWWWWWWWWWWVWWWWWWVUUUSUU
-@HWI-EAS337_3:7:1:58:1209/1
-GAATTCAACCATCTCGGATTTTTTTGGGCATATTCC
-+HWI-EAS337_3:7:1:58:1209/1
-WWWWWWWWWWWWWWWWWWWWWWWWWTTTVVUUUUUU
-@HWI-EAS337_3:7:1:1597:58/1
-GATAAAATTCCACCACTGGCCTCTAAGCATTAGCAA
-+HWI-EAS337_3:7:1:1597:58/1
-WWVVWWWVWWWWWWVWTUVWVVVTVWVVOTUUUFJR
-@HWI-EAS337_3:7:1:1678:1838/1
-GATCGGTTGCTAATGTTTTCCAGTATCGTATTAAAC
-+HWI-EAS337_3:7:1:1678:1838/1
-WWWWVWWWWWWWWWWWWWVVWVVWVWWTVVUUUUUM
-@HWI-EAS337_3:7:1:1608:1451/1
-GTGAGATCACATTGAGTATGGTGTTGTACACTGTTC
-+HWI-EAS337_3:7:1:1608:1451/1
-WRWWVWWWWWWWWWWWWVWWVWWWWWWVVVUUTUUU
-@HWI-EAS337_3:7:1:1632:1539/1
-GAACATTATCTAACATAGAAAACTAAATCATGGGAC
-+HWI-EAS337_3:7:1:1632:1539/1
-WWWWWWWWWWWWWVWVWVWWWWVWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:149:752/1
-GTCGAAGTTGTTCCTGGAACAAAGATTGATAATCAT
-+HWI-EAS337_3:7:1:149:752/1
-WWWWWWWWWVWWWWWWVWWWVWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1667:277/1
-GTTGGATAAGGTTTAGCAAGGTAGACTACTTGCTAC
-+HWI-EAS337_3:7:1:1667:277/1
-WWWWWWWWWWWWWWWWWWWVWVVVVWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1666:76/1
-GAAGGGATTCTAAATTGGAGAGATAAGAAGGGACAA
-+HWI-EAS337_3:7:1:1666:76/1
-WWWWWWWWWWWWWWWWVVVVWVWWWVVWVVUUUUUU
-@HWI-EAS337_3:7:1:73:712/1
-GTTATGTTTCTCGGACCCTCCAAAAATATCATCATA
-+HWI-EAS337_3:7:1:73:712/1
-VWWWWVWWWWWWUUWWWWWWWVWVVWWVWWUUUUUU
-@HWI-EAS337_3:7:1:203:1333/1
-GTAACGTCTGTAAATCAGTAAAGCGTCGTTTCAAAA
-+HWI-EAS337_3:7:1:203:1333/1
-WWWWWWWWWWWWVWVWWVWWWWVWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:60:1655/1
-GTATCTCCTTCTTGAGAATTTAGGTCGAACGTAGTT
-+HWI-EAS337_3:7:1:60:1655/1
-WWWWWWWWWWWWWUWVWWWWWWKUWWVWWVSUUSUU
-@HWI-EAS337_3:7:1:407:1998/1
-GTTATTGCTCATGTGGATTATAATGGAGTATGTTAT
-+HWI-EAS337_3:7:1:407:1998/1
-WWVWWVVVWVWWVWVVWVWVWVWWUTWVVWURUUUU
-@HWI-EAS337_3:7:1:1117:235/1
-GGAGTGTCCGGAGCGGTAAAGAAGTATGAACAGAAT
-+HWI-EAS337_3:7:1:1117:235/1
-WWWWWWWWWWWVWWWWVWVWWVVWVWWVVVUUUUUU
-@HWI-EAS337_3:7:1:911:250/1
-GTTAAACAAAAGAGTGGGAGATGGAACATTTAAGAC
-+HWI-EAS337_3:7:1:911:250/1
-VWWWVVWWWWVVVVVWWVVWWVVTVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:1721:641/1
-GATTCATGTTATATTTCCCCTACTGCACTCTTCATT
-+HWI-EAS337_3:7:1:1721:641/1
-WWWWWWWWWWWWWWWWWWWWWWWVVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:476:1816/1
-GTTGTGGCTCTCTCGGTTAGCTTTTTCCTTTTCTTC
-+HWI-EAS337_3:7:1:476:1816/1
-WVWVWWWWWVSSQVQVVFSRKVWVWCDVVQTUUFUF
-@HWI-EAS337_3:7:1:143:720/1
-GTGAGAGCTAGCCATATGAAGGACCAGATATTGAAA
-+HWI-EAS337_3:7:1:143:720/1
-WWWWWWWSWWWWWWWVWWWWWWVWVWVWWWUUUUUU
-@HWI-EAS337_3:7:1:832:1285/1
-GAGATTCCCGTTTGATTCACCTTTGAATCTGACTGG
-+HWI-EAS337_3:7:1:832:1285/1
-WWWWWWWWWWWWWVWWWWWWVWWWVVVWWWRUUUSR
-@HWI-EAS337_3:7:1:41:174/1
-GATGTAGGTATTCTCAAAATGGCAAACAGATCCACT
-+HWI-EAS337_3:7:1:41:174/1
-VVSWWWWWSVWWVWWQVVWWSVWWVSVVVVUUOUUU
-@HWI-EAS337_3:7:1:1695:777/1
-GAAAAAAATTTAAGAAAGTATTAGTAGGAGTCAAGA
-+HWI-EAS337_3:7:1:1695:777/1
-WVWWWWVWWWWWWVWWVWQWWWWVWWVVVVUUUUSR
-@HWI-EAS337_3:7:1:1696:1375/1
-GTTGATGTCGCTTTCTCTTTGCATGTTTGTAGAAAA
-+HWI-EAS337_3:7:1:1696:1375/1
-WWWWWWWWWSWWWVWWWWWWRVVVQWWWHWQOUSUS
-@HWI-EAS337_3:7:1:70:1427/1
-GGCGATGTTACGAACCATGAATGCCTCACCAGGTTG
-+HWI-EAS337_3:7:1:70:1427/1
-WWWWWWWWWWWWWWWWWWVWWWVVWWWWWVSUUUUU
-@HWI-EAS337_3:7:1:323:1253/1
-GTAAAAAGGAAAGTATCTTACTGTATCCTACTACTC
-+HWI-EAS337_3:7:1:323:1253/1
-VWVWWVWWWWWVUQVVVWWWVVVVVVTVVVUUUSSU
-@HWI-EAS337_3:7:1:170:1879/1
-GGAGATTCAATCTTGGTTGCACCTGTTCGACAAGAA
-+HWI-EAS337_3:7:1:170:1879/1
-WWWWWWWWWWWWWWVVWWVWWWWWVWWWQVUSURUU
-@HWI-EAS337_3:7:1:1752:1848/1
-GATAGTCCACTCATTGTCTGACCTGGTGATCTTTCT
-+HWI-EAS337_3:7:1:1752:1848/1
-WWVWWTVVWWWWVWWVVWWWVVVVVWVWJVJUUUCU
-@HWI-EAS337_3:7:1:1692:296/1
-GCAGAGAGACCAGAGAGAACGACCAGTGTTAGTTCT
-+HWI-EAS337_3:7:1:1692:296/1
-WWWWWWWWWWWWWWWWWWWWVVWWVWVVVWUUUUUU
-@HWI-EAS337_3:7:1:1070:1639/1
-GAAAGAGTCCCACATCGCGGCCCTTTAAGGAATGAG
-+HWI-EAS337_3:7:1:1070:1639/1
-WWWWWWWWWWWWWWWWWWVVWWWWVWVVVVUUUSUR
-@HWI-EAS337_3:7:1:405:1238/1
-GTATGCCAGAGCGTCTTTTTCCTTTGGCATGGGGGC
-+HWI-EAS337_3:7:1:405:1238/1
-VWWWWWWWWWWWWWWWWVWWVVWVVVVVTWURUUUU
-@HWI-EAS337_3:7:1:385:1089/1
-GGGGTAGAGGGGTATCCAAGAAAGGGTAGAAAGGAC
-+HWI-EAS337_3:7:1:385:1089/1
-WWWWVWWWWVWWUWWWWVWVVVWWVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:124:1913/1
-GAATTCTAAGAAGTCTGCCAGCACTTAGACCTTGGA
-+HWI-EAS337_3:7:1:124:1913/1
-WWWWWWWVWVWWVWWWVWWVVWVWWWWVWWUUUUSU
-@HWI-EAS337_3:7:1:745:422/1
-GTGTGGTAAGAAATTGTATTGATAATGCAAAAAGTG
-+HWI-EAS337_3:7:1:745:422/1
-WWWWWVWWWWWWWWWVWWWWVWWWVWVVWWUUUUUU
-@HWI-EAS337_3:7:1:448:1686/1
-GAACATATCCTCCCAAAATAGTGAACAATGCACTTC
-+HWI-EAS337_3:7:1:448:1686/1
-WWWWWWWWWWWWWWXWWTWXWVWVWWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1765:849/1
-GAGCCACAAATATCAAGGGATCCCAGTCTTTTGTCA
-+HWI-EAS337_3:7:1:1765:849/1
-VWWWVVWWVVWVWWWVVWVVWVWWVVVWWWUSRIUR
-@HWI-EAS337_3:7:1:300:280/1
-GGTTTTAATTACCCTTTTATCCTCTGTGCGAAACTC
-+HWI-EAS337_3:7:1:300:280/1
-WWWWWWWWWWWWWWWWWWWWWVWWWTWVWTUUUUUU
-@HWI-EAS337_3:7:1:845:1489/1
-GATTACACTTGGTATGTTGTTGTTACCTACTGATTT
-+HWI-EAS337_3:7:1:845:1489/1
-WWWWWWWWWWWWVWWVVWWWWUWWVVWWVVUSRUUU
-@HWI-EAS337_3:7:1:767:1506/1
-GGAACATGGTTAAGGAATATGAAGGGTTTTTTTGTT
-+HWI-EAS337_3:7:1:767:1506/1
-WWWWWWWWWWWWWWWWWWWWVWWVWVVWWWUUUSUU
-@HWI-EAS337_3:7:1:113:1346/1
-GAATGTCTTTATTGAGTTGATTTTGGTGTTTGTATA
-+HWI-EAS337_3:7:1:113:1346/1
-WWWWWWWWWWWWWUWVWWVVWWWWQLWTWWUHUUUU
-@HWI-EAS337_3:7:1:584:873/1
-GAGAGGGCAATATAAATGGAGGCTTATTCACATGCT
-+HWI-EAS337_3:7:1:584:873/1
-WVWWWWWWVWWWWWWWWVWWWWVWWVWWVWUUUUUU
-@HWI-EAS337_3:7:1:779:479/1
-GTCGAGGCACTTGCATTCGAAGAAACGCTAAAATGT
-+HWI-EAS337_3:7:1:779:479/1
-WWWWWWWWWWWWVWWWWWVWVVVWWVVVWVUUSUUU
-@HWI-EAS337_3:7:1:1638:394/1
-GAATGAAGCTGACGAGAATATATGTCAAGATTACCA
-+HWI-EAS337_3:7:1:1638:394/1
-WWWVVWWWWWWWWVVVVWWVWWVWWVVVVVUUSSUU
-@HWI-EAS337_3:7:1:560:1678/1
-GTTGGTGGGTTAAGTTAGAATGTATCTATTATAGGT
-+HWI-EAS337_3:7:1:560:1678/1
-WWWWWWWVWWWWWVWWWVWWWVWWWTWWWWRUUJOU
-@HWI-EAS337_3:7:1:1541:1684/1
-GAACAACATTCTTTGAACTGGATCACCTTCTCTTGT
-+HWI-EAS337_3:7:1:1541:1684/1
-WWWWWWWWWVWWWVVVWWWVVWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1356:1744/1
-GATCTGAGCCTCAACATCAGATGAGTTCCGGAATCC
-+HWI-EAS337_3:7:1:1356:1744/1
-WWWWWWWWWWWWWWWWWWVWWWVVWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1618:1813/1
-GGAGTTAATCGAGAAATCTGATAGAACTACACCACC
-+HWI-EAS337_3:7:1:1618:1813/1
-WWWWWWWWWWWWWWWWWVWWWWWVVWVWWVUUUUUU
-@HWI-EAS337_3:7:1:1749:1985/1
-GATTTGGGAGCCGCTCGGAAGATTCTAGGGATGGAG
-+HWI-EAS337_3:7:1:1749:1985/1
-WWWWWWVVWVWWVWWWVWVVVVWWVWVVVVSUUSPR
-@HWI-EAS337_3:7:1:405:1052/1
-GGGACTGGGGATTTGATGATAAATTCCAGCACCATT
-+HWI-EAS337_3:7:1:405:1052/1
-WWWWWWWWWVWWWWWWWVWWWWWWWWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1715:1896/1
-GAAGTTTATTGCCTTCTGCTTTTATTTTTTTGTCAC
-+HWI-EAS337_3:7:1:1715:1896/1
-WWWWWWWWWWWWCWVWWVWWWWVVVWWVWWUJSOS@
-@HWI-EAS337_3:7:1:394:355/1
-GTCAGCGAGGTAGAGGAGAGGGATGGGAAGCTTTGG
-+HWI-EAS337_3:7:1:394:355/1
-WWWWWWWWWWWWWWWWWVWWVVVWWVWVVVUUUUUR
-@HWI-EAS337_3:7:1:1050:198/1
-GGTGAATTCACAAGCCTCTCTTTCCCTACCTGCTCC
-+HWI-EAS337_3:7:1:1050:198/1
-WWWWWWWWWWWWWWWWWWWVWWWVVVWVTVUSUUUU
-@HWI-EAS337_3:7:1:77:1361/1
-GTCTAACTATCATTTTGTACAACTTATCTTTAGGTT
-+HWI-EAS337_3:7:1:77:1361/1
-WWWWWWWWWWWWWWWWVWWWWWVWWVWVWWUUSQUU
-@HWI-EAS337_3:7:1:399:92/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGTAA
-+HWI-EAS337_3:7:1:399:92/1
-VWWWWWWWWWVWVWVVVQVMVWVVVWVSTPUUUOSR
-@HWI-EAS337_3:7:1:242:215/1
-GGATTATAAAGAAAATTGGTCCAACTGAGAAAATTT
-+HWI-EAS337_3:7:1:242:215/1
-WWWWWWVWVWWWWWWVWWVVWWVWWVVWWVUUUUUU
-@HWI-EAS337_3:7:1:433:1943/1
-GTGAACATATCATCAATATTTTCTTGACATCGCACT
-+HWI-EAS337_3:7:1:433:1943/1
-WWWWWWWWWWWWWWWWWWWWWWWWWTWVVWUQUUUU
-@HWI-EAS337_3:7:1:1455:1155/1
-GACACATGGGTGTTGACTGAGTTACCTGCAGGGAAG
-+HWI-EAS337_3:7:1:1455:1155/1
-WWWWWWWWWWVWWWWWWWUWVWWVWVWVVVSUUSUU
-@HWI-EAS337_3:7:1:1522:1188/1
-GTGTATGTTGGAAGAAATTATAGAGAACATCTTCGG
-+HWI-EAS337_3:7:1:1522:1188/1
-WWWWWWVWWVWWWVWWWWWVWWUWVVWVWWUUUUSR
-@HWI-EAS337_3:7:1:286:1481/1
-GGTCAGGGGTGCACCTAATTGAGTCTAATTGTTTCA
-+HWI-EAS337_3:7:1:286:1481/1
-WWVWWVWVVWWWUWWUVVWWVWVWVWWVWVUUUSUU
-@HWI-EAS337_3:7:1:37:1622/1
-GTAACATACTTTGCTCAGCTGTTGTTACCATTGCCA
-+HWI-EAS337_3:7:1:37:1622/1
-WWWWWWWWWWWWVWWWWQWVVWWVWWVVVVUUJURU
-@HWI-EAS337_3:7:1:1687:93/1
-GATACCTTTCCTTTGTGAATATCCTTTAACCACTAA
-+HWI-EAS337_3:7:1:1687:93/1
-WWWWWWWWWWWWWWVWVWWWWWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:6:1402/1
-GTTTGGAGAACTATCCTAAGATGTATAACATGATAC
-+HWI-EAS337_3:7:1:6:1402/1
-WWWWVWWVWWWWWWWWWWWVWWVWWWVWWWUUUUUR
-@HWI-EAS337_3:7:1:112:1381/1
-GACATGAAAGGTCTGTTGAAAACAGGCACACTGCAA
-+HWI-EAS337_3:7:1:112:1381/1
-WWWWWWWWWWWWWWWWWVWWWWVWWWWWWWUUUUSU
-@HWI-EAS337_3:7:1:1710:24/1
-GTTTGGGGCATGGAGACTATTGACCCGTATCTTGGC
-+HWI-EAS337_3:7:1:1710:24/1
-WWWWWWWWWWWVWWWWWWWWWVVVVWVVVVUUUURU
-@HWI-EAS337_3:7:1:315:1228/1
-GGTGTTGAGGCTGTTTCCTTCTTTCAAGGCTTTTAT
-+HWI-EAS337_3:7:1:315:1228/1
-VWWWVVVWVSVWSQVSCQVWCQVVHDRKHFUFOCCS
-@HWI-EAS337_3:7:1:745:1077/1
-GAATGATAAACCTAAAAGAAGGCACGATCAAACGGT
-+HWI-EAS337_3:7:1:745:1077/1
-WWWWWWWWWWVWVWQWQWVWVVWWPWWVVVUUUUUI
-@HWI-EAS337_3:7:1:1066:1849/1
-GAAAAGCACCTTCTAGACAGTTCTTAACTAAAATGT
-+HWI-EAS337_3:7:1:1066:1849/1
-WWVWWWWWWWWWWWWWWWWVWWWWWVWVWWUUUUSU
-@HWI-EAS337_3:7:1:581:2009/1
-GAACTTAGCTATTGGTATTTACCACATCATTTGAGA
-+HWI-EAS337_3:7:1:581:2009/1
-WWWWWWWVWWWWWWWWWWWWWWWWWWWWWWUURUUU
-@HWI-EAS337_3:7:1:1543:1796/1
-GATGAGCTTGCTTTTGAGGTTGACCTAGGCCGAAGG
-+HWI-EAS337_3:7:1:1543:1796/1
-WWWWWWWWWWWWWWWVWVVWWVWVWWWTVVUSUUSR
-@HWI-EAS337_3:7:1:686:1068/1
-GGAAGCAGTGTGAGAATGAAGCACAACAAATTCTCT
-+HWI-EAS337_3:7:1:686:1068/1
-WWWWWWWWWWWWWVWWWWWWVWVVWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1675:642/1
-GTAAAGCAAATATTTAAGGAGAGTCCTGTCCCTTTC
-+HWI-EAS337_3:7:1:1675:642/1
-WWWWWWWWWWWWWWWWWVWWVVVWWVWVVVUUUUUR
-@HWI-EAS337_3:7:1:97:1361/1
-GTAACAGATGCACAGTTAAAGTTGGGATTGAAAAAA
-+HWI-EAS337_3:7:1:97:1361/1
-WWWWWWWWWWWWWWVWWWWWVWWVVVWWWVUUUUUU
-@HWI-EAS337_3:7:1:54:1932/1
-GTAATCGATTATGAGATATATTCAGCACACGAAGTG
-+HWI-EAS337_3:7:1:54:1932/1
-WWWWWWWWWWWWVWWWWWWWWWWWVWVVWWUUUUUU
-@HWI-EAS337_3:7:1:476:1210/1
-GATGCCTTTGGGATTGGCAATGTTGAATTCGATCGC
-+HWI-EAS337_3:7:1:476:1210/1
-WWWWWVWWWWWWVWWVWWWVWVWWVVVWWVSUUSUU
-@HWI-EAS337_3:7:1:612:1478/1
-GAAGCAGAGGATTTGGTGAAAAGCATGCCCATGAGA
-+HWI-EAS337_3:7:1:612:1478/1
-WWWWWWWWWWWWWWWVWVWWWWVWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:88:688/1
-GATTAATGTTTCTCTGTCTATTTCTTTTCCCTTTAG
-+HWI-EAS337_3:7:1:88:688/1
-WWVWWWWWWWWWWWWWWWWWWWWWWWWWVWRUUUUJ
-@HWI-EAS337_3:7:1:1427:1478/1
-GTATTAGGGTGTATTCGGTACGAAGGAAAATGTTTT
-+HWI-EAS337_3:7:1:1427:1478/1
-WWWWWWWVWWVWWWWWVVVWWWVWVWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1642:1597/1
-GAGCCAGATCCAAGGGATGACCTATCTGGAACAGAC
-+HWI-EAS337_3:7:1:1642:1597/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1389:1774/1
-GACGATTTTCGTGTGCTATTGCACACCATTTTTTGG
-+HWI-EAS337_3:7:1:1389:1774/1
-WWWWWVVWWWVVVWVCUWVWQVTVVVCPWWUUSURF
-@HWI-EAS337_3:7:1:1180:117/1
-GAAAATCACTCTCTTCCAATCTCTTTGATTCGTTTA
-+HWI-EAS337_3:7:1:1180:117/1
-WWWWWWWWWWWWWWWWWVWWWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:74:1988/1
-GTTTCTTATTGCTCTATGTAATGTAGAATTATCTAA
-+HWI-EAS337_3:7:1:74:1988/1
-WVWWWWWWVWVWWWWWWVVWWWTVWTVVWWUUUUUU
-@HWI-EAS337_3:7:1:938:1884/1
-GTTTAGAAGAAAACCCATTTGTAGAAAAAAAACCCT
-+HWI-EAS337_3:7:1:938:1884/1
-WWWVWWWWVWWWWWWWWWVWWVWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:164:1584/1
-GTGAGGGGACATATTGAAGATATAATAAAATAAACA
-+HWI-EAS337_3:7:1:164:1584/1
-WWWWWWWVWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:739:393/1
-GAATAAAAACTGCATGTCCAATTCGTTTCGTCTGTT
-+HWI-EAS337_3:7:1:739:393/1
-WWWWWWWWWWVVWWWWVVVWWVVWWVWSVVUUUUUU
-@HWI-EAS337_3:7:1:194:875/1
-GTAGCTCCGCCACTGGATATAGCCCAAACAGGAGAG
-+HWI-EAS337_3:7:1:194:875/1
-WWWWWWWWVWWWWWWVWWWWWVWWWVVVWVRUUUUR
-@HWI-EAS337_3:7:1:1748:1638/1
-GAAGTTCCATTTGATGATTGCTTGATTTGCAGCCCC
-+HWI-EAS337_3:7:1:1748:1638/1
-WWVWWWWWWWWWVWWVWWWVWWWUVWWWTVUKUSUU
-@HWI-EAS337_3:7:1:36:1262/1
-GTATGTTTGTCCTTCGGTATCTGATGAACCTTTGCA
-+HWI-EAS337_3:7:1:36:1262/1
-WWWWVWWWVWWWWWWUUWWWWWUWWTVWVVUUURUR
-@HWI-EAS337_3:7:1:506:1049/1
-GTCGACTGTGCTATAAACCGGCTGATATAGTTTAAT
-+HWI-EAS337_3:7:1:506:1049/1
-WWWWWWWWWVWWWWWWWWWVWWWWVVVWVVUUUUUU
-@HWI-EAS337_3:7:1:960:155/1
-GTTTTGAAGCGTTAACCCTTAGACTGGTTAAGAACA
-+HWI-EAS337_3:7:1:960:155/1
-WWVWWVWWVWVVWWWOWWWTVTVWVVVWWTURUUSU
-@HWI-EAS337_3:7:1:1760:1107/1
-GAATTGATTGATCGACAACAATAAATTAGTGTGGTG
-+HWI-EAS337_3:7:1:1760:1107/1
-WWWWWWWWWVWWWUWWWWWWWWWVVVWWVWUUUSUR
-@HWI-EAS337_3:7:1:881:441/1
-GCCTTTTAGCATGATCAAAGTCAAACCTTATCTGTC
-+HWI-EAS337_3:7:1:881:441/1
-WWWWWWWWVWWWVWWWWWVVWWWWWVVWWVUUUSUU
-@HWI-EAS337_3:7:1:713:1296/1
-GGAGGAAAAATCATGGACATAACAGATAGTGGGCAA
-+HWI-EAS337_3:7:1:713:1296/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1703:1622/1
-GTGTTCTTAGTGCTTCATTTAGTTTTCAAGATCTTA
-+HWI-EAS337_3:7:1:1703:1622/1
-WWWWWWWWWVWVWWWWWWWWWLWWWWWWWKUUUUUU
-@HWI-EAS337_3:7:1:114:374/1
-GTTATTTTTCCCTAAAAAAGCAAATACATATTCAGA
-+HWI-EAS337_3:7:1:114:374/1
-WWWVWWWWWWWWWWWWWWVUVVWWWWVVWVUUUUSR
-@HWI-EAS337_3:7:1:1688:1598/1
-GACCGAAAGATGTCTAGTGGAAAGTAGCCCAGTGGA
-+HWI-EAS337_3:7:1:1688:1598/1
-WWWWWWWWWWWWWWWWWWVVWWWWWWWWVWUUUSUU
-@HWI-EAS337_3:7:1:1164:1787/1
-GAAGTGTGAAATTGATAGATTTAGTGGGCGCACCAA
-+HWI-EAS337_3:7:1:1164:1787/1
-WWWWWWWWWWVWWWWWWWWWWWWVVWVWVWUUUUUU
-@HWI-EAS337_3:7:1:321:1064/1
-GGAAGCAGAATCATTCTGACGACTCAGTTTTATGGT
-+HWI-EAS337_3:7:1:321:1064/1
-WVWVWWWWWWWWWWWWWWWWVWWWVVVWVWUUUURU
-@HWI-EAS337_3:7:1:168:1419/1
-GGATCTGTTGACCTTCCTAGGTCAAGACAAGTTTCA
-+HWI-EAS337_3:7:1:168:1419/1
-WWWWWWWWWVWWWWWWWWVVVWWWWVWWWWSUUUUU
-@HWI-EAS337_3:7:1:174:1900/1
-GAGGATGATCCATTAACCGCAGGAACAGTGGAGACT
-+HWI-EAS337_3:7:1:174:1900/1
-WWWWWWWWWWWWWWWVWWWWVWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:399:1239/1
-GGTATGGTCCATTTATGGTGGAAGTGTTATGTGCTT
-+HWI-EAS337_3:7:1:399:1239/1
-WWVWWWWWVVWWWWVWVVWVWVLWVVVWVWUUUSLU
-@HWI-EAS337_3:7:1:213:1008/1
-GATCTGTACACCTCTCTTTTTGCTGAATATATCAGC
-+HWI-EAS337_3:7:1:213:1008/1
-WWWWWWWWVWWWVWWWVVWVWVWWVVTWWWUUUURU
-@HWI-EAS337_3:7:1:656:1907/1
-GATTCTTGTCATGGTATATATCATGCTATTACCTTC
-+HWI-EAS337_3:7:1:656:1907/1
-WWWWWWWVWWWWVVWVWWWVWVVWQVWVWWUUSUUU
-@HWI-EAS337_3:7:1:1622:793/1
-GATTATGGTTAGGAGAAAGGAAAGAGGATCTGAGCA
-+HWI-EAS337_3:7:1:1622:793/1
-WWWWWWWWWWWWVWVWWWVWWWVWVVWVWVUUUSUR
-@HWI-EAS337_3:7:1:736:1713/1
-GTAGAGGAGGTAGGCTTGGTGGTTCTGTAGATGTTT
-+HWI-EAS337_3:7:1:736:1713/1
-WWWWWWWWVWVVVWVWWQUUVVQVOWCVQQRUKUUU
-@HWI-EAS337_3:7:1:168:2006/1
-GCAGACCAAGCAAAATTATATTTATCTGGTATGGCT
-+HWI-EAS337_3:7:1:168:2006/1
-WWWWWWWWWWWWWWWULWWVWVWWWVTVQTUSSUUU
-@HWI-EAS337_3:7:1:1707:99/1
-GTAATGAGTAGATATGCAATTCAATGTCTTTCACTT
-+HWI-EAS337_3:7:1:1707:99/1
-WWWWWWWWWVWWWWWWWWWWWWVVWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:278:1921/1
-GTTTTAAGAACATTTATACAGATGACATTATCACAT
-+HWI-EAS337_3:7:1:278:1921/1
-WWVWWWWVWWWWWWVWWWWWWWWUVVVWWVUUUSUR
-@HWI-EAS337_3:7:1:307:1516/1
-GGTTGCCACTGAAAAGGTATGCAGCATACTACTGTT
-+HWI-EAS337_3:7:1:307:1516/1
-WWWWWWWWWWWWWWVWVWWWVWWVWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:489:749/1
-GTTTCTGGATATCCTATATTTTGCTGGTCTATTGTT
-+HWI-EAS337_3:7:1:489:749/1
-WWWWWWWWVWWWWWWVWWWWWWQVWKKWVWRUUJUU
-@HWI-EAS337_3:7:1:1530:889/1
-GTATTTTCGAAGGTTGGCAACCAGGCATCCAAGAGG
-+HWI-EAS337_3:7:1:1530:889/1
-WWWWWWWWVWWVVWWVWWWWVVVWWVVWVVUUUUUU
-@HWI-EAS337_3:7:1:147:207/1
-GTAGGGAGTATAAAGAAAATTGGTCCAACTGAGAAA
-+HWI-EAS337_3:7:1:147:207/1
-WWWWWWVWWWWWVWVVWWWWWVVWWWVWWWSRSUUR
-@HWI-EAS337_3:7:1:204:2014/1
-GAGTTTTACAATCAAATCACAAATTCGTCCAGGTCT
-+HWI-EAS337_3:7:1:204:2014/1
-VWWWWWVVWWWWWUWWVWWVWVVVVVVWWVUSRUUU
-@HWI-EAS337_3:7:1:272:336/1
-GCATAACGTTTCTGCTCCACGATCGAATCCTTTACG
-+HWI-EAS337_3:7:1:272:336/1
-WWVWWWWWVVWWWVWWVVVWVWWWVWVWVVUUUUUR
-@HWI-EAS337_3:7:1:722:1047/1
-GGTGTAACTTGCTCCACTTAGATTCTTCAGTAGGAG
-+HWI-EAS337_3:7:1:722:1047/1
-WWWWVWWWWWVWWWWWWWWWVWWWWWWWWVUUQSUO
-@HWI-EAS337_3:7:1:592:1943/1
-GATGTCTGAACTTTTTGATTTTAACATGGACAGAGA
-+HWI-EAS337_3:7:1:592:1943/1
-WWWWWWWVWVWWWWWWVVWWWWWVWVWTTWUURURU
-@HWI-EAS337_3:7:1:1246:1669/1
-GATGTTGTCAATTTCCTCTTGGAGACTAATAGCAGT
-+HWI-EAS337_3:7:1:1246:1669/1
-WWVWWWWVWWWWWWWWWWWWVVVVVVWWVWSUUOUU
-@HWI-EAS337_3:7:1:1285:664/1
-GTGAGTCATCGCTCCTAAACCCTATACTACTGTATT
-+HWI-EAS337_3:7:1:1285:664/1
-WWWWWWWWWWWWWWWWWWWWWWWVVVVWVVUSUUUU
-@HWI-EAS337_3:7:1:1595:1417/1
-GACTACTCCAGTACCGGATGTTGAAGAAAAGATAAG
-+HWI-EAS337_3:7:1:1595:1417/1
-WWWWWWWWWWVVWWWWWVWWJTVVVVTWVVSSUSUR
-@HWI-EAS337_3:7:1:1625:2032/1
-GAAAAGAAAGATCAATATTGTGTTGGATGTTCGTTG
-+HWI-EAS337_3:7:1:1625:2032/1
-WWWWVWWWWWWWWWWWWWWWWWWWVVVWVWUUSUUO
-@HWI-EAS337_3:7:1:1686:88/1
-GTATTCAGAGGATCGTTTTGTAAGTTTGAGTGTTCA
-+HWI-EAS337_3:7:1:1686:88/1
-WWWWWWWWWWWWWWWWWWWVWVVTVWWOVVURUUUU
-@HWI-EAS337_3:7:1:935:170/1
-GTTACAGTTGAACCAAATGAAACTGTTCTAGCCACA
-+HWI-EAS337_3:7:1:935:170/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1501:1737/1
-GATGCTTTGCCCTCCATCATAAGGCTTTAGCATGTT
-+HWI-EAS337_3:7:1:1501:1737/1
-WWWWWWWWVVWVWVWWWWVWVWVTVWVWWVUSUSUU
-@HWI-EAS337_3:7:1:1478:1158/1
-GCATCCACTGTCGATGTTGGAAAGGTGCACTTTGTC
-+HWI-EAS337_3:7:1:1478:1158/1
-WWVWWWWWWVWWWVWVWWVUVWVVVWVVVWUUUSUU
-@HWI-EAS337_3:7:1:611:223/1
-GTTTATGGCTAAACTACCTCTTTTCAAATGTAAGAT
-+HWI-EAS337_3:7:1:611:223/1
-WWWWWWVVWWWWWWWVVVVVWWWWWVVWWTUUUSUU
-@HWI-EAS337_3:7:1:353:1776/1
-GTACTTCAGAAATCATTTTAAATCTACTTTAGACTA
-+HWI-EAS337_3:7:1:353:1776/1
-VWWWVSWWVWWVVWVWSWWVVWVOVVVWWVUQUSUU
-@HWI-EAS337_3:7:1:735:412/1
-GTTGGTGGACTGTTCTTGTTTCTCCTGGAGCTGAGC
-+HWI-EAS337_3:7:1:735:412/1
-WWWWWVWWWWWWWWWWWQVWWVWWWWVKWTUUOUSU
-@HWI-EAS337_3:7:1:165:963/1
-GATTTGAATTTTAAGAATACAGTTGCAAGGTGTTAT
-+HWI-EAS337_3:7:1:165:963/1
-WWWWWWWWWWWWWWVWWWWWWVWWVWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1681:172/1
-GAAAGGTCAGGAACTTAATTAATTCAGTTTGCTCTT
-+HWI-EAS337_3:7:1:1681:172/1
-WWWWWWWWWVWVWWWWWWWWVVWWWVVWWWSUUUUU
-@HWI-EAS337_3:7:1:1744:1598/1
-GGTTTAGGGTGTGAAGATTTTATTAGACGAATGAAG
-+HWI-EAS337_3:7:1:1744:1598/1
-VVWWWWWVWVWWVWWWWWUWWWWWVQWOWVUUUSUU
-@HWI-EAS337_3:7:1:1492:1506/1
-GTTCAATCGATGAGTGAGTCTCCGAAGCCGTTCGAG
-+HWI-EAS337_3:7:1:1492:1506/1
-WWWVWWWWWWWVWWWWVWVWWVVVVVVVVVRURSPR
-@HWI-EAS337_3:7:1:1454:245/1
-GTTTTGATGAGTACTTTTCCTATATTTGTAGATTTT
-+HWI-EAS337_3:7:1:1454:245/1
-WWWWWWWWWWVWWWWWWWVWWWWVWWVTWWQUUUUU
-@HWI-EAS337_3:7:1:246:159/1
-GTAGTTTAAGACTCTCATTGGATTCACTGTGCATTG
-+HWI-EAS337_3:7:1:246:159/1
-VWWWWWWWVVWWWWWWWVWVVWWWWWWWOWSUUUUK
-@HWI-EAS337_3:7:1:948:1034/1
-GAGTTAATACTAGATGTGTTAATTTATAAATAATGA
-+HWI-EAS337_3:7:1:948:1034/1
-WWWWWWWWWVWWWVVVWVWWVVVWWWWWVVURUUSU
-@HWI-EAS337_3:7:1:413:137/1
-GATGTGAATCCTGTCCATAGAAATTTGTTATGGTGG
-+HWI-EAS337_3:7:1:413:137/1
-WWWWWWWWWWWWVWWWWWWWWVWWWWVWWVURJUUK
-@HWI-EAS337_3:7:1:1703:1432/1
-GGTGCATGAATTGGGGTTATTTTTTTTTTATTATTG
-+HWI-EAS337_3:7:1:1703:1432/1
-WWWWWWWVWWWWWVVVWWWWWWWWWWWWVVQRUCS@
-@HWI-EAS337_3:7:1:1664:832/1
-GCAGTGCCATTGCAGGTAAGAAAAATATTGCAAACC
-+HWI-EAS337_3:7:1:1664:832/1
-WWWWWWWWWWWWWVVWWWWWWWVVWWWWWVUUUUUR
-@HWI-EAS337_3:7:1:1168:788/1
-GTTGGTTGACCTGAGGAGGAGATGGAGTTGCCTTCC
-+HWI-EAS337_3:7:1:1168:788/1
-WWWWWWWWWWWWVWVWVVVVWWWWVVVVVVUUUFSU
-@HWI-EAS337_3:7:1:108:1801/1
-GACTCTTTGACAGAAGGGTACAAGAGATTATCTTTT
-+HWI-EAS337_3:7:1:108:1801/1
-WWWWWWWWVWWWVWVVVVWWWWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:23:1994/1
-GTCTCATCGTCAGCTCTGCAGTTTGTCTTTCCATAG
-+HWI-EAS337_3:7:1:23:1994/1
-WVWWWWWWWWWWWVVVWQVVVVWWTTTVWVUUUUUC
-@HWI-EAS337_3:7:1:1760:1630/1
-GCGAGATTGGGAGACGGAGGAGAGAGGCGAGCGAGA
-+HWI-EAS337_3:7:1:1760:1630/1
-WWWVWWWWVVWWWWWWWWVWVVVWVWVVVVURUUUO
-@HWI-EAS337_3:7:1:180:217/1
-GTATAAGTGTCAACGAATAATGGACCTACGGGGCAT
-+HWI-EAS337_3:7:1:180:217/1
-WWWWVWWWVWWWWWWWWWWWWVWWVWWVWVUUUUUU
-@HWI-EAS337_3:7:1:54:1523/1
-GACAAAAGGTACTCTTTGAAGTTTACTCAACTCTCT
-+HWI-EAS337_3:7:1:54:1523/1
-WWWWWWWWWWVWWWWWWVVVVWWVWWVWVWUUUUUU
-@HWI-EAS337_3:7:1:1286:2010/1
-GATATTTTCAAAGAATGGTTGGAGGTTGGATAATTT
-+HWI-EAS337_3:7:1:1286:2010/1
-WVWVSVWWWWWWVWWWWWWWVWWVVVWVVVUUTUCU
-@HWI-EAS337_3:7:1:127:1419/1
-GGAGGTCCTGGAAATCATACACCATTTTGTTGAGAT
-+HWI-EAS337_3:7:1:127:1419/1
-WVWWWWWWWVVWWWWWWWWWWWWWWWWWVWUQUUUU
-@HWI-EAS337_3:7:1:430:972/1
-GTAACCTTGTTTTAAATGTTTCCCAACAGATATGAG
-+HWI-EAS337_3:7:1:430:972/1
-WWWWWWWWWWWWWWWWWVWWWWWWWWWWVVUUUURU
-@HWI-EAS337_3:7:1:1290:858/1
-GTGTGTAATTAATTATTAACAATTAATTAAAATTCT
-+HWI-EAS337_3:7:1:1290:858/1
-WWWWWWWWWWWWWWWWWWWVWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:26:689/1
-GTTTATTGATCCTCTTTCTAGCATCTTGATGTCTCC
-+HWI-EAS337_3:7:1:26:689/1
-WWWWWWWSWWWWWWWWWWWWSWWWWWWQVWKUUUUS
-@HWI-EAS337_3:7:1:1574:359/1
-GTAATTCTAACCTTCTTAAATTAAGGTTAGTTTTAC
-+HWI-EAS337_3:7:1:1574:359/1
-WWWWWWWWWWWWWWWWWWVWWWWVTTWWWVUUUUUR
-@HWI-EAS337_3:7:1:138:337/1
-GAATGATGAATGTAGTGTACCTGACCTCGTGGTATC
-+HWI-EAS337_3:7:1:138:337/1
-WWWWWWWWWWWWWWVWWWWWWWVWWWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1756:1872/1
-GTACTTTTTATTACTATCAAGCATGAGTACTGTACA
-+HWI-EAS337_3:7:1:1756:1872/1
-WWWWWWWVWWVVWWWWVCWWVVWVVVVVVVUSUUIR
-@HWI-EAS337_3:7:1:1590:363/1
-GAACGTAAGTGTCATAAAATTGTATATAACATACCA
-+HWI-EAS337_3:7:1:1590:363/1
-WWWWWWWWWWWWWWWWWVWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1474:1451/1
-GTGTGTCACAGATCTGTGACAAAGGAAATGAGGTCA
-+HWI-EAS337_3:7:1:1474:1451/1
-WWWWWWWWWWWWWWWVWVVWWWVVVVVVWVUUSUUU
-@HWI-EAS337_3:7:1:1622:411/1
-GTTTTTTCAATGCTCAGCTAGGGATCAGACAAGGGG
-+HWI-EAS337_3:7:1:1622:411/1
-WWWVWWWVWWWVVWWWVWWVVVVVVVWWVVUUUQLU
-@HWI-EAS337_3:7:1:362:1267/1
-GCTCCGGGGCTCGTTTGACCTTCCAAATGGCCCAGA
-+HWI-EAS337_3:7:1:362:1267/1
-WWWWWVWWWWWWWWWWVWVWWVVWVVVVVOUUUUUU
-@HWI-EAS337_3:7:1:161:435/1
-GTGATAGTAAAGTAAGAAGAAATGAAAATAAAACAT
-+HWI-EAS337_3:7:1:161:435/1
-WWWWWWVWWWWVWWWWWWVWWWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:461:1484/1
-GAGGAAACGTGAACTTTTTTATTTACGGTGCTTATG
-+HWI-EAS337_3:7:1:461:1484/1
-WVWWWWWWWVWWVWWVWWVWWVWWWWVQVVUUUUUR
-@HWI-EAS337_3:7:1:688:2000/1
-GATATACTTGTCTGGTTATTCACTCAATGGGGCTTT
-+HWI-EAS337_3:7:1:688:2000/1
-WWWWWWWWWWWWWWVWWWWWVWVWWVWWVKSUUUUU
-@HWI-EAS337_3:7:1:1585:1436/1
-GAATCTCCCTCCGTGATGCGCAACCAAGTCCCAGAT
-+HWI-EAS337_3:7:1:1585:1436/1
-WWWWWWWWWWWWVWVVWVWVWVVWVVVVVVUUUUSU
-@HWI-EAS337_3:7:1:21:465/1
-GCTATATCACTGTGGGATAAATGTTCTGCAAACTAA
-+HWI-EAS337_3:7:1:21:465/1
-WWWWWWWWWWWWWVVVWWVWWWVWWWWVWWUUUUUR
-@HWI-EAS337_3:7:1:1685:1551/1
-GTGTTTAGCTTAAAAATTAATTCTAACAACATACAA
-+HWI-EAS337_3:7:1:1685:1551/1
-WWWWWWWWWWWWWWWWWWWWWWVWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:280:1289/1
-GTTGAGATGATTGTCTCCTAAATCAACAACTTCGAG
-+HWI-EAS337_3:7:1:280:1289/1
-WWWWWWWWWWWWWWWWWWWWWWWVWVWWVVUUUUUR
-@HWI-EAS337_3:7:1:59:1986/1
-GCCTCTCCATAATAAAACTGCTCCCCCTCTTCCCGT
-+HWI-EAS337_3:7:1:59:1986/1
-WWWWWWWWWWWWWWWVWWWWWWWWWWWWWVUUUUSR
-@HWI-EAS337_3:7:1:211:1293/1
-GACATAAACATCAAGATCAAGCAATTAAAAGTTATA
-+HWI-EAS337_3:7:1:211:1293/1
-WWWWWVWVWWWWWWWWWWWWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1234:544/1
-GTTGTATGAACTGCTGAAAAAGTACAGATGATCAAA
-+HWI-EAS337_3:7:1:1234:544/1
-WWWWWWWVWWWWWWWWWWWWVVWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:567:1239/1
-GATAAGTCCCTTAAAACTTGTGGCTATATGAAGATA
-+HWI-EAS337_3:7:1:567:1239/1
-WWWWWWWWWWWWWWWWWWWVWVVWWVWTVQSURUUU
-@HWI-EAS337_3:7:1:142:428/1
-GGGTGACAAAGAAAACAAAAGGGACATGGTACTTGG
-+HWI-EAS337_3:7:1:142:428/1
-WWWWWWWWVWWWWWWWWWVWWVVWWWWWVWUUUUUR
-@HWI-EAS337_3:7:1:824:1417/1
-GTAGAAAGGTGTCAAAAAAGTATTAGAGTATGTTTA
-+HWI-EAS337_3:7:1:824:1417/1
-WWVWWWWWVVWWWWWWVWVWVWWWWVWVVWUUUUUU
-@HWI-EAS337_3:7:1:1760:476/1
-GTCTTTCCTTTATCCATTTAAACAAAAGCATCTGCA
-+HWI-EAS337_3:7:1:1760:476/1
-WVVWVVWWWSWWVWWVWWWVWWVWVWWVWVUUUTUS
-@HWI-EAS337_3:7:1:482:2006/1
-GATATTTTAAAGAGTAAGCCAGCCAATTTAAAAGCA
-+HWI-EAS337_3:7:1:482:2006/1
-WWWSWWWWWWWVWVWWWVWVWVWWWWWWWWUUUTUU
-@HWI-EAS337_3:7:1:322:1489/1
-GTAGGAGATAAGTTTTGGTGCTTCTAAATTTATAAA
-+HWI-EAS337_3:7:1:322:1489/1
-WWWWWWWWWWWVWWWWWWWVWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1000:1648/1
-GCCTACATCCATCTGCATAATAACATTGATTGGGCT
-+HWI-EAS337_3:7:1:1000:1648/1
-WWWWWWWWWWVWWWWWWWWWWWVWVWWVWWUSRSUU
-@HWI-EAS337_3:7:1:149:1554/1
-GCAATAAAGAAAATGGTTGTACATGAGAAGCAGACA
-+HWI-EAS337_3:7:1:149:1554/1
-WWWWWWWWWWWWWWWVWWVWWWWWVVVWWVUUUUUU
-@HWI-EAS337_3:7:1:386:2016/1
-GCTGAGTTTATCCCAGTTCTTGCTCTGCTGTTGAAT
-+HWI-EAS337_3:7:1:386:2016/1
-WWWWVWWWWWWWWWWVWWWWWVWWWWVVWTUURUSU
-@HWI-EAS337_3:7:1:982:788/1
-GTGTAGATGCATTTACAAAGCCAATAATGGTGCTTC
-+HWI-EAS337_3:7:1:982:788/1
-WWWWWWWWWWWWWWWWWWWVWWWVWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:62:1291/1
-GCATCTTCGTGTTTTTAATATGGTGTTTGCAGTTTT
-+HWI-EAS337_3:7:1:62:1291/1
-WWWWWWWWWWVWWWWWWWWWWQQWQWWWKVUQUUUC
-@HWI-EAS337_3:7:1:685:1968/1
-GAAGTAGAGGCTGAGAAAAAAGCTCTTGAGGAGGTT
-+HWI-EAS337_3:7:1:685:1968/1
-WWWWWWWWWWWWWWWVWWWWWWWWWWWVVVUUUUSU
-@HWI-EAS337_3:7:1:322:1885/1
-GAAGAATACTGGTCAATGTACAAAAACCACTTAGAC
-+HWI-EAS337_3:7:1:322:1885/1
-WVWWWWWWWWWWWWWWWWWWWWWWWWWQVWUUUUUU
-@HWI-EAS337_3:7:1:133:1184/1
-GAATTTACAGTTTGTCTATGGAAAGACAAACTGCAG
-+HWI-EAS337_3:7:1:133:1184/1
-WWWWWWWWWVWWWVWWWWWUWWWWVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1196:343/1
-GGATTGATTATATCTTGAAAGAGATATAGGAGATCG
-+HWI-EAS337_3:7:1:1196:343/1
-WWWWWWWWWWWWWWWWVVWWUWUVWWWWTTURUUSO
-@HWI-EAS337_3:7:1:152:1594/1
-GGCTCAACCTAAATTTAATTGGAGTTTCAATTCGGA
-+HWI-EAS337_3:7:1:152:1594/1
-WWWWWWWWWWWWWWWWWWWWVVVVWVWWWVUUUSQU
-@HWI-EAS337_3:7:1:1747:469/1
-GAGTGAAATGCATAGTATATATTGAACAAGTATGGC
-+HWI-EAS337_3:7:1:1747:469/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1496:565/1
-GAAGGTTATTTTTTTCCCGAAGTTCGGATAGAAGAT
-+HWI-EAS337_3:7:1:1496:565/1
-WWWWWWWWWWWWWWWWVWUVVUWWWVTVWVRUUUSU
-@HWI-EAS337_3:7:1:172:610/1
-GAATTTTGTACTTTAGCTTGTTTTTGACTGTTACCT
-+HWI-EAS337_3:7:1:172:610/1
-WWWWWWWWWWWWWWWVWWWVWWWVWQVWWKUUSUOU
-@HWI-EAS337_3:7:1:133:1995/1
-GAACTCAATCCAAGTTTGAACTAGAAGAACTCAACT
-+HWI-EAS337_3:7:1:133:1995/1
-WWWWWWVWWWWWWWVWWWVWWWWVWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:77:1015/1
-GTTAGACATAGGACAGCATTTTAATAAGTACTACAC
-+HWI-EAS337_3:7:1:77:1015/1
-WWWWWWWWWWVVWWWVWWWWWWWVWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:252:139/1
-GATTTTCCAGGGAATTAGTATGAAAACTTGAGGAAA
-+HWI-EAS337_3:7:1:252:139/1
-WVWWWWWWWVVWWWWWWWVWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:420:1157/1
-GAAATAAAAAAAATCTAAGAAATGAACAAGACAAAA
-+HWI-EAS337_3:7:1:420:1157/1
-WWWWWWWWWWWWWWWWWWWVWWWWWVWWVVUUUUUU
-@HWI-EAS337_3:7:1:94:1183/1
-GATTCTTGTCATTTCGAGAGGTGCTGATCACCCTGA
-+HWI-EAS337_3:7:1:94:1183/1
-WVVWWWVVWWWWWVWVWVWWWVVWWVVTVVUUUUUU
-@HWI-EAS337_3:7:1:1736:50/1
-GCGTGATTCACCATTGTACTCCTTCATGCAATCTTT
-+HWI-EAS337_3:7:1:1736:50/1
-VWWVWWWWWWWWWWWWVVVWWWWWVVWVVVRUUUUU
-@HWI-EAS337_3:7:1:710:409/1
-GATATGTCCCAGACTCCAAGTACCTCTTTATGTCGA
-+HWI-EAS337_3:7:1:710:409/1
-WWWWWWWWWWWWWWWWWWWWVWWWWWWWWWUUUUQU
-@HWI-EAS337_3:7:1:275:1719/1
-GTTGTTCTGGAAAACAAACTTCATGAGTTTGTGCAG
-+HWI-EAS337_3:7:1:275:1719/1
-WWWWWWWWVVWWWWWWWVWWWWWWVVTWWWQUSUUR
-@HWI-EAS337_3:7:1:1160:157/1
-GATAAATGCAACCGAAACAGTAAAAGATATGGGATG
-+HWI-EAS337_3:7:1:1160:157/1
-WWWWWWWWWWWWWWWWWWWWVWWVVVVVWWUSUUUU
-@HWI-EAS337_3:7:1:1769:294/1
-GACGATAAGCTGGCTGTCAAAATAGGACCAGGCCAC
-+HWI-EAS337_3:7:1:1769:294/1
-WWWWWWWWVWWWVWWVVVVWWVVVVVVVVVUUUUSU
-@HWI-EAS337_3:7:1:48:1374/1
-GTATCATAATATGTTGAAAGGGAAACTAAACTTAAA
-+HWI-EAS337_3:7:1:48:1374/1
-WWWWWWWWVWVWVWWWWWWVVUWWWWWVWWUUUUSU
-@HWI-EAS337_3:7:1:1129:654/1
-GATGGAAATTCTGGAAATATACAAGATAATGAAAAT
-+HWI-EAS337_3:7:1:1129:654/1
-VWVWWWVWWWWWWVWUWWWWWVVVWRWWVWUUUUUU
-@HWI-EAS337_3:7:1:264:195/1
-GTAAGGTTGTCAAATTTCCTTTAGTTCCTTTATGAC
-+HWI-EAS337_3:7:1:264:195/1
-WWWVWWWWVWWWWVWWWWWWWWVQWWVVWWUUUKUR
-@HWI-EAS337_3:7:1:328:1833/1
-GGATATATTATGTTTTTATTAAGGATCTATGAATGG
-+HWI-EAS337_3:7:1:328:1833/1
-WWWWWWWWWWWVWWWWWWWWWWUUWWWWVWUUUURR
-@HWI-EAS337_3:7:1:1739:1334/1
-GAGGGAAGGGAAAAGATAACAATCACGTTTGCGCCA
-+HWI-EAS337_3:7:1:1739:1334/1
-WWWWWVWWWWWWWWWWWWVWWVWWWVWFVWUUUUUR
-@HWI-EAS337_3:7:1:295:216/1
-GATGAAACCCCCAACCTACTGCAAGATATTTAACCA
-+HWI-EAS337_3:7:1:295:216/1
-WWWWWWWWWWWWWVWWWWWWWWWWWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:1746:1027/1
-GTTTTACATAAAAAAAAATAAAAATGGAAGAGATGT
-+HWI-EAS337_3:7:1:1746:1027/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:436:227/1
-GTTCTGAATGGTAACCACTCCTGGATGAAGCAACAC
-+HWI-EAS337_3:7:1:436:227/1
-WWWWWVWWWWRWWWWWWWWWVVRRKQQVCQSUSURU
-@HWI-EAS337_3:7:1:1400:859/1
-GATGACCATTACTTCCTCCGTGCTGCACATCCGTCA
-+HWI-EAS337_3:7:1:1400:859/1
-WWWWWWWWWWWWWWWWVWVVWVWWVVVVTWUUUSUU
-@HWI-EAS337_3:7:1:781:1122/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGTAA
-+HWI-EAS337_3:7:1:781:1122/1
-WWWWWWWWVWVWWVVWWUVVVVVVVWVRVVUJSFSM
-@HWI-EAS337_3:7:1:1103:1645/1
-GGACATCTTGGCTTGTAAGAGCATACAACGAGCCTT
-+HWI-EAS337_3:7:1:1103:1645/1
-WWWWWWWWWVWWWWVWVWVWVWWWWVWVWVUUUUUU
-@HWI-EAS337_3:7:1:1345:1228/1
-GTAACTTTATATCATGCTCATAAAATAAAAATATTA
-+HWI-EAS337_3:7:1:1345:1228/1
-WWWWWWWWWWWWWWWVWWWWWWWWVWWVVVUUUUUU
-@HWI-EAS337_3:7:1:419:1718/1
-GGTTTTGAATGTAGAGTTCTAAGATTGAGAAACTTT
-+HWI-EAS337_3:7:1:419:1718/1
-WWWWWWWWWWVWWVWWWWWWWVVWWWVWTWUUUUUU
-@HWI-EAS337_3:7:1:915:186/1
-GAATTCTGATGAAAGGTTAAGGCAAGGCCTGCTTAG
-+HWI-EAS337_3:7:1:915:186/1
-WWWWWWWVWWVWWWVVVWWWVVWWWVVVVWUUUUUR
-@HWI-EAS337_3:7:1:925:171/1
-GTCTAAATCATTCAGTTGCTGCTGTATTTAGGTTCA
-+HWI-EAS337_3:7:1:925:171/1
-VWWWWVWWWVWWWWVWWVWWUVWUWVWWWVQKUUSR
-@HWI-EAS337_3:7:1:982:156/1
-GCAATAAGCATATCATTAACATACAACAATATATAT
-+HWI-EAS337_3:7:1:982:156/1
-WWWWWWWVWWWWWWWWWWWWWWVVWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:814:658/1
-GCATGGACGTCTTTGATTGGATGGAGACAGATATAT
-+HWI-EAS337_3:7:1:814:658/1
-WWWWWWWWWWWWWWWWWWWVVWVVVVVVWVUUSUUU
-@HWI-EAS337_3:7:1:1178:1968/1
-GTTCTGCTTACTTTGTTTGCCTCCGAAATCCTGTTT
-+HWI-EAS337_3:7:1:1178:1968/1
-WWWWWWVWVVWWWWVWVWVWWWWVVTVVVVLURUUU
-@HWI-EAS337_3:7:1:618:1934/1
-GATCTTTTATGGATGCTGAATGAAGTAAATGGCTAA
-+HWI-EAS337_3:7:1:618:1934/1
-WWWWWWWWWWVWWWVVWVVWWUVVVVWVVVUUUUSU
-@HWI-EAS337_3:7:1:327:1212/1
-GAATACCTCTATTTGCACATTCACTAATCTCAACTG
-+HWI-EAS337_3:7:1:327:1212/1
-VWWWSVNVWVVWWWWWWWWVWVWWVVVVVWUPFUUL
-@HWI-EAS337_3:7:1:1049:785/1
-GAGTTGATCCGTGCCGGTTTCCGATAATTCATCAAA
-+HWI-EAS337_3:7:1:1049:785/1
-WWWWWWWWWWVWWWWWWVWWWWWWWWVWWVUUUUUR
-@HWI-EAS337_3:7:1:1676:1927/1
-GATATATTTTTATCATATTCTAGTGTGAAAATGCAT
-+HWI-EAS337_3:7:1:1676:1927/1
-VWVWWWVWWWWWWWWWWVWWWWVWVWTWVWUUUUUU
-@HWI-EAS337_3:7:1:120:1743/1
-GTTGTGGGAGATAAGCATAACTTGGATTGCTACTGT
-+HWI-EAS337_3:7:1:120:1743/1
-WWWWWWWVWVWWWWVWWWWWWWWWVWWWTWUUUUSU
-@HWI-EAS337_3:7:1:179:1071/1
-GACCGTATTACTAAGCTTGAATGTGGTATTGTTACA
-+HWI-EAS337_3:7:1:179:1071/1
-WWWWWWWWWWWWWWVWWWVWWWUWVTWWWWSUUUUR
-@HWI-EAS337_3:7:1:1298:890/1
-GAGGCTTGATTTTGTTCGTGGGTTTTGGGGTGGTTT
-+HWI-EAS337_3:7:1:1298:890/1
-WWWWWWWWWWWWWWWWWVWQVVVWWWTJTTSQSRUF
-@HWI-EAS337_3:7:1:971:850/1
-GTTCTTGTATTTTATTTTTGTTTTACTTGTTTTCCC
-+HWI-EAS337_3:7:1:971:850/1
-WWWWWWVWWWWWWVWWWWWQWWWWVVWWCWUUUSRO
-@HWI-EAS337_3:7:1:1054:1807/1
-GAACAATTTTTGTGTTAGAGAAGGTTGAGACAAGAT
-+HWI-EAS337_3:7:1:1054:1807/1
-WWWWWWWWWWWWWVWWWWWWWWWVUWVVWVUUUUMU
-@HWI-EAS337_3:7:1:236:307/1
-GATCATTATCCAACATCAAAATTATAGTCGGAATAA
-+HWI-EAS337_3:7:1:236:307/1
-VWWWWWWVWWWWVWWWWWVVWWWVWVTVWTSUUUUU
-@HWI-EAS337_3:7:1:808:1897/1
-GTTTTTGTTTTTATTTTCATTTATCATTACAAGGTC
-+HWI-EAS337_3:7:1:808:1897/1
-WWWWWWWWWWWWWWWWWVWWWWVWWVWWTVUUJOUU
-@HWI-EAS337_3:7:1:472:848/1
-GAAACTAAAATGAATCTGTGCCCATTGGAAGCGTTC
-+HWI-EAS337_3:7:1:472:848/1
-WWWWWWWWWWWWWWWVWWWVWWWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:1130:710/1
-GGGATAGGGAAAACATATAAGTAGGCGAAGCATCCA
-+HWI-EAS337_3:7:1:1130:710/1
-WWWWVWWVWWVWWVWWWWWWTWWVWVVVVVUUURUU
-@HWI-EAS337_3:7:1:647:833/1
-GTTGTGTTGCTGAAATTAAGTTGTCGTTGTGGTTTT
-+HWI-EAS337_3:7:1:647:833/1
-WWWWWVWWVWWWWWVWWWVWWWWWVTWVVTUKUUUU
-@HWI-EAS337_3:7:1:513:1877/1
-GGAGGTAGGCTTGGTGGTTCTGTAGATGTTTGAGTC
-+HWI-EAS337_3:7:1:513:1877/1
-WWWWWWWVWWWWVVWVVVWVWUWVUVWQVWUKRQUO
-@HWI-EAS337_3:7:1:1597:292/1
-GGATGATAAATAAATGACATAAAACATAGTAGAACA
-+HWI-EAS337_3:7:1:1597:292/1
-WWWWWWVWWWVWWVWVVWWWWWWWQWWTWWUUUUUU
-@HWI-EAS337_3:7:1:1724:332/1
-GGAAAACTCATCGGAGGAAGAACAAGAAAAGGAAGC
-+HWI-EAS337_3:7:1:1724:332/1
-WWWWWWWWWWWWWWWWWWWWVWWVVWVVWVUUSUUU
-@HWI-EAS337_3:7:1:398:1996/1
-GCAGGTAGTGTCTTAACCCATTACATGAGCATTCAC
-+HWI-EAS337_3:7:1:398:1996/1
-WWWWVWWWWWWWVWWWWVWWWTWWWVVVVVUUUUUU
-@HWI-EAS337_3:7:1:1761:668/1
-GTATTGTATTCAAAATGTGGAAATATAAACGATGGA
-+HWI-EAS337_3:7:1:1761:668/1
-WWWWWVWWWWWWWWWWVWWUWVWWWWWVWWSUUSSU
-@HWI-EAS337_3:7:1:1638:1888/1
-GTGGAGCGCCTGGAGTGGGAAAGACCACTTTGGCAA
-+HWI-EAS337_3:7:1:1638:1888/1
-WWWWWWWWWWWWWWWWWVWVWVVWVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:699:396/1
-GTTTACGCAAAATGTTAAGCATTGTAAGAACAACTA
-+HWI-EAS337_3:7:1:699:396/1
-VWWVWVWVWWVWWUWVWWVWWWVURVWVVWUUUUSU
-@HWI-EAS337_3:7:1:77:1603/1
-GATCGTATATTTCTATATTGCCAATCCAATTGGGAA
-+HWI-EAS337_3:7:1:77:1603/1
-WWWVWWVWWWWVTWWWWVVUWVWWWWVVVWUSSSUU
-@HWI-EAS337_3:7:1:1665:1289/1
-GAAAAATACTTCTGAATTGATGCAGTAATGAAATTG
-+HWI-EAS337_3:7:1:1665:1289/1
-WWWWWWWWWWWWWVWVWWVWWWVWWVWWWVUUUUUR
-@HWI-EAS337_3:7:1:1501:1538/1
-GGCATTGTCTAGTCTAACTCTTCGGACAGGAGGAAA
-+HWI-EAS337_3:7:1:1501:1538/1
-WWWWWWWWWWWWWWWWWWWWWWWVWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:672:841/1
-GACTGTTCAATCGAATATTTATCAAGTATCAGCGAC
-+HWI-EAS337_3:7:1:672:841/1
-WWWWWWWWWWWWVWWWWWWWVWWWVTWWWVURUUUU
-@HWI-EAS337_3:7:1:743:981/1
-GTTTCAGTTTGTTTTGAGTTGGCACGAAGTTTAAGA
-+HWI-EAS337_3:7:1:743:981/1
-WWWWWWVWWWWWWWWUWVWWVTWWWTVVVVUUOMJR
-@HWI-EAS337_3:7:1:1516:1190/1
-GTTTTGAAGCTTTCGCAGACTCTAGTTGTGCTACTT
-+HWI-EAS337_3:7:1:1516:1190/1
-WWWWWWWWWWWWWWVWVVVWVVWWVVWTVQUUUSUU
-@HWI-EAS337_3:7:1:1006:178/1
-GCATTTTATTTATTTAAGGAAGTATATATGTCTTCC
-+HWI-EAS337_3:7:1:1006:178/1
-WWWWWWWWWWWWWWWWWQVWVVWWWWWWWWUUUUUR
-@HWI-EAS337_3:7:1:1575:1485/1
-GGATTCCTTATTGGAAAAGTCCCTGTACGTTTTACC
-+HWI-EAS337_3:7:1:1575:1485/1
-WWWWVWWWWWWWVUVWWWVWWVVWVWWVVVUUUSUR
-@HWI-EAS337_3:7:1:998:1444/1
-GTGAGTTGTTATAGTTAGCTTTTCCCAGTAGATTCA
-+HWI-EAS337_3:7:1:998:1444/1
-WVWWWWWWWWWWWVWWWUVWWWWVVVTTVTSRUUUR
-@HWI-EAS337_3:7:1:228:1267/1
-GCCAGTATATGAACTTGCTAATTCAACAATGCATTT
-+HWI-EAS337_3:7:1:228:1267/1
-WVWWWWWWWWWWWWWWVWWWWWVWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:62:854/1
-GTTTCAAGATGTGGTGTGAACGGTGTACAACAAGTG
-+HWI-EAS337_3:7:1:62:854/1
-WWWWWWWVWVVVVVWVWVWVWVVWVVWVWWUUUUUR
-@HWI-EAS337_3:7:1:747:162/1
-GATTGTTTTGTTGCATAAGATGGTTGATACTCAATT
-+HWI-EAS337_3:7:1:747:162/1
-WWWWWWWWWVWWVWWWWWVWWVWVWVWVVVUUUSUU
-@HWI-EAS337_3:7:1:1531:49/1
-GAACAAGAAGAGATAACCCAGTACAACGAGGAGGAG
-+HWI-EAS337_3:7:1:1531:49/1
-WWWWWWWWWWWWWWWWWWWVWVWWVVWVWVUSUUSU
-@HWI-EAS337_3:7:1:1142:742/1
-GTAGTCCTGGATTTAGCATCATTAACCCTGAATCTG
-+HWI-EAS337_3:7:1:1142:742/1
-VVWWVVWWVWWWUWWVVVWTVWWVVSTWTWUOUUUU
-@HWI-EAS337_3:7:1:441:173/1
-GGTACCACGTTCTGGTATGCTAACTATTTGGGTTTG
-+HWI-EAS337_3:7:1:441:173/1
-WWWWWWWWWWWWWVVWWWVWWWVVWVWWWTQRUUUO
-@HWI-EAS337_3:7:1:1663:1977/1
-GTAGAGGAGGTAGGCTTGGTGGGTCTTTAGATGTTT
-+HWI-EAS337_3:7:1:1663:1977/1
-WWWWWWWWWWQWVWSVWVWSVWCVVWCQQVQSSKQU
-@HWI-EAS337_3:7:1:100:1822/1
-GGTAGTGTTCAAACACGTAACGTGCACCTAATCAAC
-+HWI-EAS337_3:7:1:100:1822/1
-WWVWWWWVWWWWWVWWWVWWVWFVWWVTWWUUUUSU
-@HWI-EAS337_3:7:1:1422:89/1
-GAGCTGAAATTGGTTAATGATTGAATATAAGAAGGG
-+HWI-EAS337_3:7:1:1422:89/1
-WWWWWWWWVWWWVVWWWWVWWWVWWWWWWWRUUUUU
-@HWI-EAS337_3:7:1:1402:1182/1
-GTGGGAAGTGAGAGATGACGAGTTCTCTGGACTAAG
-+HWI-EAS337_3:7:1:1402:1182/1
-WWWWWWWWNVWWVVWVVWSVWVVVVWQWVWUUUCUS
-@HWI-EAS337_3:7:1:1721:1861/1
-GGGGAACTCTACTTTTTAATTGGGGAATCTTGGGGG
-+HWI-EAS337_3:7:1:1721:1861/1
-WWWWWWWWVWWWWWWWWWWWWVVKVWWWVWUUUSSO
-@HWI-EAS337_3:7:1:1414:1647/1
-GAAGACTGTACCTTGATCCTAGCTTGAACTCTTGCT
-+HWI-EAS337_3:7:1:1414:1647/1
-WWWWWWWWWWWWWWVWWWWWVVWWWQTVVWUUUQSU
-@HWI-EAS337_3:7:1:1646:443/1
-GTAATTTGGAGTGAGTGCAACAAGAATTATTCCATA
-+HWI-EAS337_3:7:1:1646:443/1
-WVVWWVVWWVWTVWVKWVWVVWVVWWWTVWUSUUUU
-@HWI-EAS337_3:7:1:390:1926/1
-GCATATCAAGATGGAGTTATTCAAGCTATTTTACTT
-+HWI-EAS337_3:7:1:390:1926/1
-VWWWWWWWWVVWWWWWWWWWVWWWVWWVWVUUUUUU
-@HWI-EAS337_3:7:1:1097:515/1
-GGTTTTGTGTATCGCATGATGTAAGGAATTGAAAAT
-+HWI-EAS337_3:7:1:1097:515/1
-WWWWWWWWWWWWWWWVWVWWVWWVVWVWWWSSUUUU
-@HWI-EAS337_3:7:1:510:122/1
-GTAGGTGTGATCAAGGGAATCTGAAACTTCAAAAGT
-+HWI-EAS337_3:7:1:510:122/1
-WWWWWWVWVWWWWWVVVWWWWWVWVVVWWVUUUUUU
-@HWI-EAS337_3:7:1:558:1059/1
-GTGAGCATCATGAAATACGCTGTCTTCCCCAGATCA
-+HWI-EAS337_3:7:1:558:1059/1
-WWWWWWWWWWWVWWWWWWVWWVWWWWWWVVURUUUU
-@HWI-EAS337_3:7:1:1094:1611/1
-GAAAATTAAAAAAATAAAAAGTATGAGAAGCTTCCT
-+HWI-EAS337_3:7:1:1094:1611/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1569:1895/1
-GGCTTCAAGTAAAACCAAAAACATAACAGAACTACA
-+HWI-EAS337_3:7:1:1569:1895/1
-VWWVVNWSVWWVVVLWWWWWWWWWVQWWVVUUUUUU
-@HWI-EAS337_3:7:1:1546:508/1
-GTTCTTGTAGGTTACTGTAAACTCTAGCTCATGCCG
-+HWI-EAS337_3:7:1:1546:508/1
-WWWWWWWWWVVWWVWWVWWWWVWWWWQVWWUUSUUR
-@HWI-EAS337_3:7:1:578:19/1
-GATTTTCAAGAATACAAACCTATGCACTTAAAACTT
-+HWI-EAS337_3:7:1:578:19/1
-WVWWVSVVWVVSVWQRSWRQWWSVQQWQVVUUTUUS
-@HWI-EAS337_3:7:1:1765:1475/1
-GTTTGCACAATTATCTTCCATAATTAATCGTAAAGT
-+HWI-EAS337_3:7:1:1765:1475/1
-WWWWVWVWWWWWWWWWWWWWWWVWWWVWWVUUURQU
-@HWI-EAS337_3:7:1:142:375/1
-GACGAAGCGATTTAGTGACACCAACAAGATTTCCTC
-+HWI-EAS337_3:7:1:142:375/1
-VVSWVWVWWWVWWWWVWWVWWSWVVWWWVWUUUUUU
-@HWI-EAS337_3:7:1:19:377/1
-GCACAGCATAAAAAGGAGTACCCCCGGCACTATATG
-+HWI-EAS337_3:7:1:19:377/1
-WWWWWWWWWWWWWWWWVWWWWWWWWVWWVWUUUSUU
-@HWI-EAS337_3:7:1:1704:1803/1
-GAAATTTCTAGGAAAAAATGACAGTCAAATCAGCTC
-+HWI-EAS337_3:7:1:1704:1803/1
-WWWWVVWVWWVVVWWVWVWWWWWVVVWVVWUUUUUU
-@HWI-EAS337_3:7:1:939:502/1
-GAATCCAAGTCAAAAGGAAATTAATCACAAAAACCT
-+HWI-EAS337_3:7:1:939:502/1
-WWVWWWWWWVWWWWWVWWVWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1550:1220/1
-GCACTGGTATTGATATTCAAGGAGCATCTGCACATA
-+HWI-EAS337_3:7:1:1550:1220/1
-WWWWWWWWWWWWWWWWWWWWUVVVWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:728:137/1
-GTCTCGTATTACTTATCAGGAAAACAGAAGAGAATC
-+HWI-EAS337_3:7:1:728:137/1
-WWWWWWWWWWWWWWWWWWVVVWVWWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1236:867/1
-GAGCATCATGAAATACGCTGTCTTCCCCAGATCAAA
-+HWI-EAS337_3:7:1:1236:867/1
-WWWWWWWWWWWWVWWWWWWVWWWWVVWWVVUUUUUU
-@HWI-EAS337_3:7:1:235:512/1
-GTAAAATTGAATCCAGCCACCTTATTCTTTTAGGAA
-+HWI-EAS337_3:7:1:235:512/1
-WWWWWWWVWWWWVVWWWWWWWWWVVWWVWVUUSUUU
-@HWI-EAS337_3:7:1:288:302/1
-GTAAAAGGTAGTTTGATTACCTCTGTTACACATCTT
-+HWI-EAS337_3:7:1:288:302/1
-WWWWWWWWWWWWWWWWWWWWVWVWUWWVVVUUUUUU
-@HWI-EAS337_3:7:1:244:1956/1
-GATGTCGAGTCAGATGAGGAGGATATCCCTGCTAGG
-+HWI-EAS337_3:7:1:244:1956/1
-WWWWWWWWVWWVVWWWWWVWWWWWWWVWVVUUUUUR
-@HWI-EAS337_3:7:1:216:738/1
-GAAATGAAGAGGCCACAGAATACTGGAATGGATTCC
-+HWI-EAS337_3:7:1:216:738/1
-VWWWWWWWVWWWWWWWWWWVWWVVWWVWWWUUUUSU
-@HWI-EAS337_3:7:1:671:1366/1
-GGCTGCACTGTGAACTGAAAGTACTTTTATCTGTTA
-+HWI-EAS337_3:7:1:671:1366/1
-WWWWWWWWWWWWWWWWWVVWWVWWWWWWVWUURUUR
-@HWI-EAS337_3:7:1:1146:1718/1
-GGGTAAAGGGGAAGAATTTATCAATGAAATTGATAC
-+HWI-EAS337_3:7:1:1146:1718/1
-WWWNWWWWWWWWWWWWWWWWWWWVVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:166:1525/1
-GATGTCTTCCACTGGTCTGTAAGGGACAGGACCACC
-+HWI-EAS337_3:7:1:166:1525/1
-WWWWWWWWWWWQWWVWWWWWWWVVVVWWWVQUSUUO
-@HWI-EAS337_3:7:1:1268:1762/1
-GGGTTTCAATTATGAATATGCTATTGGTGTATATTG
-+HWI-EAS337_3:7:1:1268:1762/1
-WWWVWWWWWWWWWVWWWWWVWWWWWVVWVWUUUUUO
-@HWI-EAS337_3:7:1:1065:21/1
-GGTCCTCAACTTTTTAACATGGCAATAAATGATTTC
-+HWI-EAS337_3:7:1:1065:21/1
-WWVWWWWWWWWWWWWWWWWWVQWWWWWWWWRUUUUU
-@HWI-EAS337_3:7:1:888:212/1
-GATGCATGATTTCCGCGATGCATGATTCCGCGATGC
-+HWI-EAS337_3:7:1:888:212/1
-WWWWWWWWWWWWWWWWVVWWWVWVWWVVVTUUUUUU
-@HWI-EAS337_3:7:1:1039:293/1
-GTGGGTTAAGTTAGAATGTATCTATTATAGGTAGTC
-+HWI-EAS337_3:7:1:1039:293/1
-WWWWVWWWWWWWWVWWWVWWWWWWWWVWVQRUURUR
-@HWI-EAS337_3:7:1:1268:1517/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGGAA
-+HWI-EAS337_3:7:1:1268:1517/1
-WWWWWWWWWWVWWWVVWVWVWVTTVVPSUDRMUSMR
-@HWI-EAS337_3:7:1:473:832/1
-GTGCCTAAATTGTTTTGGACCTCAACAATGGTTCAC
-+HWI-EAS337_3:7:1:473:832/1
-VWWWWWWWWWWWWWWWUVWWVWWVVVVVWVUUUUSR
-@HWI-EAS337_3:7:1:107:784/1
-GGAGCTGCAAGTTCCCAAGAGGGAAGAGAATGTAAA
-+HWI-EAS337_3:7:1:107:784/1
-WWWWVWWVWVVVWUTWVWVCVVWVWVVWWQUURUUU
-@HWI-EAS337_3:7:1:1252:1474/1
-GTTTAGGTTAAGCTTTATCACATGTCAAGAAGTAAA
-+HWI-EAS337_3:7:1:1252:1474/1
-WWWWVWWWWWWVWWWWWWVVWVWVVVWVTVUUUUSU
-@HWI-EAS337_3:7:1:893:1515/1
-GCATTCAAAATGATATGAATCTAAAGGACAAGAAAA
-+HWI-EAS337_3:7:1:893:1515/1
-WWWWWWWWVWWWWWWWWWWWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:458:926/1
-GATTGAATAGAATAGATTTTATGATTTGAATCCTAT
-+HWI-EAS337_3:7:1:458:926/1
-WWWWWWWWWWWWWWWVWWWWWWVVWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:378:52/1
-GATGTCATGAACACGTTAAAGGAGAAAGGAAAGGAA
-+HWI-EAS337_3:7:1:378:52/1
-WWWWWWWWVWWWWWWWWWWWVWWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:91:1357/1
-GCTCTTCAGCCTACAGAAAAATTGGAAGGTATAAGC
-+HWI-EAS337_3:7:1:91:1357/1
-WWWWWWWWVWWWWWWVWVWWWWVWVWWWVWUSUURR
-@HWI-EAS337_3:7:1:447:1302/1
-GATGAATTTTGTTCTGAACATGGCATTTTATTTCCC
-+HWI-EAS337_3:7:1:447:1302/1
-WWWWWWWWWWWWWWWVWWWWWVVWVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:569:1521/1
-GTTACACCAAGAAGTAGGATGAGTATGTTTGTTAGA
-+HWI-EAS337_3:7:1:569:1521/1
-WWWWWWWWWWWWWWWWWWWWWVVWWWWWWWUUUUQR
-@HWI-EAS337_3:7:1:254:573/1
-GAATGCTGATAAGATCTTGGAGAAGACACCAAATCT
-+HWI-EAS337_3:7:1:254:573/1
-WWWWVWWWWWWWWWWWWVVVVWWWWVWWWOUUUUUU
-@HWI-EAS337_3:7:1:1644:1622/1
-GAGCCTACTAAAGGTGCAATTGCTGATAGCCTTTTT
-+HWI-EAS337_3:7:1:1644:1622/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1133:169/1
-GAGGGGACAAAACACGAAAAATCAATTTTGATGTAT
-+HWI-EAS337_3:7:1:1133:169/1
-WWWWWVWWWWWWWWWWWWWVWVWVWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:430:1339/1
-GGGAAAAGTTAGTTTTTGGGGCGCGATTGTGAAAGG
-+HWI-EAS337_3:7:1:430:1339/1
-WWWWWWWWWWWWWWWQWVVVVWWWVVWWVWUUUUUR
-@HWI-EAS337_3:7:1:997:1056/1
-GTAAGTTCACTTTTGGTGTCATTGATCTGGTAGTTT
-+HWI-EAS337_3:7:1:997:1056/1
-WWWWWWWWWWWWWWWUWVWWWWWUWWVWVJUURUUU
-@HWI-EAS337_3:7:1:380:1919/1
-GTTGATGAGTGTGTTGAAGATGGAACGAGGAGAACA
-+HWI-EAS337_3:7:1:380:1919/1
-VSVWVWVWVVVVVQSVVWQLQVLWWQVRSQUTUOOK
-@HWI-EAS337_3:7:1:63:1040/1
-GAGCGAGTGGAAAAGGGTAGAAATGGAAAGTGAAAA
-+HWI-EAS337_3:7:1:63:1040/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWWWWUUUUFU
-@HWI-EAS337_3:7:1:678:1528/1
-GATCGAAAATGAAATAACATAAGTGAATAAATCATG
-+HWI-EAS337_3:7:1:678:1528/1
-WWWWVWWWWWWWWWWWWWWWWWWWVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1660:1685/1
-GATGCATAAATTTCGACGAGACATGAAATCTTCTCA
-+HWI-EAS337_3:7:1:1660:1685/1
-WWWWQWWWWWWSWVVVWVWWVWWUVVWWVVUUUUUR
-@HWI-EAS337_3:7:1:1383:502/1
-GATGATGCATAGCACTTGATACAACCAATTTGTCAA
-+HWI-EAS337_3:7:1:1383:502/1
-WWWWWWWWWWWVWWWWWVVWWWWWVWWVWWUUUUUU
-@HWI-EAS337_3:7:1:363:1039/1
-GAATGCAACAGAATTCTCGAATAACAGGTTTCTAGC
-+HWI-EAS337_3:7:1:363:1039/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWVWUUUURU
-@HWI-EAS337_3:7:1:203:923/1
-GTGCTTACAAATTGGGGAAGAAGAAGAAGAAAGCTA
-+HWI-EAS337_3:7:1:203:923/1
-WWWWWWWWWWWWWVVWWWWWWWWWWWVWWWUUUUUU
-@HWI-EAS337_3:7:1:1181:1733/1
-GAATAGCCAAGGAGGATAAATTGGACCCTTCTTCGA
-+HWI-EAS337_3:7:1:1181:1733/1
-WWWWWWWWWWWWWWWUWWWWWWVWWWVVWWUUUUSU
-@HWI-EAS337_3:7:1:1710:1833/1
-GTGTACACTATAAAGCTACAAGGACTAATGATGAGG
-+HWI-EAS337_3:7:1:1710:1833/1
-WWWWWWWWWWWWVWWWWWWVVWVWWWWVWWUUUURU
-@HWI-EAS337_3:7:1:1649:1783/1
-GAAAAACACTTTATACTATAGTTATTATTATTATGT
-+HWI-EAS337_3:7:1:1649:1783/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWUUUUSU
-@HWI-EAS337_3:7:1:1453:1408/1
-GTTCTAAAGAATTTCAAAGGGAAGAGGACTCAAGTT
-+HWI-EAS337_3:7:1:1453:1408/1
-WWWWWWWWVWWWWWWWWVVVVWWVWWVVVWUUUUUU
-@HWI-EAS337_3:7:1:986:860/1
-GCATGTTATCGATGATAGGAAAATTTAGGCCGTCTT
-+HWI-EAS337_3:7:1:986:860/1
-WWWWWWWWWWWWWWWWWVVWWVWWWWWVTWSRUUUU
-@HWI-EAS337_3:7:1:1363:1485/1
-GTTTCTCCATTTTATTTGACATTTTGAGCTGTCGCC
-+HWI-EAS337_3:7:1:1363:1485/1
-WWWWWWWWWWWWWWWWWQWWWWWWWLWQVWSUUQSR
-@HWI-EAS337_3:7:1:66:418/1
-GCAGAGGAAGTATGACATTGTTGTTGGAGTGGCTCG
-+HWI-EAS337_3:7:1:66:418/1
-WWWWWWWWWVWWWWWWWWWVWWVVWVVVTVSSUUUM
-@HWI-EAS337_3:7:1:1758:61/1
-GATCTCTTGAAGATTCAATTGACAATGTTTACCATG
-+HWI-EAS337_3:7:1:1758:61/1
-WWWWWVVWWWVWWWVWVWWWVVWVVWWVWWUUUPUR
-@HWI-EAS337_3:7:1:478:1391/1
-GATGCATTATTCTTTTTGATCTTCTTTTGGACTTGT
-+HWI-EAS337_3:7:1:478:1391/1
-WWWWWWWWWWWWWWWWWVVWVWWWWWWWVQSUUUJU
-@HWI-EAS337_3:7:1:203:401/1
-GTGAGAGGGGCAGCAGTCAATGTTGGTATATGGATA
-+HWI-EAS337_3:7:1:203:401/1
-WWWWWWVWVWWWWWWWWWWVWVVWUVVVWVUSQUUR
-@HWI-EAS337_3:7:1:250:1477/1
-GAATGTCTTACCTTCAAAAGGATCTAAATCCCCAGG
-+HWI-EAS337_3:7:1:250:1477/1
-SWWWVVVWWWSWWWVVWWWVVVWWWVWVWVUKUUUU
-@HWI-EAS337_3:7:1:156:347/1
-GTGAAGAATCCACGAGCCATTGGGTGCGGGAATAGG
-+HWI-EAS337_3:7:1:156:347/1
-WWWWWWWWWWWWWWWWWWWWWVVVVVWVVVUUUUSU
-@HWI-EAS337_3:7:1:341:871/1
-GAAGTAAGCCTATAATGGATAGTCTTGAGGACCTCT
-+HWI-EAS337_3:7:1:341:871/1
-WWWWWWWWWWWWWWWWWWWWVVVVVVWVWQUSUUUU
-@HWI-EAS337_3:7:1:672:394/1
-GCTCTGATTATCTGAGCTGCATGCTCTATCTAAACT
-+HWI-EAS337_3:7:1:672:394/1
-WWWWWVWWVWWWWVVWWVWWVVVWWVVVWVUUUUUU
-@HWI-EAS337_3:7:1:216:1788/1
-GTATTATTGAGCCACTTTACAGATACCACCAAAGGC
-+HWI-EAS337_3:7:1:216:1788/1
-WWWWVVVWWWVWVWWVWWWWWWWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:241:1250/1
-GAGATCAATATTCCTTTTGATCAAATTTTCATGTGT
-+HWI-EAS337_3:7:1:241:1250/1
-WVWWWWWWWWWWWWWWWWUWWVWVVVWVVWUUSUQU
-@HWI-EAS337_3:7:1:853:507/1
-GAGATCAAGTTGAGGTGTCTAGATGTGCACTCTCAA
-+HWI-EAS337_3:7:1:853:507/1
-WWWWWWWWWWWWWVVVVWWWWVWWVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:546:624/1
-GAACGGAAATCACTCAGCTTCAGTACGCTGATGACA
-+HWI-EAS337_3:7:1:546:624/1
-WWWWWWWWWWWWWWWWWWWWVWWWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:219:1037/1
-GTTTTCCGCGATAAAATATGGTGCTATTATTTTATT
-+HWI-EAS337_3:7:1:219:1037/1
-WWWWWSWVWWWVWVWWWWWVWWSWWVWWVWUUUUUU
-@HWI-EAS337_3:7:1:1208:471/1
-GGAAGGTGAATAGGTAACTATGTATTCTTGAATGTA
-+HWI-EAS337_3:7:1:1208:471/1
-WWWWWWWWWWWWWVWWWWWWWWWWWWWWWTUUUSUU
-@HWI-EAS337_3:7:1:372:160/1
-GTTGACTTATTGCTCCCAAAATTCAGGGAAAAAATC
-+HWI-EAS337_3:7:1:372:160/1
-WWWWWWWWWWWVWWWWWWVWWWWVWVWVVWUUUUUR
-@HWI-EAS337_3:7:1:108:1588/1
-GTTCTCCTTGTAGCAGTAGCAACAATTATGTCAGTA
-+HWI-EAS337_3:7:1:108:1588/1
-WSWWWVVWWVWWVVWVWWVWWWVVWVWWWSUUUSUS
-@HWI-EAS337_3:7:1:143:200/1
-GAAAGATCTCCATAAAGCCATAAAGCTTTGTGAGGC
-+HWI-EAS337_3:7:1:143:200/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWVVUUUSUU
-@HWI-EAS337_3:7:1:835:398/1
-GATAATTGGTAGCTCTTTTTGATTTTCTGAAAATGT
-+HWI-EAS337_3:7:1:835:398/1
-WWWWWWWVVWWVWWWWWWWWTWWWWWVWVTUUUURU
-@HWI-EAS337_3:7:1:102:1436/1
-GCCTTTTTAATGTTAACACCTTACTTCAATAAAAGA
-+HWI-EAS337_3:7:1:102:1436/1
-WWWWWWWWWWWVWWWWWWWWWWVWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:400:112/1
-GGTTGTTGAAGTTGGCCTTGACATCGTTTATATGGT
-+HWI-EAS337_3:7:1:400:112/1
-WWVWWWWVWWVWWVVWWWWVVWWWWVWWWWUUUQIR
-@HWI-EAS337_3:7:1:782:767/1
-GCACGTAAAGTGGATTTGCATTGGCTGCTTGAGGAC
-+HWI-EAS337_3:7:1:782:767/1
-WWWWWWWWWWVVWWWWWWVWWWVWVWWOVWRROCSS
-@HWI-EAS337_3:7:1:572:1487/1
-GGTGTTGAGGCTGTTTCCTTCTTTTAAGTCTCTAAT
-+HWI-EAS337_3:7:1:572:1487/1
-WWVWNWVVVVVWVVVWCWVSPQWWHJVLHDUFUISU
-@HWI-EAS337_3:7:1:1236:1461/1
-GCAACTCTTCTTCTTCTTCTTCTATTCCAAGTCTCA
-+HWI-EAS337_3:7:1:1236:1461/1
-WWVWWWWWWWWWWWWWWWWWWWWVWWWWWVRUUUUR
-@HWI-EAS337_3:7:1:1023:1596/1
-GTAGTCAACTGTATGTTCATTTCCTCGTGACTGTGA
-+HWI-EAS337_3:7:1:1023:1596/1
-WWWWWWWWWWVWWWVWVWWVWWVVVVQVTVUUQUQR
-@HWI-EAS337_3:7:1:1428:79/1
-GGTTTGCCATCACGGGTTTTCTGGGCCGTTTGGAAG
-+HWI-EAS337_3:7:1:1428:79/1
-WWVWWWWWWWWWWVVVVWWWVVQOVVTVVVURRMRR
-@HWI-EAS337_3:7:1:29:1806/1
-GGTACATTTAACCTCTCTTTAATTTAAAGACCACAG
-+HWI-EAS337_3:7:1:29:1806/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWTWUUUUUU
-@HWI-EAS337_3:7:1:399:1920/1
-GAAAAACAATGTGTGTGCTACTTTGGCTTATTTGGT
-+HWI-EAS337_3:7:1:399:1920/1
-WWWWWWWWWWWWWWVWVWWWWWWWWTWWWVUUUSSU
-@HWI-EAS337_3:7:1:1367:1729/1
-GATGATTAACTTGGCTCTGTTGCTTCACAATTTCTT
-+HWI-EAS337_3:7:1:1367:1729/1
-WWWWWWWWWWWWVVWWWWUWWVWWWVVVVWUUUSUF
-@HWI-EAS337_3:7:1:214:335/1
-GCTTATTGGAGGAGATTCTTCTAATTGTGGTGACAG
-+HWI-EAS337_3:7:1:214:335/1
-WWWWWWWVVWVVWVWWWWWWWWVWWWQWQQUSUSUO
-@HWI-EAS337_3:7:1:1364:1733/1
-GAAAGGTCCTAATCACAGCAAAATTGACTCCGGCGA
-+HWI-EAS337_3:7:1:1364:1733/1
-WWWWWWLWWWWWWSVWWWWWWWWVWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:259:1207/1
-GGACTCGGGTCCTAGTTAGCGGGAATAATTCAAGAA
-+HWI-EAS337_3:7:1:259:1207/1
-WWWWWWWWWWWWWWVWWVVVVVVVVWVVWWUUUSUU
-@HWI-EAS337_3:7:1:15:1065/1
-GGGTTTAGGGTTTAGGGTTTAGGGTTTAGGGTTTAG
-+HWI-EAS337_3:7:1:15:1065/1
-WWVWWWVVWWWWVWVWWVWWWVUVWVWVTVQSUUUU
-@HWI-EAS337_3:7:1:651:1154/1
-GGTTCTAGAATATGATGCTATAAAGAAATGGGAAGG
-+HWI-EAS337_3:7:1:651:1154/1
-WWWWWWWWWWWVWWVWWWWVWVVVWVVWVWUUUUUU
-@HWI-EAS337_3:7:1:412:1548/1
-GATAAACTGTCCTTGTTCAGCTCCCTCTGGATGAAG
-+HWI-EAS337_3:7:1:412:1548/1
-WWWWWWWWWWWWWWVWWWWUWWWVVWWWTVUUSUUO
-@HWI-EAS337_3:7:1:565:893/1
-GACTCCACTCTTCAAAACAGCAGCCAACAAACTGCT
-+HWI-EAS337_3:7:1:565:893/1
-WWWWWWWWWWWWWWVWWWWWWWVVWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:1086:894/1
-GTGAAGCAGAAGATCTGCAATAACTCTTAAATTTGT
-+HWI-EAS337_3:7:1:1086:894/1
-WWWWWWWVWVVWWWWWWVVSVVVVWVVVVVUUUUSU
-@HWI-EAS337_3:7:1:904:892/1
-GGAACTTCAGATTTTTAAACGACCTCTTTCTTCACA
-+HWI-EAS337_3:7:1:904:892/1
-WWWWWWWWVWWWWWWWWWWWVWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1201:1415/1
-GAGTTGGCAAAGTAGGAAGATCTCTTGAAGATTCAA
-+HWI-EAS337_3:7:1:1201:1415/1
-WWWWWWWWWWVWWWWWWVWVWWWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:157:1509/1
-GAATTAAGAAACGATTTCACTGAAGAACATAGAACT
-+HWI-EAS337_3:7:1:157:1509/1
-VVWWWVWVSWVVVVSVQHWQWWWQVVVQWWUUUUOS
-@HWI-EAS337_3:7:1:1150:1510/1
-GGGAGATGAAACCATCCTTATTATATCATTAGTCGG
-+HWI-EAS337_3:7:1:1150:1510/1
-WWWVWWWWWWWWVVWVWVWWVWVWWWWWWVURUSUR
-@HWI-EAS337_3:7:1:757:1140/1
-GAAAAAACTGAACTGATAAATGCCTACGAAAGATGT
-+HWI-EAS337_3:7:1:757:1140/1
-WWWWWWWWWWVWWWWWWWWWVWWWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:397:1260/1
-GCTTTCTTACTATAGTTAATCTGCAATCCTTGGCCA
-+HWI-EAS337_3:7:1:397:1260/1
-WWWWWWVWWWWWWWWVWWWWWWWWWVVVVVURSUUU
-@HWI-EAS337_3:7:1:370:525/1
-GTATAGGGTTTGAGCTAAAGTTGTTGACTTTAATTG
-+HWI-EAS337_3:7:1:370:525/1
-WWWWWWWWWWWWWWWWWWWVWWVWWVWVWWUUUUUP
-@HWI-EAS337_3:7:1:782:729/1
-GACTCTATCCGAAGGTGTTTTTTTGATGGATTAACC
-+HWI-EAS337_3:7:1:782:729/1
-WWWWWWWWWWWWWWWVWWWWWWWWUVWQQVUUUSUR
-@HWI-EAS337_3:7:1:1602:38/1
-GATGAGTCTGTCCTGTACAAGGACAGAGAGCAGAAG
-+HWI-EAS337_3:7:1:1602:38/1
-WWWWWWWWWWVVWWUVVVVVVVVVRVVVUWUSURUU
-@HWI-EAS337_3:7:1:204:1509/1
-GAGAGCAAGGATTCACAGGGTTAAGTGTGACAAAGT
-+HWI-EAS337_3:7:1:204:1509/1
-WWVWWWWWWWWWWWWWVWWWWWWVVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1525:1263/1
-GGGTAAGAAGCATGTCACATCTATAAATATGAGGCT
-+HWI-EAS337_3:7:1:1525:1263/1
-WWWWWWWWWWWWWWWWWWWWWWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:895:1075/1
-GGCTAGCAAAAAAACGAAATTGAGCAGAAATGTCTA
-+HWI-EAS337_3:7:1:895:1075/1
-WWWWWWWWWVWWWWWVWWWWWWWVWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1204:1920/1
-GTTTTTCCCCTGGAATAAAAGAAGGGGAGACAGCCA
-+HWI-EAS337_3:7:1:1204:1920/1
-WWWWWWWWWWWVVWWWWWWWVWWWWVVVVVUUUUUU
-@HWI-EAS337_3:7:1:115:342/1
-GAATAACCTCCATAGTAGGCTTGAGAAATTGCTTTA
-+HWI-EAS337_3:7:1:115:342/1
-WWWWWWWWVWVWWWWVVWWVWWWVWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:163:1913/1
-GATTGTTACACAAAACTTGAGACTTTTTTGTCATTA
-+HWI-EAS337_3:7:1:163:1913/1
-WWWWWWWWWWWWWWVWWWVWVVWWWWWWWQUUUUUU
-@HWI-EAS337_3:7:1:1029:1475/1
-GGGGTTGTAGGTTCTCGTTTTTCCAACTTAAAACTT
-+HWI-EAS337_3:7:1:1029:1475/1
-WWWWWWWWWWWWWWWWVWWWWWVVWVVWWVUUUUUU
-@HWI-EAS337_3:7:1:482:1356/1
-GATATCATATGAGGGAATTTCTCATCCTGTCAAGGA
-+HWI-EAS337_3:7:1:482:1356/1
-WWWWWWSWWWVWVVWVWWWWWWWWWWVWVWUUOSUS
-@HWI-EAS337_3:7:1:1427:1488/1
-GATGCATCGTCTCCATTTGAGACCAAATCCCATCTT
-+HWI-EAS337_3:7:1:1427:1488/1
-VWWWWWWWWWWWWWWVVWTVVWVVVVVVVVUUJUUU
-@HWI-EAS337_3:7:1:544:1218/1
-GTGTTGTGTTTTTACGATGTGGGTGTTATCTTGGGA
-+HWI-EAS337_3:7:1:544:1218/1
-WWWWWWWVWWWWWWWVVWQWVTVVTVWVWUOOKSJO
-@HWI-EAS337_3:7:1:426:274/1
-GTTCAGCCCACTGTTTAGAATGAGTCCAACAGAGAA
-+HWI-EAS337_3:7:1:426:274/1
-WWWWWWWWWWWWWWWWWWWVWVWVWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1490:1770/1
-GTAGGGGGAGGCGTAAAACAACACAAGTAGGATACA
-+HWI-EAS337_3:7:1:1490:1770/1
-WWRWVWVVVWWRWVVVWVVVVVVVVVWFVVUUUSUU
-@HWI-EAS337_3:7:1:1722:324/1
-GAAAGAACAACTTCACTACAAAGCCCATAATATTGG
-+HWI-EAS337_3:7:1:1722:324/1
-WVWWWWWVWSVWWWWWWWWVVVVVWWVWVVUUSUUQ
-@HWI-EAS337_3:7:1:1650:360/1
-GATAAAAAATGCCCTGCCGTTATTCTAAGGTTAATC
-+HWI-EAS337_3:7:1:1650:360/1
-WWWWWWVWWWWWWWVWWVWVWVWWVWVVTQUUUUUU
-@HWI-EAS337_3:7:1:913:1975/1
-GCGAGAGAGAAGGATGAAAGAGGCAAGAGAGAATAT
-+HWI-EAS337_3:7:1:913:1975/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:237:1206/1
-GGAAATTAAAGGATTAAAATACAGAATCATTGCCAC
-+HWI-EAS337_3:7:1:237:1206/1
-WWVWWWWWWWWVWWWWWVVWWVWVVVWVVVUUURUU
-@HWI-EAS337_3:7:1:190:823/1
-GTTCGATTTTATCATAATATTTACGGAATTTATTAA
-+HWI-EAS337_3:7:1:190:823/1
-WWWWWWWWWWWVWWWWVWWWWWWWVTWVWWUUUUUU
-@HWI-EAS337_3:7:1:1529:451/1
-GGATTTCTAGCCACCCATGTTCCATATCTCCTGGAA
-+HWI-EAS337_3:7:1:1529:451/1
-WWWWWWWWWVWWWWWWVWWWWWWVWVWWWWUUSRUU
-@HWI-EAS337_3:7:1:128:11/1
-GAGTGGGAAGTGAGAGATGACGAGTTCTCTGGACTC
-+HWI-EAS337_3:7:1:128:11/1
-WWWVWWWWVVWVWWWWWWWVWWWWVWVVVWUUUSUU
-@HWI-EAS337_3:7:1:1240:732/1
-GGAATCAATCTTTGGAGGACTTCCAAAAGCCACTGC
-+HWI-EAS337_3:7:1:1240:732/1
-WWWWWWWWWWWWWVWWVWWWWVWVVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:407:1786/1
-GATGCTATTTCCCTTTTCGGTGCTAACCGTATCTGG
-+HWI-EAS337_3:7:1:407:1786/1
-WWWWWWVWWWWWWWWWWWVUJQWWVWWWVWSUUURR
-@HWI-EAS337_3:7:1:1211:1877/1
-GTTTGCCAGATTCATCTTCAGGAAGAATCATGTTTG
-+HWI-EAS337_3:7:1:1211:1877/1
-WWWWWWWWWWWWWWWWWWWWTVVWVVWVVVUUUUUU
-@HWI-EAS337_3:7:1:1227:351/1
-GTGATGATCATGGCCTTGTCGGTAACTACTTTAATT
-+HWI-EAS337_3:7:1:1227:351/1
-WWWWWWWWWWWVVWWWWVWWVUWVVVWVVWUUSSUU
-@HWI-EAS337_3:7:1:533:1854/1
-GCAAGAATAGAAGTTTTTTACCAGAAGGAATGGATT
-+HWI-EAS337_3:7:1:533:1854/1
-WWWWWWWWWWWWVWWWWWWWWWWUWVVVWVUUUUUU
-@HWI-EAS337_3:7:1:1065:1895/1
-GAGCATTAGAGGGTCTGAAGTCTGTTGATATGGGTC
-+HWI-EAS337_3:7:1:1065:1895/1
-WWVWWWWWWWWWWWWWWWVWWVWVWWVVWWUURUUR
-@HWI-EAS337_3:7:1:1064:1838/1
-GGAAGGATGATCTGGGAAAATTTGATCCCAGAAGTG
-+HWI-EAS337_3:7:1:1064:1838/1
-WVWWVWSVVWWVWVVWVSVVWWWWKWVVVWTHUSKU
-@HWI-EAS337_3:7:1:631:2004/1
-GCATGAACAGAATGAGTGATATCTAAAGGGGAAACG
-+HWI-EAS337_3:7:1:631:2004/1
-WWWWWWWWWWWWWWVWWWVWWWWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:122:431/1
-GTATAGATGTCCTGAGGTTATCCTAGGATCTAAATA
-+HWI-EAS337_3:7:1:122:431/1
-WWWWWWWWWWWWWVWWWWWWWWWWWVVVWWUUUUUU
-@HWI-EAS337_3:7:1:1291:716/1
-GATCCTGGGAATGGACGTCTCTCATGGATCTCGTGT
-+HWI-EAS337_3:7:1:1291:716/1
-WVWVWVVWWWVWWWVWWVVWTVVFWVVVVSUSURUU
-@HWI-EAS337_3:7:1:1134:827/1
-GAGCGAGTGGAAAAGGGTAGAAATGGAAAGTGAAAA
-+HWI-EAS337_3:7:1:1134:827/1
-WWWWWWWWWWWWWWWWWVWWWWWWWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:654:1081/1
-GAACTTCGCCAATGATCCCATTTTAGATGAAAGGCT
-+HWI-EAS337_3:7:1:654:1081/1
-WWWWWWWWWWWWWWWWWWWWWWWWVVWWVWUURRUU
-@HWI-EAS337_3:7:1:1509:490/1
-GGAAGAAGATCAAAATCAGTGGCAAGAAAAGCATTA
-+HWI-EAS337_3:7:1:1509:490/1
-VWWVWWVWVVWWWVVWWVWVWWWWWVVWWWUUUUUU
-@HWI-EAS337_3:7:1:1498:311/1
-GGTTTTTGCTCATGATGAACACTACTTTCAGATTTA
-+HWI-EAS337_3:7:1:1498:311/1
-WWWWWWWVWWWWWVWWWWWWWWWWVWWWVVSUUUUU
-@HWI-EAS337_3:7:1:618:1323/1
-GAAATTTTATAGATATGTAGACATGTGAGTCTCAAA
-+HWI-EAS337_3:7:1:618:1323/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:30:200/1
-GACTGGTCCTTCTGTTACATTCTGTTCATGTTCTTT
-+HWI-EAS337_3:7:1:30:200/1
-WWWWWWPWVWWWVVWWSVVWWVWSVWHVVKUUSUUU
-@HWI-EAS337_3:7:1:789:649/1
-GAAGGCTATCAAACTTCTTTCAGTGGGTTGTCAAAA
-+HWI-EAS337_3:7:1:789:649/1
-WWWWVWWWVWWVWWWWWWVWVVVVWVTVWVUSSUSU
-@HWI-EAS337_3:7:1:554:1108/1
-GAATAAACAAGTTCGAGGGGTGGGGGGTGGGGGTAA
-+HWI-EAS337_3:7:1:554:1108/1
-WWWWWWWWWVWVWWWVWWVWVWWVWVVVVVUUUUUS
-@HWI-EAS337_3:7:1:1468:510/1
-GTAAATCACGCTAAAGGCCTCCCTTTAGCCCTCAAG
-+HWI-EAS337_3:7:1:1468:510/1
-WWWWWWWWSWWWWWVVWWVWWWVWWVWVVVUUURRQ
-@HWI-EAS337_3:7:1:380:1429/1
-GAGTTGATTTGCCATTTGGTTAAGCAATCTTGACTT
-+HWI-EAS337_3:7:1:380:1429/1
-WWWWWWWWWWWWWWWWWVVVWWWVWWWWWWURUSUU
-@HWI-EAS337_3:7:1:380:265/1
-GGAAGTATGGTAGATGATATATTGAGCTGTGAGGCC
-+HWI-EAS337_3:7:1:380:265/1
-WWWWVVWVVWVVVTWVWVWVVWWUVVWWTVRUQSRU
-@HWI-EAS337_3:7:1:248:199/1
-GGATGGGCACCTCAATTGGCCATTTTATCTCACAAA
-+HWI-EAS337_3:7:1:248:199/1
-WWWWWWWWWWWVWVWWWVVWWVWWWWVWVVUUUUUM
-@HWI-EAS337_3:7:1:933:858/1
-GAGATTTAAAGCCAATAGGGGGAAAAGCTAACTCAG
-+HWI-EAS337_3:7:1:933:858/1
-WWWVWWWWWWVWWWWWWVWVWWVWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:622:626/1
-GGAAATAGTATTTTGTAGCTAGAGAATCTGGTAGCT
-+HWI-EAS337_3:7:1:622:626/1
-WWWWWVWWWVWWWWWWWUWWWUWVVWWWWTSUURUU
-@HWI-EAS337_3:7:1:167:360/1
-GCTTGTGTTTGTGGGATTTTACTGGATAGGTTGTTT
-+HWI-EAS337_3:7:1:167:360/1
-WWWWWWVWWWVWUVUWWWWWWVWQQVWVKQUUQSUO
-@HWI-EAS337_3:7:1:1725:338/1
-GTGGGGGATAGATGGGTCAAAATGGCATGTTTGGAG
-+HWI-EAS337_3:7:1:1725:338/1
-WWWWWWWWWWWWWWWWVWWWVTWWVWVWVVUUUUUU
-@HWI-EAS337_3:7:1:1708:1999/1
-GATGTAAATAGATTGGAAAAGTGGAAGTAGTCTCTG
-+HWI-EAS337_3:7:1:1708:1999/1
-WVWWWWWWVWVWWWVWWWVVVOVWVSVVVVUUUUUO
-@HWI-EAS337_3:7:1:413:1076/1
-GGGGATAGGGAAAACATATAAGTAGGCGAAGCATCC
-+HWI-EAS337_3:7:1:413:1076/1
-WWWWWWWWWWWWWWWWWWWWVWWVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:902:1018/1
-GAGTTAATGAAGCTGGAGGGATGTGATTGCACGTGA
-+HWI-EAS337_3:7:1:902:1018/1
-WWWWWWWWWWWWWWVWWWWWWWWVWVWWWWUSSUUU
-@HWI-EAS337_3:7:1:1165:1995/1
-GGAGCCCTAGTGTTATTCAATGGAGGTTGATGTTTG
-+HWI-EAS337_3:7:1:1165:1995/1
-WWWWWWWWWWWWWWWWWWVWWVWVVVTWVLURUUUC
-@HWI-EAS337_3:7:1:66:980/1
-GGTGTTGAGGCTGTTTCCTTCTTTCAAGGCTTTTAT
-+HWI-EAS337_3:7:1:66:980/1
-WWVWWWVWVVWWVUVWQVTUCVWWTLTIVIUCUCRU
-@HWI-EAS337_3:7:1:1459:14/1
-GTTTATTTGGACTTATTTTATTACAACAATCCATTC
-+HWI-EAS337_3:7:1:1459:14/1
-WNWWWWVWVVVWVVWWWWWWWWFQVWVVVWUUPUUQ
-@HWI-EAS337_3:7:1:1747:574/1
-GTAATATCAGTGCCCTCCAAGTTCTGGATATGCACC
-+HWI-EAS337_3:7:1:1747:574/1
-WWWWWWWWWVVWWWWWWWWVWWWWWVVVWWUSUUUR
-@HWI-EAS337_3:7:1:515:1074/1
-GCTATCACTTTGAAAAGGAAAAATGATAATGATGGC
-+HWI-EAS337_3:7:1:515:1074/1
-WVVVWWWWSVVVWWWWVVVVVWVQVWWVVWUUUUQP
-@HWI-EAS337_3:7:1:591:892/1
-GTACCTTCACGAGGCATCAATCTACAGTCTCTATGT
-+HWI-EAS337_3:7:1:591:892/1
-WWWWWWWWWWVVWWWVWWWWWWWVWVVVWWUUUURU
-@HWI-EAS337_3:7:1:1322:1717/1
-GCTAAAAAAAAACTGATTTAAATAGGCTGAAACTTG
-+HWI-EAS337_3:7:1:1322:1717/1
-WWWWWWWWWWWWWWWWWWWWWWWVVVWWVVUUUUUR
-@HWI-EAS337_3:7:1:868:1320/1
-GGACTGGGACTGGATACAGACTGGGATAAGTTGCAC
-+HWI-EAS337_3:7:1:868:1320/1
-WWWWWWWWWWWWWWWWWVWVWWVWWQWVWWUUSSSU
-@HWI-EAS337_3:7:1:1148:364/1
-GCTGACAAGCTATCTTACTTACTTTCCTTATTCATC
-+HWI-EAS337_3:7:1:1148:364/1
-WWWWWWWWWWWVWWWWVWWWWWWWWVVWWVUUUUUU
-@HWI-EAS337_3:7:1:1095:1361/1
-GTTTCTCTCTGATTTCCACTGTTTCAGATTAAGCCT
-+HWI-EAS337_3:7:1:1095:1361/1
-WWWWWWWWWWVVWWWWWVWWVWWWWWQVWWUURUUU
-@HWI-EAS337_3:7:1:370:1264/1
-GGATTGTGATACTTTTAGAACCTAAATTATTTCCTA
-+HWI-EAS337_3:7:1:370:1264/1
-WPWQWVVVWVSWSVQSWSSWQHVWVVHVSWUULLCU
-@HWI-EAS337_3:7:1:193:1427/1
-GCTTTTTGAGGGCTCCACTTTACTATTCGGCCATTT
-+HWI-EAS337_3:7:1:193:1427/1
-WWWWWWWVWWVVWWWVWWVWWWVWVWVWVTPURUUU
-@HWI-EAS337_3:7:1:1040:143/1
-GTGAGTAGCGTGCTCTAGTACGCTTACATATAGCAT
-+HWI-EAS337_3:7:1:1040:143/1
-WWVWWWWWWVWVWWWWWVWWVWVWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:876:2005/1
-GGTATAGAAAGTTCTGCTTCAGGTTCATCTTTGTAA
-+HWI-EAS337_3:7:1:876:2005/1
-WWWWWVWWWWWWWWWVWWWWWVVVVVVWTWUURURR
-@HWI-EAS337_3:7:1:79:1868/1
-GTTTCGAAAATCAAAGATGCGCTTACATCCTAACAT
-+HWI-EAS337_3:7:1:79:1868/1
-WWWWWWWWWWWWWVWWWWWWWWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:826:1495/1
-GGACAGTTTAGTGGAGACAATATTAGACTTGGATCT
-+HWI-EAS337_3:7:1:826:1495/1
-WWWWWWWWWWVWVWWWWWVWWWWWVVVVWWSUUUSU
-@HWI-EAS337_3:7:1:1015:1652/1
-GTTGTAACATGCACTTAGATATCATATAATCCTTTT
-+HWI-EAS337_3:7:1:1015:1652/1
-WWWWWWWWWWWWWWWVWVWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:17:1424/1
-GCACATCCATATTGAATTACATTAAATGAACATTTA
-+HWI-EAS337_3:7:1:17:1424/1
-WWWWWWWWWWWWWVWWWWWWWWVWWVWVWVUUUUUU
-@HWI-EAS337_3:7:1:215:891/1
-GATGGAAGTCCTCGAGAACAAGAGGCTGATGAAGAA
-+HWI-EAS337_3:7:1:215:891/1
-WWWWWWWVWWWWWVVVWVWWVVVVVWWWVWSUUSUU
-@HWI-EAS337_3:7:1:1625:1231/1
-GAAGAAGAAAGTCAAATTACAGTCTGAGAAGATAAA
-+HWI-EAS337_3:7:1:1625:1231/1
-WWWWWWWWWWVWWWWWWWWWWVWWWVVTVVSUUUUU
-@HWI-EAS337_3:7:1:1357:1422/1
-GGGTTTTGTGACACAAAAGTATTTTAATATAGATAA
-+HWI-EAS337_3:7:1:1357:1422/1
-WWWWWWWWWVWWWWWWWWWVWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:63:745/1
-GGGTTAGATAGACCAGAGAATACATAGAGCTCGCTC
-+HWI-EAS337_3:7:1:63:745/1
-WWWWWWWWWWWWWWWWWVWVWWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1449:1512/1
-GAAAATCACAAAAGGGGGTTGAGGAGCAATCCTTCC
-+HWI-EAS337_3:7:1:1449:1512/1
-WWWWWWWWWWWWWWWWVWVWWWVVVVVWVWUUUUUU
-@HWI-EAS337_3:7:1:569:1275/1
-GTTATCCCAAAAAAACATATGGCATCTCTTTCCTTC
-+HWI-EAS337_3:7:1:569:1275/1
-WWWWWWWWWWVWVVWWVWWWWVWWVWVWWWUUUUUR
-@HWI-EAS337_3:7:1:1675:495/1
-GATATAGAAAGATGAAGAGTTATCCCAGCTAGAATT
-+HWI-EAS337_3:7:1:1675:495/1
-WVWWWWVWWWWWWWWWWWWWWVWWVWWVWFUURUUU
-@HWI-EAS337_3:7:1:894:1200/1
-GTGTGGATCGAAACGGGTCGGATTTGTTTAAAACGG
-+HWI-EAS337_3:7:1:894:1200/1
-WWWVWWWWWWWWWWWVWVVWVVWWVTWWWVUUUUSO
-@HWI-EAS337_3:7:1:283:103/1
-GAATTTGAGCTTCCAGATCATTCAGGCATTAGAACA
-+HWI-EAS337_3:7:1:283:103/1
-WWWWWWVWVWWWWWWVWWWWWWWWVTWWWWURUUUU
-@HWI-EAS337_3:7:1:1360:1244/1
-GGATGTGCAGACTTTTCACGCAGGACTACATCACTG
-+HWI-EAS337_3:7:1:1360:1244/1
-WWWWWWWWVWWWWWWWWWWWWWWWVVWVVWUUUUUR
-@HWI-EAS337_3:7:1:762:1421/1
-GTTTAATACCTAGCATTCTGAACCAGTAATATGGCT
-+HWI-EAS337_3:7:1:762:1421/1
-WWWWWWWWWWWWWWWWWWWVVWWWVVWVVWUUSUUU
-@HWI-EAS337_3:7:1:221:601/1
-GACTTCTAGTTCTAGAATATAATCTTAAACATGTAG
-+HWI-EAS337_3:7:1:221:601/1
-WWWWWWWWVVVWWWUWWWVWWWWWWWWQVVUUUUUR
-@HWI-EAS337_3:7:1:768:1056/1
-GTTTTGTTTCTCATCTGTTTGCACATTGAAGCAGAG
-+HWI-EAS337_3:7:1:768:1056/1
-WWWWWVWWWWWWWWWWVWWWQWVVVWWKVVRUURUO
-@HWI-EAS337_3:7:1:1654:1560/1
-GTCTGAATGGGAAATGAACGTTGGGACCATCACTCT
-+HWI-EAS337_3:7:1:1654:1560/1
-WWWWWWWWVVWWWWWWWWWVWWVVVWWJWWUUUUUU
-@HWI-EAS337_3:7:1:1627:745/1
-GAAAGAAAACATCTAGAGCAGAGATCAATATTCCTT
-+HWI-EAS337_3:7:1:1627:745/1
-WWWWVWVWWWWVWWWVWWWWWWWWWWVWWWUUSUUU
-@HWI-EAS337_3:7:1:115:1770/1
-GTTATTAGGTGATAATTGTGTTATTTGATCTTCCAC
-+HWI-EAS337_3:7:1:115:1770/1
-WWWWWWWVVWWWWWWWWVWUWWWWWWQWWVUUUUUR
-@HWI-EAS337_3:7:1:750:750/1
-GTTACAGTTATATTACCTGAGTTTCCCCGTCATCGA
-+HWI-EAS337_3:7:1:750:750/1
-WWWWWWWWWWWWWWWWWWVVVWWWWVWVVVUUUUQR
-@HWI-EAS337_3:7:1:1276:1533/1
-GGTTTTATGCTTGAAAAAGAAGCTACCTTTAATCCC
-+HWI-EAS337_3:7:1:1276:1533/1
-WWVWWWWWWWWWUWWWVWVVVVVWWVVWWWUSUUUU
-@HWI-EAS337_3:7:1:869:1047/1
-GCAGGTTCTTGGATGAGTTCCTTTGGCAGTGTTTCT
-+HWI-EAS337_3:7:1:869:1047/1
-WWWWWWWWWWWVWWVWWWWVWWWWUTVVQVQUUCJU
-@HWI-EAS337_3:7:1:1297:1991/1
-GATGGTGTAGAACTGGACTACTTTCATTTACTCAGA
-+HWI-EAS337_3:7:1:1297:1991/1
-WWWVWWWWVWWWWWVWVWWWVWWWWVVWWVUUUUUU
-@HWI-EAS337_3:7:1:1342:630/1
-GATAATCTGGTTCTTTTAAGAGTCATTATATTACTT
-+HWI-EAS337_3:7:1:1342:630/1
-WVWWWWWWVWWWWWWWWWWVWVWWWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:20:1061/1
-GACGATGGAGTGACATGAAGAAGATACACGTGATTA
-+HWI-EAS337_3:7:1:20:1061/1
-WVWWVWWVWVPVVWWVVVWVWVVSQVWWFWSUQUSR
-@HWI-EAS337_3:7:1:682:1058/1
-GGGCAATCCCGTTGTAAGAAACAAGAAGAATCAAAC
-+HWI-EAS337_3:7:1:682:1058/1
-WWWWVVVVWWWWWWWWWVWWWWWVWVWVWVUUUUUU
-@HWI-EAS337_3:7:1:265:167/1
-GAAACAAAGATCATAATATAGGTATATAAACTTGTG
-+HWI-EAS337_3:7:1:265:167/1
-WWWWWWWWWWWWWWWWWWWWWWVWWVWVWWUUUUUU
-@HWI-EAS337_3:7:1:302:256/1
-GGGTGACAAAGAAAACAAAAGGGACATGGTACTTGG
-+HWI-EAS337_3:7:1:302:256/1
-WWWVWWWWWWWWWWWWVWWWWWVWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:30:333/1
-GTAGAAGGTATGGCATTTCAAAAACTTTAGGACTGC
-+HWI-EAS337_3:7:1:30:333/1
-WWWVWWVVWWWVVWWWWWWWVWVVWWWWVQSUUURU
-@HWI-EAS337_3:7:1:1657:658/1
-GAAGTGACCTCATGAGCTGAGATGCTCAATGTGACA
-+HWI-EAS337_3:7:1:1657:658/1
-WWVWWWWWWWWVWVWWWWWWWVWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:38:373/1
-GGAAGTCGGAACTTAGAATTATTCATTTATTTACAC
-+HWI-EAS337_3:7:1:38:373/1
-WWWWWWWVWWWWWWWWWWWWWWWWVWWWWWUUUUUR
-@HWI-EAS337_3:7:1:452:1793/1
-GCATTAGAGAAAAAAAAATCAACCACCTAAAAAAGG
-+HWI-EAS337_3:7:1:452:1793/1
-WWWWWVWWWVWVVWVWWWVWVVWVVVWVRVSUUSUU
-@HWI-EAS337_3:7:1:735:440/1
-GAATCTGAACCAAGTGACTAGCCTGGGTGCCTCAGA
-+HWI-EAS337_3:7:1:735:440/1
-WWWWWWWWWWWWWWVWWWWWVWVWVWVVVVUUUUSR
-@HWI-EAS337_3:7:1:637:1028/1
-GATACTTCAACAGTGTCCCCCACCCCCACTCTTCTT
-+HWI-EAS337_3:7:1:637:1028/1
-WWWWWWWWWWWWVWWWWWWWVWVWVWWMVVUUUUUU
-@HWI-EAS337_3:7:1:620:890/1
-GAGCAATATCTGGACGTGTGCACACCATATCATACA
-+HWI-EAS337_3:7:1:620:890/1
-WWWWWWWWSWVWWWWVVVVWWWWVWWVVSWUUUUUU
-@HWI-EAS337_3:7:1:1181:1987/1
-GTTAAGGAAGAAAAAGCATACAGGCTAGATAACCAA
-+HWI-EAS337_3:7:1:1181:1987/1
-WWWWWWVWWWSWWWWWWWWWWWWWWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:847:1078/1
-GTAAGTGTTCCTTAATTTTTCCGGTTTGTTAGTTTC
-+HWI-EAS337_3:7:1:847:1078/1
-WWWWWWWWWWWWWWVWWWWWWVQTWWWVWWUJUUUR
-@HWI-EAS337_3:7:1:309:1475/1
-GTAACCAATGTCGATCACGTGGATTCATGAGTACAA
-+HWI-EAS337_3:7:1:309:1475/1
-WVWVVWWVWWVWVWVWWWVWVVWWWVVVVWUUUUUU
-@HWI-EAS337_3:7:1:1084:1531/1
-GTCTGGAAGGAAAGAAACAATAGATGTTTTGAGAAT
-+HWI-EAS337_3:7:1:1084:1531/1
-WVVWWWWWWWWWVWWWWWWWWWWWWWWWWWSUUUUU
-@HWI-EAS337_3:7:1:1687:1892/1
-GTTATCCATGGAAGTATCACATAACCTATCCAAGCA
-+HWI-EAS337_3:7:1:1687:1892/1
-WWWWWWWWWVVWWWWWWWWWVWWWWVWVWVUUUUUU
-@HWI-EAS337_3:7:1:907:1440/1
-GAACAGGGTTTTGAAAAGAAAAAAAATATTGGCCTT
-+HWI-EAS337_3:7:1:907:1440/1
-WWWWWWWWWWWWVWWWWWWWWWWWWWWWWWSUUUUU
-@HWI-EAS337_3:7:1:1540:1571/1
-GGAGGGAAAAAAAATAGGGGCATTTTATATTTGTTG
-+HWI-EAS337_3:7:1:1540:1571/1
-WWWWWWWWWWWWWWVVWWWWWVWWWWVWVWUUUJUO
-@HWI-EAS337_3:7:1:1264:1223/1
-GGATAAGGAATGGAGTTTTATTTATATGAGAGGGAA
-+HWI-EAS337_3:7:1:1264:1223/1
-WWWWWWWVWWWWWWWWWWWWWWWWWWWQWTUUQRUU
-@HWI-EAS337_3:7:1:542:1296/1
-GTCGCTAAAAGCTCATGCATTACACGTAAAAGGATG
-+HWI-EAS337_3:7:1:542:1296/1
-WWWWWWWWWWWWWWVWVVWWWVWVWTVVVWUUUUUU
-@HWI-EAS337_3:7:1:1306:1071/1
-GGTTTTTTTATTTCAAGTCATTCCCAACAATATGAA
-+HWI-EAS337_3:7:1:1306:1071/1
-WWWWWWWWWWWWWWVWVWWVWWVVWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:1659:1489/1
-GTGGTTCAACATAGCCCACAACCAGGTTAAATAGCA
-+HWI-EAS337_3:7:1:1659:1489/1
-WWWWWWWWWWWWWVWWWVWWVWWVVVWWWVUUUSUU
-@HWI-EAS337_3:7:1:1590:1669/1
-GTTAAATAATCGATTAAGATAATAGGAGGCATTACT
-+HWI-EAS337_3:7:1:1590:1669/1
-WWWWWWWWWWWVWWWWWVVWWVWVVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:1702:23/1
-GTGAGCTACATGGAATCCGGTGTTCGGCTTCCACAC
-+HWI-EAS337_3:7:1:1702:23/1
-VWWWVWWWVWNVVVVWWLVVVVVVVVWVVVUULUPR
-@HWI-EAS337_3:7:1:295:329/1
-GATATTGAAGATTTATCTTCAAATATCTGTTTGGCC
-+HWI-EAS337_3:7:1:295:329/1
-WVWWVVWSWVWSWWWVQSWWWVWWWVQQVWUUQOUB
-@HWI-EAS337_3:7:1:1693:589/1
-GAAACAAAAGAGACATTCTCCATCATTTTGTACAAA
-+HWI-EAS337_3:7:1:1693:589/1
-WWWWWWWWWWWVWWWWWWWWWWWWVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:568:1384/1
-GATGAGAAAAATCAGAACATAAGAGGAAATAGATCA
-+HWI-EAS337_3:7:1:568:1384/1
-WVSWWWWVWWWWWVWWWWWVVVVWWWVVVVUUQUUU
-@HWI-EAS337_3:7:1:1752:1815/1
-GAGAACGACCAGTGTTAGTTCTGGAAGATCATGGAT
-+HWI-EAS337_3:7:1:1752:1815/1
-VWVWWWWWWWVWVWWWVWWVWWWVVWVVWVUUSSUU
-@HWI-EAS337_3:7:1:1733:1606/1
-GAGAAACTGAAAACAACAATAAAAAAGTACGAGGCT
-+HWI-EAS337_3:7:1:1733:1606/1
-WWWVWVWWVWVWWWWWWWWVWWVWVWWVWWUPUUMU
-@HWI-EAS337_3:7:1:765:446/1
-GGCTATGTAGCTCCAGAGTTGATCAGCAGAAGCATT
-+HWI-EAS337_3:7:1:765:446/1
-WWWWWWVWWWWWWWJWVVWWWWWVVWQMVVUSUUUU
-@HWI-EAS337_3:7:1:336:118/1
-GGACGAAATTGCTCCAAATTGTGTCTTCTTGTAATT
-+HWI-EAS337_3:7:1:336:118/1
-WWWWWWWWWWWWWWWWWVVWVVVVWWWWWVJURUUU
-@HWI-EAS337_3:7:1:738:903/1
-GTTTCTATCATCACCTTGCATTTGATAAAAATTCCC
-+HWI-EAS337_3:7:1:738:903/1
-VVWPVWWWWVVSVVVWWVVQQVSSVCVVVRUSUUUU
-@HWI-EAS337_3:7:1:413:1444/1
-GCAGGGAGGCTTTTTCGAAGACCTTCGGCTTAAGTA
-+HWI-EAS337_3:7:1:413:1444/1
-WWWWWWWWWWWWWWWWVWWVWWWWWWVVWWUUUUUU
-@HWI-EAS337_3:7:1:224:683/1
-GAGAGGTGGTTAGACAAGACAACACACCTTTAATTT
-+HWI-EAS337_3:7:1:224:683/1
-WWWWWWWWWWWWWWVWWWVVVWVWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:450:1445/1
-GAATCCATGTGGTGTAGTTTGTATACTGGGCAATCA
-+HWI-EAS337_3:7:1:450:1445/1
-WWWWVWWWWWWVWWWWWWWWVWWWWWWTTQUUUUUR
-@HWI-EAS337_3:7:1:241:1025/1
-GATTCCCCGGCAGCTGAAATATGAGTCCAGGCGAAA
-+HWI-EAS337_3:7:1:241:1025/1
-WWWWWWWWWWWWWWWVVVWVVVVWVVTWVVUUUSUU
-@HWI-EAS337_3:7:1:222:646/1
-GTGGCACAATCAAATTAGCTAATTGAAGCATGCATT
-+HWI-EAS337_3:7:1:222:646/1
-WWWWWWWWWWWWVWWWWVWWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:8:1998/1
-GGCGAACTGTGCTTTCCCAAGGCTAGAAAAGTACAA
-+HWI-EAS337_3:7:1:8:1998/1
-WWWWWWWWWWWWWWWWWWWWVWWWWVWWWWUUUUUU
-@HWI-EAS337_3:7:1:1469:210/1
-GAGAGAGGGTGTTGGAGGTGAGGGTGTGGAAATATC
-+HWI-EAS337_3:7:1:1469:210/1
-WWVVWVWWWWWWWWVVVWTWVTVTVVVVTOQSUUUR
-@HWI-EAS337_3:7:1:1307:1998/1
-GAAATAATTTTTTGTAGGGACCTCTTGGAGATAGAA
-+HWI-EAS337_3:7:1:1307:1998/1
-WWWWWWWWWWWWWVWWVVVWWWWWVWTVVVUUUSUU
-@HWI-EAS337_3:7:1:670:1721/1
-GTGATTCTGAATGAGAAGAGGTTCTGTGAATTTGTC
-+HWI-EAS337_3:7:1:670:1721/1
-WWWWWVWWVWWWWWVWWWWWVWWWWVWVWVUUURSU
-@HWI-EAS337_3:7:1:520:1672/1
-GTATTTCAAATTAACTTTATGTGTCCAAGGCTTTGA
-+HWI-EAS337_3:7:1:520:1672/1
-WWWWWWVVWWWWWVVWVVWVTVQVWVVVQQUUUUSR
-@HWI-EAS337_3:7:1:1251:233/1
-GCAATAGAAACCAAGAATGGAGGTGACTTTGCTACA
-+HWI-EAS337_3:7:1:1251:233/1
-WVWWWWWWWWWWWWWVWWWWWVWVVWVWWWQUUUUU
-@HWI-EAS337_3:7:1:1160:71/1
-GTATGATGAGAAAAGCTACGAGGCCACAATGTTGCA
-+HWI-EAS337_3:7:1:1160:71/1
-WWWWWWWWWWWWWWWWWWWWWVWWVVVVVVUSUUSR
-@HWI-EAS337_3:7:1:1487:91/1
-GTACAATAACCAGGTGCGACAAATGAACATGACCGG
-+HWI-EAS337_3:7:1:1487:91/1
-WWWWWWWWWWWWVWVVWVVWWVWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:1406:1858/1
-GAATACAATACAACTAGTGAATTGCCAACAAAGGCA
-+HWI-EAS337_3:7:1:1406:1858/1
-WWWWWWWWWWWVWWWWVWWWWWWTWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1556:417/1
-GTATAGGTTGGAAGCAAGTGGAAGTCTAAAATGCAA
-+HWI-EAS337_3:7:1:1556:417/1
-WVWWWVVVVWVVWVWWSVWVVVVVTVWVVWUUUUUR
-@HWI-EAS337_3:7:1:382:1778/1
-GGTCGATCCCACTAGGAAAATGATTTAGACTTAACT
-+HWI-EAS337_3:7:1:382:1778/1
-WWWWWWWWVWWWVVVVVWVWWWWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:855:481/1
-GGTTCTTCCGGTTCGGGTGCTCTTTCTAATATTGTG
-+HWI-EAS337_3:7:1:855:481/1
-WWWWWWWWWVWWVWTVVVVWWVWWWWWVVVUUURUF
-@HWI-EAS337_3:7:1:627:1931/1
-GACTTCTTCTTCAACTACTAAATCTAGTATTCTAAG
-+HWI-EAS337_3:7:1:627:1931/1
-WWWWWWWWWWWWWVWWWWWWWVWWWWVVWWUUUSUO
-@HWI-EAS337_3:7:1:831:1134/1
-GTTGTTTCAACACTTGGTCAATTTTGCTTCGCCTAG
-+HWI-EAS337_3:7:1:831:1134/1
-WWWWWWWWWWWWWWWVVWWVWWWWWQWWWVJUUUUF
-@HWI-EAS337_3:7:1:378:1488/1
-GTTGAGTGGTCTGACAACATGAGACATTTCCATTTG
-+HWI-EAS337_3:7:1:378:1488/1
-WWWWVWVVWWWWVWWWWWWWWVVWWVWWWWUUUUUR
-@HWI-EAS337_3:7:1:1532:1732/1
-GTTCTAGTGAAGGTAAATCACGTCTGCAAGTGGAAT
-+HWI-EAS337_3:7:1:1532:1732/1
-WWVSVVVWWSSVVLVWWVWVQVVWRVHVOSUCHSSF
-@HWI-EAS337_3:7:1:749:947/1
-GATTATAGTGAGCATGCTATATTAGGAATCCATGGA
-+HWI-EAS337_3:7:1:749:947/1
-WWWWWWWVWVWVWWWWWWVWWWWWVQVWWWUUUSSU
-@HWI-EAS337_3:7:1:437:1034/1
-GATATATGTACTCTTTTCTTATGGTTTTCCTTCTGT
-+HWI-EAS337_3:7:1:437:1034/1
-WWWWWWWWWWWWWWWWWWWWWWUUWWWWVVUUUUCU
-@HWI-EAS337_3:7:1:1426:326/1
-GAAAAAAAGGAGCTAAGAAATCCCATCATGAAATTT
-+HWI-EAS337_3:7:1:1426:326/1
-WWWWWWWWWWVWWWWWWWWVWWWVVVWWWWUUUUUU
-@HWI-EAS337_3:7:1:976:1608/1
-GCAAGGTAGATAGACTGTTTCTAATTGACCCGTGAC
-+HWI-EAS337_3:7:1:976:1608/1
-WWWWWWWWWWWWWWWWWVWWVWVWWWVWVVUUUSUU
-@HWI-EAS337_3:7:1:1731:1459/1
-GACACTTTTTTCAAAATTTTTTTCATTTTCTTTTCA
-+HWI-EAS337_3:7:1:1731:1459/1
-WWWVWWWWWVWWWWWWWWWWWWWWWWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1063:148/1
-GACTATTATACTATTAGACCAATAGCTCATGAAGGA
-+HWI-EAS337_3:7:1:1063:148/1
-WWWWWWWWWWWWWWWWVWWWWWWWWWWWVWUUUUUR
-@HWI-EAS337_3:7:1:1749:344/1
-GTAACACTTTGACGCTACAACAAATAGAGAGAAATA
-+HWI-EAS337_3:7:1:1749:344/1
-VWWWWWWSWVVWWWWWRQVVKCLVKRQVHWUUOQSU
-@HWI-EAS337_3:7:1:667:1164/1
-GAATAAATTTTGCTTGTATAAAGAGAAGGTGAAATG
-+HWI-EAS337_3:7:1:667:1164/1
-WWWWWWWWWWWVWWWWWWWWWWVWVWVTTWSUUUUU
-@HWI-EAS337_3:7:1:1736:273/1
-GAGTTGCAGGAGGAAGAGAGACCAGAGACATGCTAG
-+HWI-EAS337_3:7:1:1736:273/1
-WWWWWWWWVWWWWWWWWWWWWWVWVVWWVVUUUUUU
-@HWI-EAS337_3:7:1:1100:1459/1
-GAGGGTTCACCTGACCAGACCTCATTCAGAGTCTTA
-+HWI-EAS337_3:7:1:1100:1459/1
-WVWWWWWWWWWWWWVVVWWWWWWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:28:992/1
-GTCACTTTATCGCTTGCTTAAAGGCAAGAACGATGA
-+HWI-EAS337_3:7:1:28:992/1
-WWWWWWWWWWWVWWWWWWWWWWVVWWWWVWUUUUSU
-@HWI-EAS337_3:7:1:1575:809/1
-GATCTAAAGTACTAAAGGGGAAGTGTCCTGTAGCAA
-+HWI-EAS337_3:7:1:1575:809/1
-WWWWWWWWWWWWWWWWWVVWWWWWWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:882:1063/1
-GAAACTCGACCTCTGGAATAGTGGGCAGACAGTCGA
-+HWI-EAS337_3:7:1:882:1063/1
-WWWWWWWWWWWWWWWVVVWVWVVWWVWVVVUUUUUU
-@HWI-EAS337_3:7:1:596:1331/1
-GGATATTCTTAGTAATCTTCGCCTCAGTCCTCAAGT
-+HWI-EAS337_3:7:1:596:1331/1
-WWWVVWWWWVWWWWVWWWWVVWVVWWTVVVUUUSUU
-@HWI-EAS337_3:7:1:313:1164/1
-GATGAGTCCACACCCACATCTTCAAGATCGTCCTCA
-+HWI-EAS337_3:7:1:313:1164/1
-WWWWWWWWWVWWWWWWVVWVOVWWRVVVVVUSUUUU
-@HWI-EAS337_3:7:1:1660:281/1
-GGGGTTGTTGTTTCCTGTTCTTAGATCCCCTTTTTT
-+HWI-EAS337_3:7:1:1660:281/1
-WWWWWWWWWVWWWWWWUWWVWWVQVWVVVVUUUUUU
-@HWI-EAS337_3:7:1:1289:257/1
-GAAATTGATAATTTATTATGACTAATTGTGATTACC
-+HWI-EAS337_3:7:1:1289:257/1
-VVSVVSVWVPSVVVPVVPVPPVWVQVVSWNUUUUQR
-@HWI-EAS337_3:7:1:748:213/1
-GTATATTCTTAGTATTCCTAGAAACTAAGTTTGCTC
-+HWI-EAS337_3:7:1:748:213/1
-WWWWWWWWWWWWWWWWWWWWVVWWVWWVWVUUUUUU
-@HWI-EAS337_3:7:1:138:1872/1
-GTTTTTCTCGAACACCCCATTTCAGAGGCAGTGCTT
-+HWI-EAS337_3:7:1:138:1872/1
-WWWWWWWWWWWWWWWWWWWWWWWVVVTWVVUORORU
-@HWI-EAS337_3:7:1:1700:1348/1
-GCAACAAAGCCTACTGACAAGAATACAACCTCAACT
-+HWI-EAS337_3:7:1:1700:1348/1
-WWWWWWVWWWWWWWWWWWVWWWWWWVVWVVUUUUUS
-@HWI-EAS337_3:7:1:384:1970/1
-GAGAAGCATATCCTTGTCTGGTTAAGTCTACAATGT
-+HWI-EAS337_3:7:1:384:1970/1
-SWWWWWWWWWWWWVWWVWWVVWVWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:1328:1911/1
-GATTTTCCATCAATTTACTTTGTTACTGAACTCACT
-+HWI-EAS337_3:7:1:1328:1911/1
-WWWWWWWWWWWWWWWWWWWWWVWWWVWTVVUUUUUU
-@HWI-EAS337_3:7:1:555:596/1
-GGTTGAGGTTGGCTAGCCTTTCTATTTTTTTTTTTT
-+HWI-EAS337_3:7:1:555:596/1
-WWWWVWWWLWWWWWWVPWWWWWWUWWWWVWUUUUTF
-@HWI-EAS337_3:7:1:1622:679/1
-GTGGGGTGATGAATGTGATGTTTTTGAACCTGGGGA
-+HWI-EAS337_3:7:1:1622:679/1
-WWWWWWWWWWWWWWVWWWWVWWWWWTWVVVUSSUUO
-@HWI-EAS337_3:7:1:596:1395/1
-GAAATCTCTTCTTCGATGCCGAAAAATTACAAGGCT
-+HWI-EAS337_3:7:1:596:1395/1
-WWWWWWWWWWWWWWVWWWWWWWVVVWWVWWUUUUUU
-@HWI-EAS337_3:7:1:7:1282/1
-GCACGTTGGTGTAAACATTGCCTGGGCAGTGTGTAA
-+HWI-EAS337_3:7:1:7:1282/1
-WWWWWWWWWWVWWWWWWWWWWWWVVVWWVWUUSUUU
-@HWI-EAS337_3:7:1:1742:1594/1
-GTCGAGGTGTGCAAAAGTTGGCCCAAACATTACGGT
-+HWI-EAS337_3:7:1:1742:1594/1
-WWWWWWWWWWWWWWWWWVVWWWWWVVVVVVUUUUUU
-@HWI-EAS337_3:7:1:1672:1819/1
-GAGAGTTAAATATATCATCATACGTATCATATTGCA
-+HWI-EAS337_3:7:1:1672:1819/1
-WWWWWVWWWVWWWWWVVWWWWVWWVVWVWVUUUUUU
-@HWI-EAS337_3:7:1:1355:1647/1
-GATAATTTCCATGCTGCTCCTAACATTGATCATTCC
-+HWI-EAS337_3:7:1:1355:1647/1
-WWWWWWWWWWWWVWWVWWWWWWWWWWWVVWUUUUUU
-@HWI-EAS337_3:7:1:398:1069/1
-GCCTTATTTGGAGTAAGGAAAATCACAAGCTTTCCC
-+HWI-EAS337_3:7:1:398:1069/1
-WWWWWWWVVVWWWVWWWWWWWWWWWWWVWWUUUUUU
-@HWI-EAS337_3:7:1:1556:1286/1
-GTTGGAGAAAAGGAAATTCTCATACATCTATTACAA
-+HWI-EAS337_3:7:1:1556:1286/1
-WWWVWWSWWWSVVKWVWWWWWWWWVVWVWVUUUSUU
-@HWI-EAS337_3:7:1:351:1386/1
-GGTTTATTATTGTTTGGTTATCCTTATCTCATGCTA
-+HWI-EAS337_3:7:1:351:1386/1
-WWWWWWWVWWWVWWVVVKWWUWWWWVWVWVSUSUUR
-@HWI-EAS337_3:7:1:630:63/1
-GAAAAGGCTTACACTTCACACTCACATAGGTGATTT
-+HWI-EAS337_3:7:1:630:63/1
-WWWWWWWWWWWWWWWWWWWWWWWVWWWWVVURUUUU
-@HWI-EAS337_3:7:1:447:1930/1
-GAAGCATAATAATTCATCATGCTTAGAAAGTGATAA
-+HWI-EAS337_3:7:1:447:1930/1
-WWWWWWWWWWWWWWWWWWVWVVWVVTVVVVUUUUUU
-@HWI-EAS337_3:7:1:182:645/1
-GAAACTCCAGTTTCAAGAACAAAGCCATTGATCAGT
-+HWI-EAS337_3:7:1:182:645/1
-WWWWWWWWVWWWWWWWVVWWWWWVWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:729:1061/1
-GAATTTATACGCATGCAAAAAGAGGTAGCCAAAAAA
-+HWI-EAS337_3:7:1:729:1061/1
-VSWWWWWWVWVWHVWVWQQOWVHSKCVVWHUUKUUK
-@HWI-EAS337_3:7:1:150:1864/1
-GGGAAAGGAAATTTCAAAGCAAAAGCACCTGCGTCA
-+HWI-EAS337_3:7:1:150:1864/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:400:1505/1
-GATCTTTCTCACCATGGACATATAATTTTCTATGTT
-+HWI-EAS337_3:7:1:400:1505/1
-WWWWWWWWWWWWWWWVVVWVWWWVVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1100:159/1
-GTCATATTCACAAGGTAAGCTACTTATAGATGTGTT
-+HWI-EAS337_3:7:1:1100:159/1
-WWWVVWWWWWWWWVVWWVVWVVVVWTWVVWUSUOUU
-@HWI-EAS337_3:7:1:1452:82/1
-GCATTGCTCTATGAATTGGAGAAAACAAGGTGAAAA
-+HWI-EAS337_3:7:1:1452:82/1
-WWWWWWWWWWWWVVWWWVVWUWWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:658:1823/1
-GTAGTTGAGAGTTGATCTTTTCTCACACATGAGGCG
-+HWI-EAS337_3:7:1:658:1823/1
-VVWWWPWWVWWVSSVWVWWWVSVVVVVVVWHLUSUU
-@HWI-EAS337_3:7:1:1338:1344/1
-GAGGAGGGGAAGAAAGTTGGGTATCGAGCAATATAA
-+HWI-EAS337_3:7:1:1338:1344/1
-WVWWWWWWWVWWWWVWWVWWWVVWWWVWVVUUUUUU
-@HWI-EAS337_3:7:1:10:52/1
-GTTTTAAAAATTTAGACTTATCGTCAAGAGTTTGAC
-+HWI-EAS337_3:7:1:10:52/1
-WWWWWWWWVWWWWWVWWWWWWWVWWWWVVVUUUUUU
-@HWI-EAS337_3:7:1:139:1093/1
-GAAAGAGGTTGCACAAACTAAAAATTGGCAATCAGC
-+HWI-EAS337_3:7:1:139:1093/1
-WWWWWWWWWWVWWWWWWWWWWVWWWWWVWWUUUUSU
-@HWI-EAS337_3:7:1:1623:82/1
-GTAATTTGATGTTAAAGGAAATTATAACATTGGACA
-+HWI-EAS337_3:7:1:1623:82/1
-WVWWWVWWWVVWWWWVWVWWWWWWWWWVWVUURUUU
-@HWI-EAS337_3:7:1:1132:1779/1
-GAGTTATGTTTTGCATTATGATATTGTGAGTTTTCA
-+HWI-EAS337_3:7:1:1132:1779/1
-WWWWWWWVWWWWVWWWWWWVWWWWWTWVWTUUUUUR
-@HWI-EAS337_3:7:1:955:162/1
-GCCAGAGCGGATCTATGATTTCTAGAACATGGGTGC
-+HWI-EAS337_3:7:1:955:162/1
-WWWWWWWRWWWWWWWWWVWWWWWWVVWWWVUQUUUU
-@HWI-EAS337_3:7:1:342:1482/1
-GTGAATGAAATTAGACTAATTCCTGGGGCATTGCAA
-+HWI-EAS337_3:7:1:342:1482/1
-WWWWWWWWWWWWWWWWWWWWWWWWVWVWVWUUUUUU
-@HWI-EAS337_3:7:1:899:880/1
-GCCGTAATGAGTAACATTATAAAATTTATTGGGAGT
-+HWI-EAS337_3:7:1:899:880/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWWWWWRQRURU
-@HWI-EAS337_3:7:1:1461:1740/1
-GAAATGAGTTGTTTTACTGACTAGGCCGTGATTGTA
-+HWI-EAS337_3:7:1:1461:1740/1
-WVWWWWWWWWWVWWWWWWVWWWWVVVWVVVOUUJSU
-@HWI-EAS337_3:7:1:386:1537/1
-GGTTAACCATAATTAGGTTTTGAAATAGTGAAAAAT
-+HWI-EAS337_3:7:1:386:1537/1
-WWWWWWWWWWWVVWWVVWWWWUWVWWWVWVUUUUUU
-@HWI-EAS337_3:7:1:1648:533/1
-GCTACTCCAACATCTCCATACAACTTACAAGCGCCA
-+HWI-EAS337_3:7:1:1648:533/1
-WWWWWWWVVWWVWWWWWVWWWVVWWVWVVVUUUUUR
-@HWI-EAS337_3:7:1:1218:749/1
-GTTCTCCCAACAACATCACCAATTGCTCCACTCTCT
-+HWI-EAS337_3:7:1:1218:749/1
-WWWWWWWWVWWWWWWWWWWWWVWWWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:259:44/1
-GATAGGGTAAATGTAATTGGGTTATGAACATTTTAT
-+HWI-EAS337_3:7:1:259:44/1
-WWVWWWWWWWWWVWWWWWWWVWVWWVWWVWUUUUUU
-@HWI-EAS337_3:7:1:316:136/1
-GGATGGCGTTACCTTGATACTGGCCAAGTGTTGATA
-+HWI-EAS337_3:7:1:316:136/1
-WVWWWWWVWWWWWWWVWWVWWVVVWVWVVVUUSPUU
-@HWI-EAS337_3:7:1:1759:1350/1
-GAGATGGTTGGAAATGCTTGAATTATGTTTGAAGTG
-+HWI-EAS337_3:7:1:1759:1350/1
-VVWWWWVWWWWOWQVWVCWWOWWVQVVVVVSUSQUU
-@HWI-EAS337_3:7:1:1190:1457/1
-GGAGCTAAAGTCCTAAGCTTGAGATCCAATAAACTG
-+HWI-EAS337_3:7:1:1190:1457/1
-WWWWWWWWWVVWVWWVWWWWVVVVVWVVWVUUUUUU
-@HWI-EAS337_3:7:1:1067:1958/1
-GTTCATGACATCCACCAACTTGTTTGTCTGTGGCTC
-+HWI-EAS337_3:7:1:1067:1958/1
-WVWWWVWVWWVWWWWWVWWVVWWWWVWVVWURUUUU
-@HWI-EAS337_3:7:1:87:714/1
-GTGAGGAAAATGAAAAGTAAATAGGCAGATGCAGTA
-+HWI-EAS337_3:7:1:87:714/1
-WWWWWWWWWWWWWWWWVWWWWWWVVWWVWWUUUUUU
-@HWI-EAS337_3:7:1:566:576/1
-GAACACAGGGCTTCAGGGTCTAATATCCTGGCAGCG
-+HWI-EAS337_3:7:1:566:576/1
-WWWWWWWWWWWWWWWWWWWWWVWWVWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1316:1455/1
-GAATTTATTTCAGTTCTTCTATTCTTTTTCTCTTCA
-+HWI-EAS337_3:7:1:1316:1455/1
-WWWWWWWWWWWWWVWVWWWWVWWWWWWWWVUUUUSU
-@HWI-EAS337_3:7:1:1734:1346/1
-GACACCTGACAGGAAGGGATCAACGAGCTATCTTTA
-+HWI-EAS337_3:7:1:1734:1346/1
-WWWWWWWWWWWWWWWWVVWWWWVWCWWWWVUUUUUU
-@HWI-EAS337_3:7:1:1315:1665/1
-GATCTTCTGAACGTTGAAACTTTAATAGTTCGAGGA
-+HWI-EAS337_3:7:1:1315:1665/1
-WWWWWWWWWWWWVWWVVWWWWWWVVWWVWWUQUQRR
-@HWI-EAS337_3:7:1:319:1450/1
-GTCCCCCATAATGTTCTTGATAACCTTCCTCTTTCC
-+HWI-EAS337_3:7:1:319:1450/1
-WWWWWVWVWVWVWWWWWWVWWWWWQWWVWWUUUUSR
-@HWI-EAS337_3:7:1:1565:1478/1
-GATCCTAACTTGCTTGGAACTGAGATATAGTTGTTG
-+HWI-EAS337_3:7:1:1565:1478/1
-WWWWVVWWVWWWWWWVUTWWWVVVVVWWVQUUUUUC
-@HWI-EAS337_3:7:1:33:25/1
-GAATATAATCTTAAACATGTAGAGTTTTGAATACTT
-+HWI-EAS337_3:7:1:33:25/1
-WWWWWWWWWWWWWWWWWWWWWVWWWWWWVWUUUUUU
-@HWI-EAS337_3:7:1:1281:1649/1
-GATTAATTCCGTTAGTGAAAAATACAAAATGGAATT
-+HWI-EAS337_3:7:1:1281:1649/1
-WWWWWWWWWWWWWWVWWWVWVWWWWWWVWWRUUUUU
-@HWI-EAS337_3:7:1:783:509/1
-GTCATAGTTTTAAGGCGTGGAAACAGCCTCTAGCAG
-+HWI-EAS337_3:7:1:783:509/1
-WWWWWVWVWWWWWWVWVWUWVVWVWVVVWVUUUUUU
-@HWI-EAS337_3:7:1:527:1823/1
-GTCGGGACCGGAGAAAAGTATTATTTTAGAGATTAT
-+HWI-EAS337_3:7:1:527:1823/1
-WWWWWWWWWWWWWWWWWWWWWWWWWWWVVVSUUUUU
-@HWI-EAS337_3:7:1:361:602/1
-GAAGCGAAAGGGCCATGTTCTTCGTACCTCCGTACA
-+HWI-EAS337_3:7:1:361:602/1
-WWWWWWWWVWWWWWWWWWWWWWWVWWWVWWURUUUR
-@HWI-EAS337_3:7:1:1111:669/1
-GTGTAGTCATGTGAGGCTTTTGTCTCAGAAAAAAGT
-+HWI-EAS337_3:7:1:1111:669/1
-WWWWWWWWWWWWWWWVWWWWWUWVWVVVVVUUUUSU
-@HWI-EAS337_3:7:1:1404:1238/1
-GTAAATTAGGTATAGAAGGAGTAGAGAACAATCTTT
-+HWI-EAS337_3:7:1:1404:1238/1
-WWWSWWWVVWVVWWVWWVSVVWVVWVVVVWOUSUUU
-@HWI-EAS337_3:7:1:1325:1626/1
-GTATGCCAGAGCGTCTTTTTCCTTTGGCATGGGGGC
-+HWI-EAS337_3:7:1:1325:1626/1
-WWWWWWWWVVWWWWVWWWWWWWWWWVVVVWUUSSSR
-@HWI-EAS337_3:7:1:625:642/1
-GAAACTGTAGCTATATGACTATCATTTGAATTTTGT
-+HWI-EAS337_3:7:1:625:642/1
-WWWWWWWWWWWWWWWWVWWWWWWVWWWTWWUUUULU
-@HWI-EAS337_3:7:1:1377:1833/1
-GAAAATGCACCTAAAGTTCTCCCTAAAAACTACTCG
-+HWI-EAS337_3:7:1:1377:1833/1
-WWWWWWWWWWWWWVWWWWWWVWVWVVVVWVUUUUUR
-@HWI-EAS337_3:7:1:964:815/1
-GAACCCTACGGATGGAAGAGGAAAGGCGAGGATTAA
-+HWI-EAS337_3:7:1:964:815/1
-VWVVVVWVVWVVQWWVQWVWWIVVVVFWFWURRURC
-@HWI-EAS337_3:7:1:283:1284/1
-GTATGAAAAGCTTCCACATCCCCACTGGATGTTGAC
-+HWI-EAS337_3:7:1:283:1284/1
-WVWWWWWWWVWWUWWWWVVVWWVVWWWVVVUUUFSU
-@HWI-EAS337_3:7:1:374:1453/1
-GTCAGTCTATGAGCGAATCAGAATGATATTATTGGA
-+HWI-EAS337_3:7:1:374:1453/1
-WWWWVWWWWWVWVWVWWWWWVWWWVVWWWWUUUSJU
-@HWI-EAS337_3:7:1:98:638/1
-GTTACGTTTTCGTATTTGAATGATGTGATCTCAGGG
-+HWI-EAS337_3:7:1:98:638/1
-WWWWWWWWWWWWWWWWWUWWWWWWVWVWWWUUURQU
-@HWI-EAS337_3:7:1:309:1564/1
-GTCTGATAATTTTTCCTGTTTTCTATTTATGTACCA
-+HWI-EAS337_3:7:1:309:1564/1
-WWWVVWWWTWWWVWWWWWVWWVVWWWWWVWSUUUSU
-@HWI-EAS337_3:7:1:863:418/1
-GATAAAACATAAAAGAAATTCCTTCTATAATGAGCA
-+HWI-EAS337_3:7:1:863:418/1
-WVVWWWWWWWWWWWWWWWVWVWWWVWVWVVUUUUUU
-@HWI-EAS337_3:7:1:1532:1997/1
-GTTGTATTTCTAAATGTTTCTACTCCGATTTTTTTT
-+HWI-EAS337_3:7:1:1532:1997/1
-WWWWWWWWWWWWWWWUWWWWWWWWWWQRWWUUUUUU
-@HWI-EAS337_3:7:1:1079:566/1
-GAGTAACGTTTATGGAATCTACATAATTCATTATTA
-+HWI-EAS337_3:7:1:1079:566/1
-WVWWWWWWWWVWWWWWWWVVVWWWWVWWWVUUUUUU
-@HWI-EAS337_3:7:1:42:911/1
-GAGAAAACCATTCACCATCTTTTGCCGTTATAGTGC
-+HWI-EAS337_3:7:1:42:911/1
-WWWVWWWWWWWVWWWWWWWWWWWVWWVWWWUUQUQM
-@HWI-EAS337_3:7:1:428:1520/1
-GCAAAGAAAGAAGGATTTCCTAACCAAGAAGATTTT
-+HWI-EAS337_3:7:1:428:1520/1
-WWWWWWWWWWWWWWWWWWVWWWWWWWVVVVUUUUUU
-@HWI-EAS337_3:7:1:986:591/1
-GAGTTTCTTGCTCCACCACCTTTACCGAAATCTCCA
-+HWI-EAS337_3:7:1:986:591/1
-WWWWWWWWWVWWWWWWWWWWWWWVWVVWVVUUUUUR
-@HWI-EAS337_3:7:1:181:1099/1
-GGTCGACGTAAGAGATCTGCAGGGCTATTACTCATT
-+HWI-EAS337_3:7:1:181:1099/1
-WWWWWWWWWWWWWVWWWWWWWVVWWWVWWVUUUUUU
-@HWI-EAS337_3:7:1:509:832/1
-GTGAAGTATGGGTGGAAATGCTTGCGTATGCTGCTA
-+HWI-EAS337_3:7:1:509:832/1
-WWWWVWWWWVVWWWWWWVWVWWWVVVVVWVSUUUUR
-@HWI-EAS337_3:7:1:510:597/1
-GGGTCTGGAATAGTAATGCGCTGATTCTAGTAAAGT
-+HWI-EAS337_3:7:1:510:597/1
-VWWWVWWWWWWWWWWWWVWWWWWVWWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1765:1489/1
-GTCAATTTTTTCTTTGTTTAAATCCGGGGAGGCTAG
-+HWI-EAS337_3:7:1:1765:1489/1
-WVWWVWWWWWWWWWWVWWWWWWWWWQQVTVUSUUUR
-@HWI-EAS337_3:7:1:417:1560/1
-GTAACCTTCCCAGTGTCTCCTTAAGAAAGACTTGGA
-+HWI-EAS337_3:7:1:417:1560/1
-WWWWVWWSWSVWVVVVWWWWWWWWVSWWWWUQUUQU
-@HWI-EAS337_3:7:1:1047:854/1
-GTTGAAATTCCTGATTTTCCATGTGCATCATAAGCC
-+HWI-EAS337_3:7:1:1047:854/1
-WWWWWVWWWWWWWWUWWWWWVWVWVVVWVVUUUUUU
-@HWI-EAS337_3:7:1:1296:202/1
-GGTGTTGGAGTTGGATTTGTTTCTGCTTTGATATCC
-+HWI-EAS337_3:7:1:1296:202/1
-WWWWWWWVWVWWWVVWWWWWWWWWVVWWWTUUUUUF
-@HWI-EAS337_3:7:1:502:642/1
-GATGATTCTTGCTGGTTAAGTTGAGATGGGTTATAA
-+HWI-EAS337_3:7:1:502:642/1
-WWWWWVPVVVWWWVVVWWWVWWSVVVWVVVUUUUUR
-@HWI-EAS337_3:7:1:82:1651/1
-GGCATCCTGTTCATCCTTCTCTTCATTTTTAGGCGT
-+HWI-EAS337_3:7:1:82:1651/1
-WWWWWWWWVWWWWWWWWVWWWWWWVWWWWWUKJUQU
-@HWI-EAS337_3:7:1:1505:1274/1
-GAAACTTTTCAAAAAAAAAGTTGCATGAGAAATAAG
-+HWI-EAS337_3:7:1:1505:1274/1
-WWWWWWWWWWWWVWWWWWWWVWWWWWWVWWSUUUUR
-@HWI-EAS337_3:7:1:5:1770/1
-GTGTGAAAAAGTATTTCATTCACATATTGAGTTGTT
-+HWI-EAS337_3:7:1:5:1770/1
-WWWWWWWWWWVWWWWWWWWWWWWWWWWWVVSUUQUU
-@HWI-EAS337_3:7:1:115:1005/1
-GATTTTACTGGAATGGGGAAGGGTGAGGCATGGGTG
-+HWI-EAS337_3:7:1:115:1005/1
-WWWWWWWWWVVWWWVVVVWWVVVWWWVVWVUUUUUU
-@HWI-EAS337_3:7:1:354:1708/1
-GCATCCGACAGTGACTTAGACGATGAGGAATACGAG
-+HWI-EAS337_3:7:1:354:1708/1
-WWWWWWWWWWWWVWWWWWVWWVWWVWWVWWUUUUUR
-@HWI-EAS337_3:7:1:1639:1500/1
-GTGATTATTATCTAACTCTGCAACAGCATCCAGGGA
-+HWI-EAS337_3:7:1:1639:1500/1
-WWWWWWVVWWWWWVVWVVWUVVVVVVVVWVUUUUUR
-@HWI-EAS337_3:7:1:766:243/1
-GTGGCATCTATGGAAGATAAATTGGAGATTGTTGCT
-+HWI-EAS337_3:7:1:766:243/1
-WWVWWWWWWWWVVWWVWWWWWWWVVVTVWWRUUJSU
-@HWI-EAS337_3:7:1:920:144/1
-GTGCGATCACACTGTTTATGTTGTTGTTGATCATTG
-+HWI-EAS337_3:7:1:920:144/1
-WWVVWWWWWVWPWVWWVWWSWVSWWHWWLVUCPUUH
-@HWI-EAS337_3:7:1:389:268/1
-GGTCAATTAGAGAGGGCAACCACCCTCAAAGAATTT
-+HWI-EAS337_3:7:1:389:268/1
-WWWWWWWWWVWWWWVVWWWWWWWWWWWWVVSUUUUU
-@HWI-EAS337_3:7:1:294:1868/1
-GAAAAAAAATTGTTTGTCTTGAATTAATGTTTCAAT
-+HWI-EAS337_3:7:1:294:1868/1
-VWVWWWWWWWWVQWWWWOWVVWWVWVVWQWUURULU
-@HWI-EAS337_3:7:1:1147:62/1
-GAATTCCCCTCAGGTTGGAGTTGTGCACTTGGCACT
-+HWI-EAS337_3:7:1:1147:62/1
-WWWWWWWWWWWWVWWWWWWVWWVWVVWVVWUUUUUU
-@HWI-EAS337_3:7:1:787:1759/1
-GGTTTTATTAGAATTGGTAGCTGTTCTGATTTTCTG
-+HWI-EAS337_3:7:1:787:1759/1
-WVVWWWWVWWWWWWWVUWWUWWUVWVVTVVUUUUUH
-@HWI-EAS337_3:7:1:425:1939/1
-GCTAATTGTGGTGTCTGGGTCTATGTGGCTAAACTT
-+HWI-EAS337_3:7:1:425:1939/1
-WWWWVWWVWWWWVWWWVVVVWWWVVWVVVWUUUUUU
-@HWI-EAS337_3:7:1:187:1132/1
-GTGGGAGAGGCAAGGGGCTTGGCTCATATCCTCTTC
-+HWI-EAS337_3:7:1:187:1132/1
-WVWWWWWWWWWWWWWWWWWWWTVWVWWWVVUUUUUU
-@HWI-EAS337_3:7:1:1739:1840/1
-GGAGGGGTGAAATCGTTTCTGAAAAATAATGAAATG
-+HWI-EAS337_3:7:1:1739:1840/1
-WWVWWWWWWWWWWWWWWVTWWWVVVWWWWWUUUUUU
-@HWI-EAS337_3:7:1:1505:1876/1
-GAAAGATCAAGTGTTGTCAAGTTCACTAGTTTAGAG
-+HWI-EAS337_3:7:1:1505:1876/1
-WWWWWWWWWWWWWWWWWWWWVWWVWWWVVVUUUSUR
-@HWI-EAS337_3:7:1:447:192/1
-GACTATGCCTAGCAGCTGAAATCACCACAACAAGTT
-+HWI-EAS337_3:7:1:447:192/1
-WWWWWWWWWWWWWWWTWWWVVWWVWWWWWVUUUUUU
-@HWI-EAS337_3:7:1:21:2019/1
-GTATGAGGTAAAAGATGATAACCTGTCTTCCAGCCC
-+HWI-EAS337_3:7:1:21:2019/1
-VWWVVWWVVWWWWWWWWWWWWWWWQVVWWWUURUUU
-@HWI-EAS337_3:7:1:1593:652/1
-GTGATGAGTAAAACATCATCATATGAACTTGAAGAG
-+HWI-EAS337_3:7:1:1593:652/1
-WWWVWVWWVWVWWVWWWWWWVVWWVWWVWWUUUSUU
-@HWI-EAS337_3:7:1:1254:1660/1
-GAAGTTTGTAATTCCTTTTAGGATTGTGGTTAACAT
-+HWI-EAS337_3:7:1:1254:1660/1
-WWWVVWWWWWWWWWWWVWVWVUWWWTWVQWUUUUMU
-@HWI-EAS337_3:7:1:291:629/1
-GTAGAGGAGGTAGGCTTGGTGGTCCCTCTATGGTAA
-+HWI-EAS337_3:7:1:291:629/1
-WWWWWWWWWWVVVWVWVVWTWWKOVVTRVSUSSMFR
--- a/SMART/Java/Python/TestFiles/Wig/chr1.wig	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,9 +0,0 @@
-fixedStep  chrom=chr1  start=11  step=1
-1.1
-1.2
-fixedStep  chrom=chr1  start=14  step=1
-1.4
-1.5
-variableStep chrom=chr1
-17  1.7
-19  1.9
--- a/SMART/Java/Python/TestFiles/adress.txt	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,7 +0,0 @@
-0
-58
-115
-173
-231
-289
-347
--- a/SMART/Java/Python/TestFiles/clusterize_default_expected.gff3	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1790 +0,0 @@
-chr4	S-MART	transcript	1	50000	.	+	.	nbElements=0;ID=region1;Name=region1
-chr4	S-MART	transcript	49951	99950	.	+	.	nbElements=0;ID=region2;Name=region2
-chr4	S-MART	transcript	99901	149900	.	+	.	nbElements=0;ID=region3;Name=region3
-chr4	S-MART	transcript	149851	199850	.	+	.	nbElements=0;ID=region4;Name=region4
-chr4	S-MART	transcript	199801	249800	.	+	.	nbElements=0;ID=region5;Name=region5
-chr4	S-MART	transcript	249751	299750	.	+	.	nbElements=0;ID=region6;Name=region6
-chr4	S-MART	transcript	299701	349700	.	+	.	nbElements=0;ID=region7;Name=region7
-chr4	S-MART	transcript	349651	399650	.	+	.	nbElements=0;ID=region8;Name=region8
-chr4	S-MART	transcript	399601	449600	.	+	.	nbElements=0;ID=region9;Name=region9
-chr4	S-MART	transcript	449551	499550	.	+	.	nbElements=0;ID=region10;Name=region10
-chr4	S-MART	transcript	499501	549500	.	+	.	nbElements=0;ID=region11;Name=region11
-chr4	S-MART	transcript	549451	599450	.	+	.	nbElements=0;ID=region12;Name=region12
-chr4	S-MART	transcript	599401	649400	.	+	.	nbElements=0;ID=region13;Name=region13
-chr4	S-MART	transcript	649351	699350	.	+	.	nbElements=0;ID=region14;Name=region14
-chr4	S-MART	transcript	699301	749300	.	+	.	nbElements=0;ID=region15;Name=region15
-chr4	S-MART	transcript	749251	799250	.	+	.	nbElements=0;ID=region16;Name=region16
-chr4	S-MART	transcript	799201	849200	.	+	.	nbElements=0;ID=region17;Name=region17
-chr4	S-MART	transcript	849151	899150	.	+	.	nbElements=0;ID=region18;Name=region18
-chr4	S-MART	transcript	899101	949100	.	+	.	nbElements=0;ID=region19;Name=region19
-chr4	S-MART	transcript	949051	999050	.	+	.	nbElements=0;ID=region20;Name=region20
-chr4	S-MART	transcript	999001	1049000	.	+	.	nbElements=0;ID=region21;Name=region21
-chr4	S-MART	transcript	1048951	1098950	.	+	.	nbElements=0;ID=region22;Name=region22
-chr4	S-MART	transcript	1098901	1148900	.	+	.	nbElements=0;ID=region23;Name=region23
-chr4	S-MART	transcript	1148851	1198850	.	+	.	nbElements=0;ID=region24;Name=region24
-chr4	S-MART	transcript	1198801	1248800	.	+	.	nbElements=0;ID=region25;Name=region25
-chr4	S-MART	transcript	1248751	1298750	.	+	.	nbElements=0;ID=region26;Name=region26
-chr4	S-MART	transcript	1298701	1348700	.	+	.	nbElements=0;ID=region27;Name=region27
-chr4	S-MART	transcript	1348651	1398650	.	+	.	nbElements=0;ID=region28;Name=region28
-chr4	S-MART	transcript	1398601	1448600	.	+	.	nbElements=0;ID=region29;Name=region29
-chr4	S-MART	transcript	1448551	1498550	.	+	.	nbElements=0;ID=region30;Name=region30
-chr4	S-MART	transcript	1498501	1548500	.	+	.	nbElements=0;ID=region31;Name=region31
-chr4	S-MART	transcript	1548451	1598450	.	+	.	nbElements=0;ID=region32;Name=region32
-chr4	S-MART	transcript	1598401	1648400	.	+	.	nbElements=0;ID=region33;Name=region33
-chr4	S-MART	transcript	1648351	1698350	.	+	.	nbElements=0;ID=region34;Name=region34
-chr4	S-MART	transcript	1698301	1748300	.	+	.	nbElements=0;ID=region35;Name=region35
-chr4	S-MART	transcript	1748251	1798250	.	+	.	nbElements=0;ID=region36;Name=region36
-chr4	S-MART	transcript	1798201	1848200	.	+	.	nbElements=0;ID=region37;Name=region37
-chr4	S-MART	transcript	1848151	1898150	.	+	.	nbElements=0;ID=region38;Name=region38
-chr4	S-MART	transcript	1898101	1948100	.	+	.	nbElements=0;ID=region39;Name=region39
-chr4	S-MART	transcript	1948051	1998050	.	+	.	nbElements=0;ID=region40;Name=region40
-chr4	S-MART	transcript	1998001	2048000	.	+	.	nbElements=0;ID=region41;Name=region41
-chr4	S-MART	transcript	2047951	2097950	.	+	.	nbElements=0;ID=region42;Name=region42
-chr4	S-MART	transcript	2097901	2147900	.	+	.	nbElements=0;ID=region43;Name=region43
-chr4	S-MART	transcript	2147851	2197850	.	+	.	nbElements=0;ID=region44;Name=region44
-chr4	S-MART	transcript	2197801	2247800	.	+	.	nbElements=0;ID=region45;Name=region45
-chr4	S-MART	transcript	2247751	2297750	.	+	.	nbElements=0;ID=region46;Name=region46
-chr4	S-MART	transcript	2297701	2347700	.	+	.	nbElements=0;ID=region47;Name=region47
-chr4	S-MART	transcript	2347651	2397650	.	+	.	nbElements=0;ID=region48;Name=region48
-chr4	S-MART	transcript	2397601	2447600	.	+	.	nbElements=0;ID=region49;Name=region49
-chr4	S-MART	transcript	2447551	2497550	.	+	.	nbElements=0;ID=region50;Name=region50
-chr4	S-MART	transcript	2497501	2547500	.	+	.	nbElements=0;ID=region51;Name=region51
-chr4	S-MART	transcript	2547451	2597450	.	+	.	nbElements=0;ID=region52;Name=region52
-chr4	S-MART	transcript	2597401	2647400	.	+	.	nbElements=0;ID=region53;Name=region53
-chr4	S-MART	transcript	2647351	2697350	.	+	.	nbElements=0;ID=region54;Name=region54
-chr4	S-MART	transcript	2697301	2747300	.	+	.	nbElements=0;ID=region55;Name=region55
-chr4	S-MART	transcript	2747251	2797250	.	+	.	nbElements=0;ID=region56;Name=region56
-chr4	S-MART	transcript	2797201	2847200	.	+	.	nbElements=0;ID=region57;Name=region57
-chr4	S-MART	transcript	2847151	2897150	.	+	.	nbElements=0;ID=region58;Name=region58
-chr4	S-MART	transcript	2897101	2947100	.	+	.	nbElements=0;ID=region59;Name=region59
-chr4	S-MART	transcript	2947051	2997050	.	+	.	nbElements=0;ID=region60;Name=region60
-chr4	S-MART	transcript	2997001	3047000	.	+	.	nbElements=0;ID=region61;Name=region61
-chr4	S-MART	transcript	3046951	3096950	.	+	.	nbElements=0;ID=region62;Name=region62
-chr4	S-MART	transcript	3096901	3146900	.	+	.	nbElements=0;ID=region63;Name=region63
-chr4	S-MART	transcript	3146851	3196850	.	+	.	nbElements=0;ID=region64;Name=region64
-chr4	S-MART	transcript	3196801	3246800	.	+	.	nbElements=0;ID=region65;Name=region65
-chr4	S-MART	transcript	3246751	3296750	.	+	.	nbElements=0;ID=region66;Name=region66
-chr4	S-MART	transcript	3296701	3346700	.	+	.	nbElements=0;ID=region67;Name=region67
-chr4	S-MART	transcript	3346651	3396650	.	+	.	nbElements=0;ID=region68;Name=region68
-chr4	S-MART	transcript	3396601	3446600	.	+	.	nbElements=0;ID=region69;Name=region69
-chr4	S-MART	transcript	3446551	3496550	.	+	.	nbElements=0;ID=region70;Name=region70
-chr4	S-MART	transcript	3496501	3546500	.	+	.	nbElements=0;ID=region71;Name=region71
-chr4	S-MART	transcript	3546451	3596450	.	+	.	nbElements=0;ID=region72;Name=region72
-chr4	S-MART	transcript	3596401	3646400	.	+	.	nbElements=0;ID=region73;Name=region73
-chr4	S-MART	transcript	3646351	3696350	.	+	.	nbElements=0;ID=region74;Name=region74
-chr4	S-MART	transcript	3696301	3746300	.	+	.	nbElements=0;ID=region75;Name=region75
-chr4	S-MART	transcript	3746251	3796250	.	+	.	nbElements=0;ID=region76;Name=region76
-chr4	S-MART	transcript	3796201	3846200	.	+	.	nbElements=0;ID=region77;Name=region77
-chr4	S-MART	transcript	3846151	3896150	.	+	.	nbElements=0;ID=region78;Name=region78
-chr4	S-MART	transcript	3896101	3946100	.	+	.	nbElements=0;ID=region79;Name=region79
-chr4	S-MART	transcript	3946051	3996050	.	+	.	nbElements=0;ID=region80;Name=region80
-chr4	S-MART	transcript	3996001	4046000	.	+	.	nbElements=0;ID=region81;Name=region81
-chr4	S-MART	transcript	4045951	4095950	.	+	.	nbElements=0;ID=region82;Name=region82
-chr4	S-MART	transcript	4095901	4145900	.	+	.	nbElements=0;ID=region83;Name=region83
-chr4	S-MART	transcript	4145851	4195850	.	+	.	nbElements=0;ID=region84;Name=region84
-chr4	S-MART	transcript	4195801	4245800	.	+	.	nbElements=0;ID=region85;Name=region85
-chr4	S-MART	transcript	4245751	4295750	.	+	.	nbElements=0;ID=region86;Name=region86
-chr4	S-MART	transcript	4295701	4345700	.	+	.	nbElements=0;ID=region87;Name=region87
-chr4	S-MART	transcript	4345651	4395650	.	+	.	nbElements=0;ID=region88;Name=region88
-chr4	S-MART	transcript	4395601	4445600	.	+	.	nbElements=0;ID=region89;Name=region89
-chr4	S-MART	transcript	4445551	4495550	.	+	.	nbElements=0;ID=region90;Name=region90
-chr4	S-MART	transcript	4495501	4545500	.	+	.	nbElements=0;ID=region91;Name=region91
-chr4	S-MART	transcript	4545451	4595450	.	+	.	nbElements=0;ID=region92;Name=region92
-chr4	S-MART	transcript	4595401	4645400	.	+	.	nbElements=0;ID=region93;Name=region93
-chr4	S-MART	transcript	4645351	4695350	.	+	.	nbElements=0;ID=region94;Name=region94
-chr4	S-MART	transcript	4695301	4745300	.	+	.	nbElements=0;ID=region95;Name=region95
-chr4	S-MART	transcript	4745251	4795250	.	+	.	nbElements=0;ID=region96;Name=region96
-chr4	S-MART	transcript	4795201	4845200	.	+	.	nbElements=0;ID=region97;Name=region97
-chr4	S-MART	transcript	4845151	4895150	.	+	.	nbElements=0;ID=region98;Name=region98
-chr4	S-MART	transcript	4895101	4945100	.	+	.	nbElements=0;ID=region99;Name=region99
-chr4	S-MART	transcript	4945051	4995050	.	+	.	nbElements=0;ID=region100;Name=region100
-chr4	S-MART	transcript	4995001	5045000	.	+	.	nbElements=0;ID=region101;Name=region101
-chr4	S-MART	transcript	5044951	5094950	.	+	.	nbElements=0;ID=region102;Name=region102
-chr4	S-MART	transcript	5094901	5144900	.	+	.	nbElements=0;ID=region103;Name=region103
-chr4	S-MART	transcript	5144851	5194850	.	+	.	nbElements=0;ID=region104;Name=region104
-chr4	S-MART	transcript	5194801	5244800	.	+	.	nbElements=0;ID=region105;Name=region105
-chr4	S-MART	transcript	5244751	5294750	.	+	.	nbElements=0;ID=region106;Name=region106
-chr4	S-MART	transcript	5294701	5344700	.	+	.	nbElements=0;ID=region107;Name=region107
-chr4	S-MART	transcript	5344651	5394650	.	+	.	nbElements=0;ID=region108;Name=region108
-chr4	S-MART	transcript	5394601	5444600	.	+	.	nbElements=0;ID=region109;Name=region109
-chr4	S-MART	transcript	5444551	5494550	.	+	.	nbElements=0;ID=region110;Name=region110
-chr4	S-MART	transcript	5494501	5544500	.	+	.	nbElements=0;ID=region111;Name=region111
-chr4	S-MART	transcript	5544451	5594450	.	+	.	nbElements=0;ID=region112;Name=region112
-chr4	S-MART	transcript	5594401	5644400	.	+	.	nbElements=0;ID=region113;Name=region113
-chr4	S-MART	transcript	5644351	5694350	.	+	.	nbElements=0;ID=region114;Name=region114
-chr4	S-MART	transcript	5694301	5744300	.	+	.	nbElements=0;ID=region115;Name=region115
-chr4	S-MART	transcript	5744251	5794250	.	+	.	nbElements=0;ID=region116;Name=region116
-chr4	S-MART	transcript	5794201	5844200	.	+	.	nbElements=0;ID=region117;Name=region117
-chr4	S-MART	transcript	5844151	5894150	.	+	.	nbElements=0;ID=region118;Name=region118
-chr4	S-MART	transcript	5894101	5944100	.	+	.	nbElements=0;ID=region119;Name=region119
-chr4	S-MART	transcript	5944051	5994050	.	+	.	nbElements=0;ID=region120;Name=region120
-chr4	S-MART	transcript	5994001	6044000	.	+	.	nbElements=0;ID=region121;Name=region121
-chr4	S-MART	transcript	6043951	6093950	.	+	.	nbElements=0;ID=region122;Name=region122
-chr4	S-MART	transcript	6093901	6143900	.	+	.	nbElements=0;ID=region123;Name=region123
-chr4	S-MART	transcript	6143851	6193850	.	+	.	nbElements=0;ID=region124;Name=region124
-chr4	S-MART	transcript	6193801	6243800	.	+	.	nbElements=0;ID=region125;Name=region125
-chr4	S-MART	transcript	6243751	6293750	.	+	.	nbElements=0;ID=region126;Name=region126
-chr4	S-MART	transcript	6293701	6343700	.	+	.	nbElements=0;ID=region127;Name=region127
-chr4	S-MART	transcript	6343651	6393650	.	+	.	nbElements=0;ID=region128;Name=region128
-chr4	S-MART	transcript	6393601	6443600	.	+	.	nbElements=0;ID=region129;Name=region129
-chr4	S-MART	transcript	6443551	6493550	.	+	.	nbElements=0;ID=region130;Name=region130
-chr4	S-MART	transcript	6493501	6543500	.	+	.	nbElements=0;ID=region131;Name=region131
-chr4	S-MART	transcript	6543451	6593450	.	+	.	nbElements=0;ID=region132;Name=region132
-chr4	S-MART	transcript	6593401	6643400	.	+	.	nbElements=0;ID=region133;Name=region133
-chr4	S-MART	transcript	6643351	6693350	.	+	.	nbElements=0;ID=region134;Name=region134
-chr4	S-MART	transcript	6693301	6743300	.	+	.	nbElements=0;ID=region135;Name=region135
-chr4	S-MART	transcript	6743251	6793250	.	+	.	nbElements=0;ID=region136;Name=region136
-chr4	S-MART	transcript	6793201	6843200	.	+	.	nbElements=0;ID=region137;Name=region137
-chr4	S-MART	transcript	6843151	6893150	.	+	.	nbElements=0;ID=region138;Name=region138
-chr4	S-MART	transcript	6893101	6943100	.	+	.	nbElements=0;ID=region139;Name=region139
-chr4	S-MART	transcript	6943051	6993050	.	+	.	nbElements=0;ID=region140;Name=region140
-chr4	S-MART	transcript	6993001	7043000	.	+	.	nbElements=0;ID=region141;Name=region141
-chr4	S-MART	transcript	7042951	7092950	.	+	.	nbElements=0;ID=region142;Name=region142
-chr4	S-MART	transcript	7092901	7142900	.	+	.	nbElements=0;ID=region143;Name=region143
-chr4	S-MART	transcript	7142851	7192850	.	+	.	nbElements=0;ID=region144;Name=region144
-chr4	S-MART	transcript	7192801	7242800	.	+	.	nbElements=0;ID=region145;Name=region145
-chr4	S-MART	transcript	7242751	7292750	.	+	.	nbElements=0;ID=region146;Name=region146
-chr4	S-MART	transcript	7292701	7342700	.	+	.	nbElements=0;ID=region147;Name=region147
-chr4	S-MART	transcript	7342651	7392650	.	+	.	nbElements=0;ID=region148;Name=region148
-chr4	S-MART	transcript	7392601	7442600	.	+	.	nbElements=0;ID=region149;Name=region149
-chr4	S-MART	transcript	7442551	7492550	.	+	.	nbElements=0;ID=region150;Name=region150
-chr4	S-MART	transcript	7492501	7542500	.	+	.	nbElements=0;ID=region151;Name=region151
-chr4	S-MART	transcript	7542451	7592450	.	+	.	nbElements=0;ID=region152;Name=region152
-chr4	S-MART	transcript	7592401	7642400	.	+	.	nbElements=0;ID=region153;Name=region153
-chr4	S-MART	transcript	7642351	7692350	.	+	.	nbElements=0;ID=region154;Name=region154
-chr4	S-MART	transcript	7692301	7742300	.	+	.	nbElements=0;ID=region155;Name=region155
-chr4	S-MART	transcript	7742251	7792250	.	+	.	nbElements=0;ID=region156;Name=region156
-chr4	S-MART	transcript	7792201	7842200	.	+	.	nbElements=0;ID=region157;Name=region157
-chr4	S-MART	transcript	7842151	7892150	.	+	.	nbElements=0;ID=region158;Name=region158
-chr4	S-MART	transcript	7892101	7942100	.	+	.	nbElements=0;ID=region159;Name=region159
-chr4	S-MART	transcript	7942051	7992050	.	+	.	nbElements=0;ID=region160;Name=region160
-chr4	S-MART	transcript	7992001	8042000	.	+	.	nbElements=0;ID=region161;Name=region161
-chr4	S-MART	transcript	8041951	8091950	.	+	.	nbElements=0;ID=region162;Name=region162
-chr4	S-MART	transcript	8091901	8141900	.	+	.	nbElements=0;ID=region163;Name=region163
-chr4	S-MART	transcript	8141851	8191850	.	+	.	nbElements=0;ID=region164;Name=region164
-chr4	S-MART	transcript	8191801	8241800	.	+	.	nbElements=0;ID=region165;Name=region165
-chr4	S-MART	transcript	8241751	8291750	.	+	.	nbElements=0;ID=region166;Name=region166
-chr4	S-MART	transcript	8291701	8341700	.	+	.	nbElements=0;ID=region167;Name=region167
-chr4	S-MART	transcript	8341651	8391650	.	+	.	nbElements=0;ID=region168;Name=region168
-chr4	S-MART	transcript	8391601	8441600	.	+	.	nbElements=0;ID=region169;Name=region169
-chr4	S-MART	transcript	8441551	8491550	.	+	.	nbElements=0;ID=region170;Name=region170
-chr4	S-MART	transcript	8491501	8541500	.	+	.	nbElements=0;ID=region171;Name=region171
-chr4	S-MART	transcript	8541451	8591450	.	+	.	nbElements=0;ID=region172;Name=region172
-chr4	S-MART	transcript	8591401	8641400	.	+	.	nbElements=0;ID=region173;Name=region173
-chr4	S-MART	transcript	8641351	8691350	.	+	.	nbElements=0;ID=region174;Name=region174
-chr4	S-MART	transcript	8691301	8741300	.	+	.	nbElements=0;ID=region175;Name=region175
-chr4	S-MART	transcript	8741251	8791250	.	+	.	nbElements=0;ID=region176;Name=region176
-chr4	S-MART	transcript	8791201	8841200	.	+	.	nbElements=0;ID=region177;Name=region177
-chr4	S-MART	transcript	8841151	8891150	.	+	.	nbElements=0;ID=region178;Name=region178
-chr4	S-MART	transcript	8891101	8941100	.	+	.	nbElements=0;ID=region179;Name=region179
-chr4	S-MART	transcript	8941051	8991050	.	+	.	nbElements=0;ID=region180;Name=region180
-chr4	S-MART	transcript	8991001	9041000	.	+	.	nbElements=0;ID=region181;Name=region181
-chr4	S-MART	transcript	9040951	9090950	.	+	.	nbElements=0;ID=region182;Name=region182
-chr4	S-MART	transcript	9090901	9140900	.	+	.	nbElements=0;ID=region183;Name=region183
-chr4	S-MART	transcript	9140851	9190850	.	+	.	nbElements=0;ID=region184;Name=region184
-chr4	S-MART	transcript	9190801	9240800	.	+	.	nbElements=0;ID=region185;Name=region185
-chr4	S-MART	transcript	9240751	9290750	.	+	.	nbElements=0;ID=region186;Name=region186
-chr4	S-MART	transcript	9290701	9340700	.	+	.	nbElements=0;ID=region187;Name=region187
-chr4	S-MART	transcript	9340651	9390650	.	+	.	nbElements=0;ID=region188;Name=region188
-chr4	S-MART	transcript	9390601	9440600	.	+	.	nbElements=0;ID=region189;Name=region189
-chr4	S-MART	transcript	9440551	9490550	.	+	.	nbElements=0;ID=region190;Name=region190
-chr4	S-MART	transcript	9490501	9540500	.	+	.	nbElements=0;ID=region191;Name=region191
-chr4	S-MART	transcript	9540451	9590450	.	+	.	nbElements=0;ID=region192;Name=region192
-chr4	S-MART	transcript	9590401	9640400	.	+	.	nbElements=0;ID=region193;Name=region193
-chr4	S-MART	transcript	9640351	9690350	.	+	.	nbElements=0;ID=region194;Name=region194
-chr4	S-MART	transcript	9690301	9740300	.	+	.	nbElements=0;ID=region195;Name=region195
-chr4	S-MART	transcript	9740251	9790250	.	+	.	nbElements=0;ID=region196;Name=region196
-chr4	S-MART	transcript	9790201	9840200	.	+	.	nbElements=0;ID=region197;Name=region197
-chr4	S-MART	transcript	9840151	9890150	.	+	.	nbElements=0;ID=region198;Name=region198
-chr4	S-MART	transcript	9890101	9940100	.	+	.	nbElements=0;ID=region199;Name=region199
-chr4	S-MART	transcript	9940051	9990050	.	+	.	nbElements=0;ID=region200;Name=region200
-chr4	S-MART	transcript	9990001	10040000	.	+	.	nbElements=0;ID=region201;Name=region201
-chr4	S-MART	transcript	10039951	10089950	.	+	.	nbElements=0;ID=region202;Name=region202
-chr4	S-MART	transcript	10089901	10139900	.	+	.	nbElements=0;ID=region203;Name=region203
-chr4	S-MART	transcript	10139851	10189850	.	+	.	nbElements=0;ID=region204;Name=region204
-chr4	S-MART	transcript	10189801	10239800	.	+	.	nbElements=0;ID=region205;Name=region205
-chr4	S-MART	transcript	10239751	10289750	.	+	.	nbElements=0;ID=region206;Name=region206
-chr4	S-MART	transcript	10289701	10339700	.	+	.	nbElements=0;ID=region207;Name=region207
-chr4	S-MART	transcript	10339651	10389650	.	+	.	nbElements=0;ID=region208;Name=region208
-chr4	S-MART	transcript	10389601	10439600	.	+	.	nbElements=0;ID=region209;Name=region209
-chr4	S-MART	transcript	10439551	10489550	.	+	.	nbElements=0;ID=region210;Name=region210
-chr4	S-MART	transcript	10489501	10539500	.	+	.	nbElements=0;ID=region211;Name=region211
-chr4	S-MART	transcript	10539451	10589450	.	+	.	nbElements=0;ID=region212;Name=region212
-chr4	S-MART	transcript	10589401	10639400	.	+	.	nbElements=0;ID=region213;Name=region213
-chr4	S-MART	transcript	10639351	10689350	.	+	.	nbElements=0;ID=region214;Name=region214
-chr4	S-MART	transcript	10689301	10739300	.	+	.	nbElements=0;ID=region215;Name=region215
-chr4	S-MART	transcript	10739251	10789250	.	+	.	nbElements=0;ID=region216;Name=region216
-chr4	S-MART	transcript	10789201	10839200	.	+	.	nbElements=0;ID=region217;Name=region217
-chr4	S-MART	transcript	10839151	10889150	.	+	.	nbElements=0;ID=region218;Name=region218
-chr4	S-MART	transcript	10889101	10939100	.	+	.	nbElements=0;ID=region219;Name=region219
-chr4	S-MART	transcript	10939051	10989050	.	+	.	nbElements=0;ID=region220;Name=region220
-chr4	S-MART	transcript	10989001	11039000	.	+	.	nbElements=0;ID=region221;Name=region221
-chr4	S-MART	transcript	11038951	11088950	.	+	.	nbElements=0;ID=region222;Name=region222
-chr4	S-MART	transcript	11088901	11138900	.	+	.	nbElements=0;ID=region223;Name=region223
-chr4	S-MART	transcript	11138851	11188850	.	+	.	nbElements=0;ID=region224;Name=region224
-chr4	S-MART	transcript	11188801	11238800	.	+	.	nbElements=0;ID=region225;Name=region225
-chr4	S-MART	transcript	11238751	11288750	.	+	.	nbElements=0;ID=region226;Name=region226
-chr4	S-MART	transcript	11288701	11338700	.	+	.	nbElements=0;ID=region227;Name=region227
-chr4	S-MART	transcript	11338651	11388650	.	+	.	nbElements=0;ID=region228;Name=region228
-chr4	S-MART	transcript	11388601	11438600	.	+	.	nbElements=0;ID=region229;Name=region229
-chr4	S-MART	transcript	11438551	11488550	.	+	.	nbElements=0;ID=region230;Name=region230
-chr4	S-MART	transcript	11488501	11538500	.	+	.	nbElements=0;ID=region231;Name=region231
-chr4	S-MART	transcript	11538451	11588450	.	+	.	nbElements=0;ID=region232;Name=region232
-chr4	S-MART	transcript	11588401	11638400	.	+	.	nbElements=0;ID=region233;Name=region233
-chr4	S-MART	transcript	11638351	11688350	.	+	.	nbElements=0;ID=region234;Name=region234
-chr4	S-MART	transcript	11688301	11738300	.	+	.	nbElements=0;ID=region235;Name=region235
-chr4	S-MART	transcript	11738251	11788250	.	+	.	nbElements=0;ID=region236;Name=region236
-chr4	S-MART	transcript	11788201	11838200	.	+	.	nbElements=0;ID=region237;Name=region237
-chr4	S-MART	transcript	11838151	11888150	.	+	.	nbElements=0;ID=region238;Name=region238
-chr4	S-MART	transcript	11888101	11938100	.	+	.	nbElements=0;ID=region239;Name=region239
-chr4	S-MART	transcript	11938051	11988050	.	+	.	nbElements=0;ID=region240;Name=region240
-chr4	S-MART	transcript	11988001	12038000	.	+	.	nbElements=0;ID=region241;Name=region241
-chr4	S-MART	transcript	12037951	12087950	.	+	.	nbElements=0;ID=region242;Name=region242
-chr4	S-MART	transcript	12087901	12137900	.	+	.	nbElements=0;ID=region243;Name=region243
-chr4	S-MART	transcript	12137851	12187850	.	+	.	nbElements=0;ID=region244;Name=region244
-chr4	S-MART	transcript	12187801	12237800	.	+	.	nbElements=0;ID=region245;Name=region245
-chr4	S-MART	transcript	12237751	12287750	.	+	.	nbElements=0;ID=region246;Name=region246
-chr4	S-MART	transcript	12287701	12337700	.	+	.	nbElements=0;ID=region247;Name=region247
-chr4	S-MART	transcript	12337651	12387650	.	+	.	nbElements=0;ID=region248;Name=region248
-chr4	S-MART	transcript	12387601	12437600	.	+	.	nbElements=0;ID=region249;Name=region249
-chr4	S-MART	transcript	12437551	12487550	.	+	.	nbElements=0;ID=region250;Name=region250
-chr4	S-MART	transcript	12487501	12537500	.	+	.	nbElements=0;ID=region251;Name=region251
-chr4	S-MART	transcript	12537451	12587450	.	+	.	nbElements=0;ID=region252;Name=region252
-chr4	S-MART	transcript	12587401	12637400	.	+	.	nbElements=0;ID=region253;Name=region253
-chr4	S-MART	transcript	12637351	12687350	.	+	.	nbElements=0;ID=region254;Name=region254
-chr4	S-MART	transcript	12687301	12737300	.	+	.	nbElements=0;ID=region255;Name=region255
-chr4	S-MART	transcript	12737251	12787250	.	+	.	nbElements=0;ID=region256;Name=region256
-chr4	S-MART	transcript	12787201	12837200	.	+	.	nbElements=0;ID=region257;Name=region257
-chr4	S-MART	transcript	12837151	12887150	.	+	.	nbElements=0;ID=region258;Name=region258
-chr4	S-MART	transcript	12887101	12937100	.	+	.	nbElements=0;ID=region259;Name=region259
-chr4	S-MART	transcript	12937051	12987050	.	+	.	nbElements=0;ID=region260;Name=region260
-chr4	S-MART	transcript	12987001	13037000	.	+	.	nbElements=0;ID=region261;Name=region261
-chr4	S-MART	transcript	13036951	13086950	.	+	.	nbElements=0;ID=region262;Name=region262
-chr4	S-MART	transcript	13086901	13136900	.	+	.	nbElements=0;ID=region263;Name=region263
-chr4	S-MART	transcript	13136851	13186850	.	+	.	nbElements=0;ID=region264;Name=region264
-chr4	S-MART	transcript	13186801	13236800	.	+	.	nbElements=0;ID=region265;Name=region265
-chr4	S-MART	transcript	13236751	13286750	.	+	.	nbElements=0;ID=region266;Name=region266
-chr4	S-MART	transcript	13286701	13336700	.	+	.	nbElements=0;ID=region267;Name=region267
-chr4	S-MART	transcript	13336651	13386650	.	+	.	nbElements=0;ID=region268;Name=region268
-chr4	S-MART	transcript	13386601	13436600	.	+	.	nbElements=0;ID=region269;Name=region269
-chr4	S-MART	transcript	13436551	13486550	.	+	.	nbElements=0;ID=region270;Name=region270
-chr4	S-MART	transcript	13486501	13536500	.	+	.	nbElements=0;ID=region271;Name=region271
-chr4	S-MART	transcript	13536451	13586450	.	+	.	nbElements=0;ID=region272;Name=region272
-chr4	S-MART	transcript	13586401	13636400	.	+	.	nbElements=0;ID=region273;Name=region273
-chr4	S-MART	transcript	13636351	13686350	.	+	.	nbElements=0;ID=region274;Name=region274
-chr4	S-MART	transcript	13686301	13736300	.	+	.	nbElements=0;ID=region275;Name=region275
-chr4	S-MART	transcript	13736251	13786250	.	+	.	nbElements=0;ID=region276;Name=region276
-chr4	S-MART	transcript	13786201	13836200	.	+	.	nbElements=0;ID=region277;Name=region277
-chr4	S-MART	transcript	13836151	13886150	.	+	.	nbElements=0;ID=region278;Name=region278
-chr4	S-MART	transcript	13886101	13936100	.	+	.	nbElements=0;ID=region279;Name=region279
-chr4	S-MART	transcript	13936051	13986050	.	+	.	nbElements=0;ID=region280;Name=region280
-chr4	S-MART	transcript	13986001	14036000	.	+	.	nbElements=0;ID=region281;Name=region281
-chr4	S-MART	transcript	14035951	14085950	.	+	.	nbElements=0;ID=region282;Name=region282
-chr4	S-MART	transcript	14085901	14135900	.	+	.	nbElements=0;ID=region283;Name=region283
-chr4	S-MART	transcript	14135851	14185850	.	+	.	nbElements=0;ID=region284;Name=region284
-chr4	S-MART	transcript	14185801	14235800	.	+	.	nbElements=0;ID=region285;Name=region285
-chr4	S-MART	transcript	14235751	14285750	.	+	.	nbElements=0;ID=region286;Name=region286
-chr4	S-MART	transcript	14285701	14335700	.	+	.	nbElements=0;ID=region287;Name=region287
-chr4	S-MART	transcript	14335651	14385650	.	+	.	nbElements=0;ID=region288;Name=region288
-chr4	S-MART	transcript	14385601	14435600	.	+	.	nbElements=0;ID=region289;Name=region289
-chr4	S-MART	transcript	14435551	14485550	.	+	.	nbElements=0;ID=region290;Name=region290
-chr4	S-MART	transcript	14485501	14535500	.	+	.	nbElements=0;ID=region291;Name=region291
-chr4	S-MART	transcript	14535451	14585450	.	+	.	nbElements=0;ID=region292;Name=region292
-chr4	S-MART	transcript	14585401	14635400	.	+	.	nbElements=0;ID=region293;Name=region293
-chr4	S-MART	transcript	14635351	14685350	.	+	.	nbElements=0;ID=region294;Name=region294
-chr4	S-MART	transcript	14685301	14735300	.	+	.	nbElements=0;ID=region295;Name=region295
-chr4	S-MART	transcript	14735251	14785250	.	+	.	nbElements=0;ID=region296;Name=region296
-chr4	S-MART	transcript	14785201	14835200	.	+	.	nbElements=0;ID=region297;Name=region297
-chr4	S-MART	transcript	14835151	14885150	.	+	.	nbElements=0;ID=region298;Name=region298
-chr4	S-MART	transcript	14885101	14935100	.	+	.	nbElements=0;ID=region299;Name=region299
-chr4	S-MART	transcript	14935051	14985050	.	+	.	nbElements=0;ID=region300;Name=region300
-chr4	S-MART	transcript	14985001	15035000	.	+	.	nbElements=0;ID=region301;Name=region301
-chr4	S-MART	transcript	15034951	15084950	.	+	.	nbElements=0;ID=region302;Name=region302
-chr4	S-MART	transcript	15084901	15134900	.	+	.	nbElements=0;ID=region303;Name=region303
-chr4	S-MART	transcript	15134851	15184850	.	+	.	nbElements=0;ID=region304;Name=region304
-chr4	S-MART	transcript	15184801	15234800	.	+	.	nbElements=0;ID=region305;Name=region305
-chr4	S-MART	transcript	15234751	15284750	.	+	.	nbElements=0;ID=region306;Name=region306
-chr4	S-MART	transcript	15284701	15334700	.	+	.	nbElements=0;ID=region307;Name=region307
-chr4	S-MART	transcript	15334651	15384650	.	+	.	nbElements=0;ID=region308;Name=region308
-chr4	S-MART	transcript	15384601	15434600	.	+	.	nbElements=0;ID=region309;Name=region309
-chr4	S-MART	transcript	15434551	15484550	.	+	.	nbElements=0;ID=region310;Name=region310
-chr4	S-MART	transcript	15484501	15534500	.	+	.	nbElements=0;ID=region311;Name=region311
-chr4	S-MART	transcript	15534451	15584450	.	+	.	nbElements=0;ID=region312;Name=region312
-chr4	S-MART	transcript	15584401	15634400	.	+	.	nbElements=0;ID=region313;Name=region313
-chr4	S-MART	transcript	15634351	15684350	.	+	.	nbElements=0;ID=region314;Name=region314
-chr4	S-MART	transcript	15684301	15734300	.	+	.	nbElements=0;ID=region315;Name=region315
-chr4	S-MART	transcript	15734251	15784250	.	+	.	nbElements=0;ID=region316;Name=region316
-chr4	S-MART	transcript	15784201	15834200	.	+	.	nbElements=0;ID=region317;Name=region317
-chr4	S-MART	transcript	15834151	15884150	.	+	.	nbElements=0;ID=region318;Name=region318
-chr4	S-MART	transcript	15884101	15934100	.	+	.	nbElements=0;ID=region319;Name=region319
-chr4	S-MART	transcript	15934051	15984050	.	+	.	nbElements=0;ID=region320;Name=region320
-chr4	S-MART	transcript	15984001	16034000	.	+	.	nbElements=0;ID=region321;Name=region321
-chr4	S-MART	transcript	16033951	16083950	.	+	.	nbElements=0;ID=region322;Name=region322
-chr4	S-MART	transcript	16083901	16133900	.	+	.	nbElements=0;ID=region323;Name=region323
-chr4	S-MART	transcript	16133851	16183850	.	+	.	nbElements=0;ID=region324;Name=region324
-chr4	S-MART	transcript	16183801	16233800	.	+	.	nbElements=0;ID=region325;Name=region325
-chr4	S-MART	transcript	16233751	16283750	.	+	.	nbElements=0;ID=region326;Name=region326
-chr4	S-MART	transcript	16283701	16333700	.	+	.	nbElements=0;ID=region327;Name=region327
-chr4	S-MART	transcript	16333651	16383650	.	+	.	nbElements=0;ID=region328;Name=region328
-chr4	S-MART	transcript	16383601	16433600	.	+	.	nbElements=0;ID=region329;Name=region329
-chr4	S-MART	transcript	16433551	16483550	.	+	.	nbElements=0;ID=region330;Name=region330
-chr4	S-MART	transcript	16483501	16533500	.	+	.	nbElements=0;ID=region331;Name=region331
-chr4	S-MART	transcript	16533451	16583450	.	+	.	nbElements=0;ID=region332;Name=region332
-chr4	S-MART	transcript	16583401	16633400	.	+	.	nbElements=0;ID=region333;Name=region333
-chr4	S-MART	transcript	16633351	16683350	.	+	.	nbElements=0;ID=region334;Name=region334
-chr4	S-MART	transcript	16683301	16733300	.	+	.	nbElements=0;ID=region335;Name=region335
-chr4	S-MART	transcript	16733251	16783250	.	+	.	nbElements=0;ID=region336;Name=region336
-chr4	S-MART	transcript	16783201	16833200	.	+	.	nbElements=0;ID=region337;Name=region337
-chr4	S-MART	transcript	16833151	16883150	.	+	.	nbElements=0;ID=region338;Name=region338
-chr4	S-MART	transcript	16883101	16933100	.	+	.	nbElements=0;ID=region339;Name=region339
-chr4	S-MART	transcript	16933051	16983050	.	+	.	nbElements=0;ID=region340;Name=region340
-chr4	S-MART	transcript	16983001	17033000	.	+	.	nbElements=0;ID=region341;Name=region341
-chr4	S-MART	transcript	17032951	17082950	.	+	.	nbElements=0;ID=region342;Name=region342
-chr4	S-MART	transcript	17082901	17132900	.	+	.	nbElements=0;ID=region343;Name=region343
-chr4	S-MART	transcript	17132851	17182850	.	+	.	nbElements=0;ID=region344;Name=region344
-chr4	S-MART	transcript	17182801	17232800	.	+	.	nbElements=0;ID=region345;Name=region345
-chr4	S-MART	transcript	17232751	17282750	.	+	.	nbElements=0;ID=region346;Name=region346
-chr4	S-MART	transcript	17282701	17332700	.	+	.	nbElements=0;ID=region347;Name=region347
-chr4	S-MART	transcript	17332651	17382650	.	+	.	nbElements=0;ID=region348;Name=region348
-chr4	S-MART	transcript	17382601	17432600	.	+	.	nbElements=0;ID=region349;Name=region349
-chr4	S-MART	transcript	17432551	17482550	.	+	.	nbElements=0;ID=region350;Name=region350
-chr4	S-MART	transcript	17482501	17532500	.	+	.	nbElements=0;ID=region351;Name=region351
-chr4	S-MART	transcript	17532451	17582450	.	+	.	nbElements=0;ID=region352;Name=region352
-chr4	S-MART	transcript	17582401	17632400	.	+	.	nbElements=0;ID=region353;Name=region353
-chr4	S-MART	transcript	17632351	17682350	.	+	.	nbElements=0;ID=region354;Name=region354
-chr4	S-MART	transcript	17682301	17732300	.	+	.	nbElements=0;ID=region355;Name=region355
-chr4	S-MART	transcript	17732251	17782250	.	+	.	nbElements=0;ID=region356;Name=region356
-chr4	S-MART	transcript	17782201	17832200	.	+	.	nbElements=0;ID=region357;Name=region357
-chr4	S-MART	transcript	17832151	17882150	.	+	.	nbElements=0;ID=region358;Name=region358
-chr4	S-MART	transcript	17882101	17932100	.	+	.	nbElements=0;ID=region359;Name=region359
-chr4	S-MART	transcript	17932051	17982050	.	+	.	nbElements=0;ID=region360;Name=region360
-chr4	S-MART	transcript	17982001	18032000	.	+	.	nbElements=0;ID=region361;Name=region361
-chr4	S-MART	transcript	18031951	18081950	.	+	.	nbElements=0;ID=region362;Name=region362
-chr4	S-MART	transcript	18081901	18131900	.	+	.	nbElements=0;ID=region363;Name=region363
-chr4	S-MART	transcript	18131851	18181850	.	+	.	nbElements=0;ID=region364;Name=region364
-chr4	S-MART	transcript	18181801	18231800	.	+	.	nbElements=0;ID=region365;Name=region365
-chr4	S-MART	transcript	18231751	18281750	.	+	.	nbElements=0;ID=region366;Name=region366
-chr4	S-MART	transcript	18281701	18331700	.	+	.	nbElements=0;ID=region367;Name=region367
-chr4	S-MART	transcript	18331651	18381650	.	+	.	nbElements=0;ID=region368;Name=region368
-chr4	S-MART	transcript	18381601	18431600	.	+	.	nbElements=0;ID=region369;Name=region369
-chr4	S-MART	transcript	18431551	18481550	.	+	.	nbElements=0;ID=region370;Name=region370
-chr4	S-MART	transcript	18481501	18531500	.	+	.	nbElements=0;ID=region371;Name=region371
-chr4	S-MART	transcript	18531451	18581450	.	+	.	nbElements=0;ID=region372;Name=region372
-chr4	S-MART	transcript	18581401	18631400	.	+	.	nbElements=0;ID=region373;Name=region373
-chr4	S-MART	transcript	18631351	18681350	.	+	.	nbElements=0;ID=region374;Name=region374
-chr4	S-MART	transcript	18681301	18731300	.	+	.	nbElements=0;ID=region375;Name=region375
-chr4	S-MART	transcript	18731251	18781250	.	+	.	nbElements=0;ID=region376;Name=region376
-chr4	S-MART	transcript	18781201	18831200	.	+	.	nbElements=0;ID=region377;Name=region377
-chr4	S-MART	transcript	18831151	18881150	.	+	.	nbElements=0;ID=region378;Name=region378
-chr4	S-MART	transcript	18881101	18931100	.	+	.	nbElements=0;ID=region379;Name=region379
-chr4	S-MART	transcript	18931051	18981050	.	+	.	nbElements=0;ID=region380;Name=region380
-chr4	S-MART	transcript	18981001	19031000	.	+	.	nbElements=0;ID=region381;Name=region381
-chr4	S-MART	transcript	19030951	19080950	.	+	.	nbElements=0;ID=region382;Name=region382
-chr4	S-MART	transcript	19080901	19130900	.	+	.	nbElements=0;ID=region383;Name=region383
-chr4	S-MART	transcript	19130851	19180850	.	+	.	nbElements=0;ID=region384;Name=region384
-chr4	S-MART	transcript	19180801	19230800	.	+	.	nbElements=0;ID=region385;Name=region385
-chr4	S-MART	transcript	19230751	19280750	.	+	.	nbElements=0;ID=region386;Name=region386
-chr4	S-MART	transcript	19280701	19330700	.	+	.	nbElements=0;ID=region387;Name=region387
-chr4	S-MART	transcript	19330651	19380650	.	+	.	nbElements=0;ID=region388;Name=region388
-chr4	S-MART	transcript	19380601	19430600	.	+	.	nbElements=0;ID=region389;Name=region389
-chr4	S-MART	transcript	19430551	19480550	.	+	.	nbElements=0;ID=region390;Name=region390
-chr4	S-MART	transcript	19480501	19530500	.	+	.	nbElements=0;ID=region391;Name=region391
-chr4	S-MART	transcript	19530451	19580450	.	+	.	nbElements=0;ID=region392;Name=region392
-chr4	S-MART	transcript	19580401	19630400	.	+	.	nbElements=0;ID=region393;Name=region393
-chr4	S-MART	transcript	19630351	19680350	.	+	.	nbElements=0;ID=region394;Name=region394
-chr4	S-MART	transcript	19680301	19730300	.	+	.	nbElements=0;ID=region395;Name=region395
-chr4	S-MART	transcript	19730251	19780250	.	+	.	nbElements=0;ID=region396;Name=region396
-chr4	S-MART	transcript	19780201	19830200	.	+	.	nbElements=0;ID=region397;Name=region397
-chr4	S-MART	transcript	19830151	19880150	.	+	.	nbElements=0;ID=region398;Name=region398
-chr4	S-MART	transcript	19880101	19930100	.	+	.	nbElements=0;ID=region399;Name=region399
-chr4	S-MART	transcript	19930051	19980050	.	+	.	nbElements=0;ID=region400;Name=region400
-chr4	S-MART	transcript	19980001	20030000	.	+	.	nbElements=0;ID=region401;Name=region401
-chr4	S-MART	transcript	20029951	20079950	.	+	.	nbElements=0;ID=region402;Name=region402
-chr4	S-MART	transcript	20079901	20129900	.	+	.	nbElements=0;ID=region403;Name=region403
-chr4	S-MART	transcript	20129851	20179850	.	+	.	nbElements=0;ID=region404;Name=region404
-chr4	S-MART	transcript	20179801	20229800	.	+	.	nbElements=0;ID=region405;Name=region405
-chr4	S-MART	transcript	20229751	20279750	.	+	.	nbElements=0;ID=region406;Name=region406
-chr4	S-MART	transcript	20279701	20329700	.	+	.	nbElements=0;ID=region407;Name=region407
-chr4	S-MART	transcript	20329651	20379650	.	+	.	nbElements=0;ID=region408;Name=region408
-chr4	S-MART	transcript	20379601	20429600	.	+	.	nbElements=0;ID=region409;Name=region409
-chr4	S-MART	transcript	20429551	20479550	.	+	.	nbElements=0;ID=region410;Name=region410
-chr4	S-MART	transcript	20479501	20529500	.	+	.	nbElements=0;ID=region411;Name=region411
-chr4	S-MART	transcript	20529451	20579450	.	+	.	nbElements=0;ID=region412;Name=region412
-chr4	S-MART	transcript	20579401	20629400	.	+	.	nbElements=0;ID=region413;Name=region413
-chr4	S-MART	transcript	20629351	20679350	.	+	.	nbElements=0;ID=region414;Name=region414
-chr4	S-MART	transcript	20679301	20729300	.	+	.	nbElements=0;ID=region415;Name=region415
-chr4	S-MART	transcript	20729251	20779250	.	+	.	nbElements=0;ID=region416;Name=region416
-chr4	S-MART	transcript	20779201	20829200	.	+	.	nbElements=0;ID=region417;Name=region417
-chr4	S-MART	transcript	20829151	20879150	.	+	.	nbElements=0;ID=region418;Name=region418
-chr4	S-MART	transcript	20879101	20929100	.	+	.	nbElements=0;ID=region419;Name=region419
-chr4	S-MART	transcript	20929051	20979050	.	+	.	nbElements=0;ID=region420;Name=region420
-chr4	S-MART	transcript	20979001	21029000	.	+	.	nbElements=0;ID=region421;Name=region421
-chr4	S-MART	transcript	21028951	21078950	.	+	.	nbElements=0;ID=region422;Name=region422
-chr4	S-MART	transcript	21078901	21128900	.	+	.	nbElements=0;ID=region423;Name=region423
-chr4	S-MART	transcript	21128851	21178850	.	+	.	nbElements=0;ID=region424;Name=region424
-chr4	S-MART	transcript	21178801	21228800	.	+	.	nbElements=0;ID=region425;Name=region425
-chr4	S-MART	transcript	21228751	21278750	.	+	.	nbElements=0;ID=region426;Name=region426
-chr4	S-MART	transcript	21278701	21328700	.	+	.	nbElements=0;ID=region427;Name=region427
-chr4	S-MART	transcript	21328651	21378650	.	+	.	nbElements=0;ID=region428;Name=region428
-chr4	S-MART	transcript	21378601	21428600	.	+	.	nbElements=0;ID=region429;Name=region429
-chr4	S-MART	transcript	21428551	21478550	.	+	.	nbElements=0;ID=region430;Name=region430
-chr4	S-MART	transcript	21478501	21528500	.	+	.	nbElements=0;ID=region431;Name=region431
-chr4	S-MART	transcript	21528451	21578450	.	+	.	nbElements=0;ID=region432;Name=region432
-chr4	S-MART	transcript	21578401	21628400	.	+	.	nbElements=0;ID=region433;Name=region433
-chr4	S-MART	transcript	21628351	21678350	.	+	.	nbElements=0;ID=region434;Name=region434
-chr4	S-MART	transcript	21678301	21728300	.	+	.	nbElements=0;ID=region435;Name=region435
-chr4	S-MART	transcript	21728251	21778250	.	+	.	nbElements=0;ID=region436;Name=region436
-chr4	S-MART	transcript	21778201	21828200	.	+	.	nbElements=0;ID=region437;Name=region437
-chr4	S-MART	transcript	21828151	21878150	.	+	.	nbElements=0;ID=region438;Name=region438
-chr4	S-MART	transcript	21878101	21928100	.	+	.	nbElements=0;ID=region439;Name=region439
-chr4	S-MART	transcript	21928051	21978050	.	+	.	nbElements=0;ID=region440;Name=region440
-chr4	S-MART	transcript	21978001	22028000	.	+	.	nbElements=0;ID=region441;Name=region441
-chr4	S-MART	transcript	22027951	22077950	.	+	.	nbElements=0;ID=region442;Name=region442
-chr4	S-MART	transcript	22077901	22127900	.	+	.	nbElements=0;ID=region443;Name=region443
-chr4	S-MART	transcript	22127851	22177850	.	+	.	nbElements=0;ID=region444;Name=region444
-chr4	S-MART	transcript	22177801	22227800	.	+	.	nbElements=0;ID=region445;Name=region445
-chr4	S-MART	transcript	22227751	22277750	.	+	.	nbElements=0;ID=region446;Name=region446
-chr4	S-MART	transcript	22277701	22327700	.	+	.	nbElements=0;ID=region447;Name=region447
-chr4	S-MART	transcript	22327651	22377650	.	+	.	nbElements=0;ID=region448;Name=region448
-chr4	S-MART	transcript	22377601	22427600	.	+	.	nbElements=0;ID=region449;Name=region449
-chr4	S-MART	transcript	22427551	22477550	.	+	.	nbElements=0;ID=region450;Name=region450
-chr4	S-MART	transcript	22477501	22527500	.	+	.	nbElements=0;ID=region451;Name=region451
-chr4	S-MART	transcript	22527451	22577450	.	+	.	nbElements=0;ID=region452;Name=region452
-chr4	S-MART	transcript	22577401	22627400	.	+	.	nbElements=0;ID=region453;Name=region453
-chr4	S-MART	transcript	22627351	22677350	.	+	.	nbElements=0;ID=region454;Name=region454
-chr4	S-MART	transcript	22677301	22727300	.	+	.	nbElements=0;ID=region455;Name=region455
-chr4	S-MART	transcript	22727251	22777250	.	+	.	nbElements=0;ID=region456;Name=region456
-chr4	S-MART	transcript	22777201	22827200	.	+	.	nbElements=0;ID=region457;Name=region457
-chr4	S-MART	transcript	22827151	22877150	.	+	.	nbElements=0;ID=region458;Name=region458
-chr4	S-MART	transcript	22877101	22927100	.	+	.	nbElements=0;ID=region459;Name=region459
-chr4	S-MART	transcript	22927051	22977050	.	+	.	nbElements=0;ID=region460;Name=region460
-chr4	S-MART	transcript	22977001	23027000	.	+	.	nbElements=0;ID=region461;Name=region461
-chr4	S-MART	transcript	23026951	23076950	.	+	.	nbElements=0;ID=region462;Name=region462
-chr4	S-MART	transcript	23076901	23126900	.	+	.	nbElements=0;ID=region463;Name=region463
-chr4	S-MART	transcript	23126851	23176850	.	+	.	nbElements=0;ID=region464;Name=region464
-chr4	S-MART	transcript	23176801	23226800	.	+	.	nbElements=0;ID=region465;Name=region465
-chr4	S-MART	transcript	23226751	23276750	.	+	.	nbElements=0;ID=region466;Name=region466
-chr4	S-MART	transcript	23276701	23326700	.	+	.	nbElements=0;ID=region467;Name=region467
-chr4	S-MART	transcript	23326651	23376650	.	+	.	nbElements=0;ID=region468;Name=region468
-chr4	S-MART	transcript	23376601	23426600	.	+	.	nbElements=0;ID=region469;Name=region469
-chr4	S-MART	transcript	23426551	23476550	.	+	.	nbElements=0;ID=region470;Name=region470
-chr4	S-MART	transcript	23476501	23526500	.	+	.	nbElements=0;ID=region471;Name=region471
-chr4	S-MART	transcript	23526451	23576450	.	+	.	nbElements=0;ID=region472;Name=region472
-chr4	S-MART	transcript	23576401	23626400	.	+	.	nbElements=0;ID=region473;Name=region473
-chr4	S-MART	transcript	23626351	23676350	.	+	.	nbElements=0;ID=region474;Name=region474
-chr4	S-MART	transcript	23676301	23726300	.	+	.	nbElements=0;ID=region475;Name=region475
-chr4	S-MART	transcript	23726251	23776250	.	+	.	nbElements=0;ID=region476;Name=region476
-chr4	S-MART	transcript	23776201	23826200	.	+	.	nbElements=0;ID=region477;Name=region477
-chr4	S-MART	transcript	23826151	23876150	.	+	.	nbElements=0;ID=region478;Name=region478
-chr4	S-MART	transcript	23876101	23926100	.	+	.	nbElements=0;ID=region479;Name=region479
-chr4	S-MART	transcript	23926051	23976050	.	+	.	nbElements=0;ID=region480;Name=region480
-chr4	S-MART	transcript	23976001	24026000	.	+	.	nbElements=0;ID=region481;Name=region481
-chr4	S-MART	transcript	24025951	24075950	.	+	.	nbElements=0;ID=region482;Name=region482
-chr4	S-MART	transcript	24075901	24125900	.	+	.	nbElements=0;ID=region483;Name=region483
-chr4	S-MART	transcript	24125851	24175850	.	+	.	nbElements=0;ID=region484;Name=region484
-chr4	S-MART	transcript	24175801	24225800	.	+	.	nbElements=0;ID=region485;Name=region485
-chr4	S-MART	transcript	24225751	24275750	.	+	.	nbElements=0;ID=region486;Name=region486
-chr4	S-MART	transcript	24275701	24325700	.	+	.	nbElements=0;ID=region487;Name=region487
-chr4	S-MART	transcript	24325651	24375650	.	+	.	nbElements=0;ID=region488;Name=region488
-chr4	S-MART	transcript	24375601	24425600	.	+	.	nbElements=0;ID=region489;Name=region489
-chr4	S-MART	transcript	24425551	24475550	.	+	.	nbElements=0;ID=region490;Name=region490
-chr4	S-MART	transcript	24475501	24525500	.	+	.	nbElements=0;ID=region491;Name=region491
-chr4	S-MART	transcript	24525451	24575450	.	+	.	nbElements=0;ID=region492;Name=region492
-chr4	S-MART	transcript	24575401	24625400	.	+	.	nbElements=0;ID=region493;Name=region493
-chr4	S-MART	transcript	24625351	24675350	.	+	.	nbElements=0;ID=region494;Name=region494
-chr4	S-MART	transcript	24675301	24725300	.	+	.	nbElements=0;ID=region495;Name=region495
-chr4	S-MART	transcript	24725251	24775250	.	+	.	nbElements=0;ID=region496;Name=region496
-chr4	S-MART	transcript	24775201	24825200	.	+	.	nbElements=0;ID=region497;Name=region497
-chr4	S-MART	transcript	24825151	24875150	.	+	.	nbElements=0;ID=region498;Name=region498
-chr4	S-MART	transcript	24875101	24925100	.	+	.	nbElements=0;ID=region499;Name=region499
-chr4	S-MART	transcript	24925051	24975050	.	+	.	nbElements=0;ID=region500;Name=region500
-chr4	S-MART	transcript	24975001	25025000	.	+	.	nbElements=0;ID=region501;Name=region501
-chr4	S-MART	transcript	25024951	25074950	.	+	.	nbElements=0;ID=region502;Name=region502
-chr4	S-MART	transcript	25074901	25124900	.	+	.	nbElements=0;ID=region503;Name=region503
-chr4	S-MART	transcript	25124851	25174850	.	+	.	nbElements=0;ID=region504;Name=region504
-chr4	S-MART	transcript	25174801	25224800	.	+	.	nbElements=0;ID=region505;Name=region505
-chr4	S-MART	transcript	25224751	25274750	.	+	.	nbElements=0;ID=region506;Name=region506
-chr4	S-MART	transcript	25274701	25324700	.	+	.	nbElements=0;ID=region507;Name=region507
-chr4	S-MART	transcript	25324651	25374650	.	+	.	nbElements=0;ID=region508;Name=region508
-chr4	S-MART	transcript	25374601	25424600	.	+	.	nbElements=0;ID=region509;Name=region509
-chr4	S-MART	transcript	25424551	25474550	.	+	.	nbElements=0;ID=region510;Name=region510
-chr4	S-MART	transcript	25474501	25524500	.	+	.	nbElements=0;ID=region511;Name=region511
-chr4	S-MART	transcript	25524451	25574450	.	+	.	nbElements=0;ID=region512;Name=region512
-chr4	S-MART	transcript	25574401	25624400	.	+	.	nbElements=0;ID=region513;Name=region513
-chr4	S-MART	transcript	25624351	25674350	.	+	.	nbElements=0;ID=region514;Name=region514
-chr4	S-MART	transcript	25674301	25724300	.	+	.	nbElements=0;ID=region515;Name=region515
-chr4	S-MART	transcript	25724251	25774250	.	+	.	nbElements=0;ID=region516;Name=region516
-chr4	S-MART	transcript	25774201	25824200	.	+	.	nbElements=0;ID=region517;Name=region517
-chr4	S-MART	transcript	25824151	25874150	.	+	.	nbElements=0;ID=region518;Name=region518
-chr4	S-MART	transcript	25874101	25924100	.	+	.	nbElements=0;ID=region519;Name=region519
-chr4	S-MART	transcript	25924051	25974050	.	+	.	nbElements=0;ID=region520;Name=region520
-chr4	S-MART	transcript	25974001	26024000	.	+	.	nbElements=0;ID=region521;Name=region521
-chr4	S-MART	transcript	26023951	26073950	.	+	.	nbElements=0;ID=region522;Name=region522
-chr4	S-MART	transcript	26073901	26123900	.	+	.	nbElements=0;ID=region523;Name=region523
-chr4	S-MART	transcript	26123851	26173850	.	+	.	nbElements=0;ID=region524;Name=region524
-chr4	S-MART	transcript	26173801	26223800	.	+	.	nbElements=0;ID=region525;Name=region525
-chr4	S-MART	transcript	26223751	26273750	.	+	.	nbElements=0;ID=region526;Name=region526
-chr4	S-MART	transcript	26273701	26323700	.	+	.	nbElements=0;ID=region527;Name=region527
-chr4	S-MART	transcript	26323651	26373650	.	+	.	nbElements=0;ID=region528;Name=region528
-chr4	S-MART	transcript	26373601	26423600	.	+	.	nbElements=0;ID=region529;Name=region529
-chr4	S-MART	transcript	26423551	26473550	.	+	.	nbElements=0;ID=region530;Name=region530
-chr4	S-MART	transcript	26473501	26523500	.	+	.	nbElements=0;ID=region531;Name=region531
-chr4	S-MART	transcript	26523451	26573450	.	+	.	nbElements=0;ID=region532;Name=region532
-chr4	S-MART	transcript	26573401	26623400	.	+	.	nbElements=0;ID=region533;Name=region533
-chr4	S-MART	transcript	26623351	26673350	.	+	.	nbElements=0;ID=region534;Name=region534
-chr4	S-MART	transcript	26673301	26723300	.	+	.	nbElements=0;ID=region535;Name=region535
-chr4	S-MART	transcript	26723251	26773250	.	+	.	nbElements=0;ID=region536;Name=region536
-chr4	S-MART	transcript	26773201	26823200	.	+	.	nbElements=0;ID=region537;Name=region537
-chr4	S-MART	transcript	26823151	26873150	.	+	.	nbElements=0;ID=region538;Name=region538
-chr4	S-MART	transcript	26873101	26923100	.	+	.	nbElements=0;ID=region539;Name=region539
-chr4	S-MART	transcript	26923051	26973050	.	+	.	nbElements=0;ID=region540;Name=region540
-chr4	S-MART	transcript	26973001	27023000	.	+	.	nbElements=0;ID=region541;Name=region541
-chr4	S-MART	transcript	27022951	27072950	.	+	.	nbElements=0;ID=region542;Name=region542
-chr4	S-MART	transcript	27072901	27122900	.	+	.	nbElements=0;ID=region543;Name=region543
-chr4	S-MART	transcript	27122851	27172850	.	+	.	nbElements=0;ID=region544;Name=region544
-chr4	S-MART	transcript	27172801	27222800	.	+	.	nbElements=0;ID=region545;Name=region545
-chr4	S-MART	transcript	27222751	27272750	.	+	.	nbElements=0;ID=region546;Name=region546
-chr4	S-MART	transcript	27272701	27322700	.	+	.	nbElements=0;ID=region547;Name=region547
-chr4	S-MART	transcript	27322651	27372650	.	+	.	nbElements=0;ID=region548;Name=region548
-chr4	S-MART	transcript	27372601	27422600	.	+	.	nbElements=0;ID=region549;Name=region549
-chr4	S-MART	transcript	27422551	27472550	.	+	.	nbElements=0;ID=region550;Name=region550
-chr4	S-MART	transcript	27472501	27522500	.	+	.	nbElements=0;ID=region551;Name=region551
-chr4	S-MART	transcript	27522451	27572450	.	+	.	nbElements=0;ID=region552;Name=region552
-chr4	S-MART	transcript	27572401	27622400	.	+	.	nbElements=0;ID=region553;Name=region553
-chr4	S-MART	transcript	27622351	27672350	.	+	.	nbElements=0;ID=region554;Name=region554
-chr4	S-MART	transcript	27672301	27722300	.	+	.	nbElements=0;ID=region555;Name=region555
-chr4	S-MART	transcript	27722251	27772250	.	+	.	nbElements=0;ID=region556;Name=region556
-chr4	S-MART	transcript	27772201	27822200	.	+	.	nbElements=0;ID=region557;Name=region557
-chr4	S-MART	transcript	27822151	27872150	.	+	.	nbElements=0;ID=region558;Name=region558
-chr4	S-MART	transcript	27872101	27922100	.	+	.	nbElements=0;ID=region559;Name=region559
-chr4	S-MART	transcript	27922051	27972050	.	+	.	nbElements=0;ID=region560;Name=region560
-chr4	S-MART	transcript	27972001	28022000	.	+	.	nbElements=0;ID=region561;Name=region561
-chr4	S-MART	transcript	28021951	28071950	.	+	.	nbElements=0;ID=region562;Name=region562
-chr4	S-MART	transcript	28071901	28121900	.	+	.	nbElements=0;ID=region563;Name=region563
-chr4	S-MART	transcript	28121851	28171850	.	+	.	nbElements=0;ID=region564;Name=region564
-chr4	S-MART	transcript	28171801	28221800	.	+	.	nbElements=0;ID=region565;Name=region565
-chr4	S-MART	transcript	28221751	28271750	.	+	.	nbElements=0;ID=region566;Name=region566
-chr4	S-MART	transcript	28271701	28321700	.	+	.	nbElements=0;ID=region567;Name=region567
-chr4	S-MART	transcript	28321651	28371650	.	+	.	nbElements=0;ID=region568;Name=region568
-chr4	S-MART	transcript	28371601	28421600	.	+	.	nbElements=0;ID=region569;Name=region569
-chr4	S-MART	transcript	28421551	28471550	.	+	.	nbElements=0;ID=region570;Name=region570
-chr4	S-MART	transcript	28471501	28521500	.	+	.	nbElements=0;ID=region571;Name=region571
-chr4	S-MART	transcript	28521451	28571450	.	+	.	nbElements=0.333333333333;ID=region572;Name=region572
-chr3	S-MART	transcript	1	50000	.	+	.	nbElements=0;ID=region573;Name=region573
-chr3	S-MART	transcript	49951	99950	.	+	.	nbElements=0;ID=region574;Name=region574
-chr3	S-MART	transcript	99901	149900	.	+	.	nbElements=0;ID=region575;Name=region575
-chr3	S-MART	transcript	149851	199850	.	+	.	nbElements=0;ID=region576;Name=region576
-chr3	S-MART	transcript	199801	249800	.	+	.	nbElements=0;ID=region577;Name=region577
-chr3	S-MART	transcript	249751	299750	.	+	.	nbElements=0;ID=region578;Name=region578
-chr3	S-MART	transcript	299701	349700	.	+	.	nbElements=0;ID=region579;Name=region579
-chr3	S-MART	transcript	349651	399650	.	+	.	nbElements=0;ID=region580;Name=region580
-chr3	S-MART	transcript	399601	449600	.	+	.	nbElements=0;ID=region581;Name=region581
-chr3	S-MART	transcript	449551	499550	.	+	.	nbElements=0;ID=region582;Name=region582
-chr3	S-MART	transcript	499501	549500	.	+	.	nbElements=0;ID=region583;Name=region583
-chr3	S-MART	transcript	549451	599450	.	+	.	nbElements=0;ID=region584;Name=region584
-chr3	S-MART	transcript	599401	649400	.	+	.	nbElements=0;ID=region585;Name=region585
-chr3	S-MART	transcript	649351	699350	.	+	.	nbElements=0;ID=region586;Name=region586
-chr3	S-MART	transcript	699301	749300	.	+	.	nbElements=0;ID=region587;Name=region587
-chr3	S-MART	transcript	749251	799250	.	+	.	nbElements=0;ID=region588;Name=region588
-chr3	S-MART	transcript	799201	849200	.	+	.	nbElements=0;ID=region589;Name=region589
-chr3	S-MART	transcript	849151	899150	.	+	.	nbElements=0;ID=region590;Name=region590
-chr3	S-MART	transcript	899101	949100	.	+	.	nbElements=0;ID=region591;Name=region591
-chr3	S-MART	transcript	949051	999050	.	+	.	nbElements=0;ID=region592;Name=region592
-chr3	S-MART	transcript	999001	1049000	.	+	.	nbElements=0;ID=region593;Name=region593
-chr3	S-MART	transcript	1048951	1098950	.	+	.	nbElements=0;ID=region594;Name=region594
-chr3	S-MART	transcript	1098901	1148900	.	+	.	nbElements=0;ID=region595;Name=region595
-chr3	S-MART	transcript	1148851	1198850	.	+	.	nbElements=0;ID=region596;Name=region596
-chr3	S-MART	transcript	1198801	1248800	.	+	.	nbElements=0;ID=region597;Name=region597
-chr3	S-MART	transcript	1248751	1298750	.	+	.	nbElements=0;ID=region598;Name=region598
-chr3	S-MART	transcript	1298701	1348700	.	+	.	nbElements=0;ID=region599;Name=region599
-chr3	S-MART	transcript	1348651	1398650	.	+	.	nbElements=0;ID=region600;Name=region600
-chr3	S-MART	transcript	1398601	1448600	.	+	.	nbElements=0;ID=region601;Name=region601
-chr3	S-MART	transcript	1448551	1498550	.	+	.	nbElements=0;ID=region602;Name=region602
-chr3	S-MART	transcript	1498501	1548500	.	+	.	nbElements=0;ID=region603;Name=region603
-chr3	S-MART	transcript	1548451	1598450	.	+	.	nbElements=0;ID=region604;Name=region604
-chr3	S-MART	transcript	1598401	1648400	.	+	.	nbElements=0;ID=region605;Name=region605
-chr3	S-MART	transcript	1648351	1698350	.	+	.	nbElements=0;ID=region606;Name=region606
-chr3	S-MART	transcript	1698301	1748300	.	+	.	nbElements=0;ID=region607;Name=region607
-chr3	S-MART	transcript	1748251	1798250	.	+	.	nbElements=0;ID=region608;Name=region608
-chr3	S-MART	transcript	1798201	1848200	.	+	.	nbElements=0;ID=region609;Name=region609
-chr3	S-MART	transcript	1848151	1898150	.	+	.	nbElements=0;ID=region610;Name=region610
-chr3	S-MART	transcript	1898101	1948100	.	+	.	nbElements=0;ID=region611;Name=region611
-chr3	S-MART	transcript	1948051	1998050	.	+	.	nbElements=0;ID=region612;Name=region612
-chr3	S-MART	transcript	1998001	2048000	.	+	.	nbElements=0;ID=region613;Name=region613
-chr3	S-MART	transcript	2047951	2097950	.	+	.	nbElements=0;ID=region614;Name=region614
-chr3	S-MART	transcript	2097901	2147900	.	+	.	nbElements=0;ID=region615;Name=region615
-chr3	S-MART	transcript	2147851	2197850	.	+	.	nbElements=0;ID=region616;Name=region616
-chr3	S-MART	transcript	2197801	2247800	.	+	.	nbElements=0;ID=region617;Name=region617
-chr3	S-MART	transcript	2247751	2297750	.	+	.	nbElements=0;ID=region618;Name=region618
-chr3	S-MART	transcript	2297701	2347700	.	+	.	nbElements=0;ID=region619;Name=region619
-chr3	S-MART	transcript	2347651	2397650	.	+	.	nbElements=0;ID=region620;Name=region620
-chr3	S-MART	transcript	2397601	2447600	.	+	.	nbElements=0;ID=region621;Name=region621
-chr3	S-MART	transcript	2447551	2497550	.	+	.	nbElements=0;ID=region622;Name=region622
-chr3	S-MART	transcript	2497501	2547500	.	+	.	nbElements=0;ID=region623;Name=region623
-chr3	S-MART	transcript	2547451	2597450	.	+	.	nbElements=0;ID=region624;Name=region624
-chr3	S-MART	transcript	2597401	2647400	.	+	.	nbElements=0;ID=region625;Name=region625
-chr3	S-MART	transcript	2647351	2697350	.	+	.	nbElements=0;ID=region626;Name=region626
-chr3	S-MART	transcript	2697301	2747300	.	+	.	nbElements=0;ID=region627;Name=region627
-chr3	S-MART	transcript	2747251	2797250	.	+	.	nbElements=0;ID=region628;Name=region628
-chr3	S-MART	transcript	2797201	2847200	.	+	.	nbElements=0;ID=region629;Name=region629
-chr3	S-MART	transcript	2847151	2897150	.	+	.	nbElements=0;ID=region630;Name=region630
-chr3	S-MART	transcript	2897101	2947100	.	+	.	nbElements=0;ID=region631;Name=region631
-chr3	S-MART	transcript	2947051	2997050	.	+	.	nbElements=0;ID=region632;Name=region632
-chr3	S-MART	transcript	2997001	3047000	.	+	.	nbElements=0;ID=region633;Name=region633
-chr3	S-MART	transcript	3046951	3096950	.	+	.	nbElements=0;ID=region634;Name=region634
-chr3	S-MART	transcript	3096901	3146900	.	+	.	nbElements=0;ID=region635;Name=region635
-chr3	S-MART	transcript	3146851	3196850	.	+	.	nbElements=0;ID=region636;Name=region636
-chr3	S-MART	transcript	3196801	3246800	.	+	.	nbElements=0;ID=region637;Name=region637
-chr3	S-MART	transcript	3246751	3296750	.	+	.	nbElements=0;ID=region638;Name=region638
-chr3	S-MART	transcript	3296701	3346700	.	+	.	nbElements=0;ID=region639;Name=region639
-chr3	S-MART	transcript	3346651	3396650	.	+	.	nbElements=0;ID=region640;Name=region640
-chr3	S-MART	transcript	3396601	3446600	.	+	.	nbElements=0;ID=region641;Name=region641
-chr3	S-MART	transcript	3446551	3496550	.	+	.	nbElements=0;ID=region642;Name=region642
-chr3	S-MART	transcript	3496501	3546500	.	+	.	nbElements=0;ID=region643;Name=region643
-chr3	S-MART	transcript	3546451	3596450	.	+	.	nbElements=0;ID=region644;Name=region644
-chr3	S-MART	transcript	3596401	3646400	.	+	.	nbElements=0;ID=region645;Name=region645
-chr3	S-MART	transcript	3646351	3696350	.	+	.	nbElements=0;ID=region646;Name=region646
-chr3	S-MART	transcript	3696301	3746300	.	+	.	nbElements=0;ID=region647;Name=region647
-chr3	S-MART	transcript	3746251	3796250	.	+	.	nbElements=0;ID=region648;Name=region648
-chr3	S-MART	transcript	3796201	3846200	.	+	.	nbElements=0;ID=region649;Name=region649
-chr3	S-MART	transcript	3846151	3896150	.	+	.	nbElements=0;ID=region650;Name=region650
-chr3	S-MART	transcript	3896101	3946100	.	+	.	nbElements=0;ID=region651;Name=region651
-chr3	S-MART	transcript	3946051	3996050	.	+	.	nbElements=0;ID=region652;Name=region652
-chr3	S-MART	transcript	3996001	4046000	.	+	.	nbElements=0;ID=region653;Name=region653
-chr3	S-MART	transcript	4045951	4095950	.	+	.	nbElements=0;ID=region654;Name=region654
-chr3	S-MART	transcript	4095901	4145900	.	+	.	nbElements=0;ID=region655;Name=region655
-chr3	S-MART	transcript	4145851	4195850	.	+	.	nbElements=0;ID=region656;Name=region656
-chr3	S-MART	transcript	4195801	4245800	.	+	.	nbElements=0;ID=region657;Name=region657
-chr3	S-MART	transcript	4245751	4295750	.	+	.	nbElements=0;ID=region658;Name=region658
-chr3	S-MART	transcript	4295701	4345700	.	+	.	nbElements=0;ID=region659;Name=region659
-chr3	S-MART	transcript	4345651	4395650	.	+	.	nbElements=0;ID=region660;Name=region660
-chr3	S-MART	transcript	4395601	4445600	.	+	.	nbElements=0;ID=region661;Name=region661
-chr3	S-MART	transcript	4445551	4495550	.	+	.	nbElements=0;ID=region662;Name=region662
-chr3	S-MART	transcript	4495501	4545500	.	+	.	nbElements=0;ID=region663;Name=region663
-chr3	S-MART	transcript	4545451	4595450	.	+	.	nbElements=0;ID=region664;Name=region664
-chr3	S-MART	transcript	4595401	4645400	.	+	.	nbElements=0;ID=region665;Name=region665
-chr3	S-MART	transcript	4645351	4695350	.	+	.	nbElements=0;ID=region666;Name=region666
-chr3	S-MART	transcript	4695301	4745300	.	+	.	nbElements=0;ID=region667;Name=region667
-chr3	S-MART	transcript	4745251	4795250	.	+	.	nbElements=0;ID=region668;Name=region668
-chr3	S-MART	transcript	4795201	4845200	.	+	.	nbElements=0;ID=region669;Name=region669
-chr3	S-MART	transcript	4845151	4895150	.	+	.	nbElements=0;ID=region670;Name=region670
-chr3	S-MART	transcript	4895101	4945100	.	+	.	nbElements=0;ID=region671;Name=region671
-chr3	S-MART	transcript	4945051	4995050	.	+	.	nbElements=0;ID=region672;Name=region672
-chr3	S-MART	transcript	4995001	5045000	.	+	.	nbElements=0;ID=region673;Name=region673
-chr3	S-MART	transcript	5044951	5094950	.	+	.	nbElements=0;ID=region674;Name=region674
-chr3	S-MART	transcript	5094901	5144900	.	+	.	nbElements=0;ID=region675;Name=region675
-chr3	S-MART	transcript	5144851	5194850	.	+	.	nbElements=0;ID=region676;Name=region676
-chr3	S-MART	transcript	5194801	5244800	.	+	.	nbElements=0;ID=region677;Name=region677
-chr3	S-MART	transcript	5244751	5294750	.	+	.	nbElements=0;ID=region678;Name=region678
-chr3	S-MART	transcript	5294701	5344700	.	+	.	nbElements=0;ID=region679;Name=region679
-chr3	S-MART	transcript	5344651	5394650	.	+	.	nbElements=0;ID=region680;Name=region680
-chr3	S-MART	transcript	5394601	5444600	.	+	.	nbElements=0;ID=region681;Name=region681
-chr3	S-MART	transcript	5444551	5494550	.	+	.	nbElements=0;ID=region682;Name=region682
-chr3	S-MART	transcript	5494501	5544500	.	+	.	nbElements=0;ID=region683;Name=region683
-chr3	S-MART	transcript	5544451	5594450	.	+	.	nbElements=0;ID=region684;Name=region684
-chr3	S-MART	transcript	5594401	5644400	.	+	.	nbElements=0;ID=region685;Name=region685
-chr3	S-MART	transcript	5644351	5694350	.	+	.	nbElements=0;ID=region686;Name=region686
-chr3	S-MART	transcript	5694301	5744300	.	+	.	nbElements=0;ID=region687;Name=region687
-chr3	S-MART	transcript	5744251	5794250	.	+	.	nbElements=0;ID=region688;Name=region688
-chr3	S-MART	transcript	5794201	5844200	.	+	.	nbElements=0;ID=region689;Name=region689
-chr3	S-MART	transcript	5844151	5894150	.	+	.	nbElements=0;ID=region690;Name=region690
-chr3	S-MART	transcript	5894101	5944100	.	+	.	nbElements=0;ID=region691;Name=region691
-chr3	S-MART	transcript	5944051	5994050	.	+	.	nbElements=0;ID=region692;Name=region692
-chr3	S-MART	transcript	5994001	6044000	.	+	.	nbElements=0;ID=region693;Name=region693
-chr3	S-MART	transcript	6043951	6093950	.	+	.	nbElements=0;ID=region694;Name=region694
-chr3	S-MART	transcript	6093901	6143900	.	+	.	nbElements=0;ID=region695;Name=region695
-chr3	S-MART	transcript	6143851	6193850	.	+	.	nbElements=0;ID=region696;Name=region696
-chr3	S-MART	transcript	6193801	6243800	.	+	.	nbElements=0;ID=region697;Name=region697
-chr3	S-MART	transcript	6243751	6293750	.	+	.	nbElements=0;ID=region698;Name=region698
-chr3	S-MART	transcript	6293701	6343700	.	+	.	nbElements=0;ID=region699;Name=region699
-chr3	S-MART	transcript	6343651	6393650	.	+	.	nbElements=0;ID=region700;Name=region700
-chr3	S-MART	transcript	6393601	6443600	.	+	.	nbElements=0;ID=region701;Name=region701
-chr3	S-MART	transcript	6443551	6493550	.	+	.	nbElements=0;ID=region702;Name=region702
-chr3	S-MART	transcript	6493501	6543500	.	+	.	nbElements=0;ID=region703;Name=region703
-chr3	S-MART	transcript	6543451	6593450	.	+	.	nbElements=0;ID=region704;Name=region704
-chr3	S-MART	transcript	6593401	6643400	.	+	.	nbElements=0;ID=region705;Name=region705
-chr3	S-MART	transcript	6643351	6693350	.	+	.	nbElements=0;ID=region706;Name=region706
-chr3	S-MART	transcript	6693301	6743300	.	+	.	nbElements=0;ID=region707;Name=region707
-chr3	S-MART	transcript	6743251	6793250	.	+	.	nbElements=0;ID=region708;Name=region708
-chr3	S-MART	transcript	6793201	6843200	.	+	.	nbElements=0;ID=region709;Name=region709
-chr3	S-MART	transcript	6843151	6893150	.	+	.	nbElements=0;ID=region710;Name=region710
-chr3	S-MART	transcript	6893101	6943100	.	+	.	nbElements=0;ID=region711;Name=region711
-chr3	S-MART	transcript	6943051	6993050	.	+	.	nbElements=0;ID=region712;Name=region712
-chr3	S-MART	transcript	6993001	7043000	.	+	.	nbElements=0;ID=region713;Name=region713
-chr3	S-MART	transcript	7042951	7092950	.	+	.	nbElements=0;ID=region714;Name=region714
-chr3	S-MART	transcript	7092901	7142900	.	+	.	nbElements=0;ID=region715;Name=region715
-chr3	S-MART	transcript	7142851	7192850	.	+	.	nbElements=0;ID=region716;Name=region716
-chr3	S-MART	transcript	7192801	7242800	.	+	.	nbElements=0;ID=region717;Name=region717
-chr3	S-MART	transcript	7242751	7292750	.	+	.	nbElements=0;ID=region718;Name=region718
-chr3	S-MART	transcript	7292701	7342700	.	+	.	nbElements=0;ID=region719;Name=region719
-chr3	S-MART	transcript	7342651	7392650	.	+	.	nbElements=0;ID=region720;Name=region720
-chr3	S-MART	transcript	7392601	7442600	.	+	.	nbElements=0;ID=region721;Name=region721
-chr3	S-MART	transcript	7442551	7492550	.	+	.	nbElements=0;ID=region722;Name=region722
-chr3	S-MART	transcript	7492501	7542500	.	+	.	nbElements=0;ID=region723;Name=region723
-chr3	S-MART	transcript	7542451	7592450	.	+	.	nbElements=0;ID=region724;Name=region724
-chr3	S-MART	transcript	7592401	7642400	.	+	.	nbElements=0;ID=region725;Name=region725
-chr3	S-MART	transcript	7642351	7692350	.	+	.	nbElements=0;ID=region726;Name=region726
-chr3	S-MART	transcript	7692301	7742300	.	+	.	nbElements=0;ID=region727;Name=region727
-chr3	S-MART	transcript	7742251	7792250	.	+	.	nbElements=0;ID=region728;Name=region728
-chr3	S-MART	transcript	7792201	7842200	.	+	.	nbElements=0;ID=region729;Name=region729
-chr3	S-MART	transcript	7842151	7892150	.	+	.	nbElements=0;ID=region730;Name=region730
-chr3	S-MART	transcript	7892101	7942100	.	+	.	nbElements=0;ID=region731;Name=region731
-chr3	S-MART	transcript	7942051	7992050	.	+	.	nbElements=0;ID=region732;Name=region732
-chr3	S-MART	transcript	7992001	8042000	.	+	.	nbElements=0;ID=region733;Name=region733
-chr3	S-MART	transcript	8041951	8091950	.	+	.	nbElements=0;ID=region734;Name=region734
-chr3	S-MART	transcript	8091901	8141900	.	+	.	nbElements=0;ID=region735;Name=region735
-chr3	S-MART	transcript	8141851	8191850	.	+	.	nbElements=0;ID=region736;Name=region736
-chr3	S-MART	transcript	8191801	8241800	.	+	.	nbElements=0;ID=region737;Name=region737
-chr3	S-MART	transcript	8241751	8291750	.	+	.	nbElements=0;ID=region738;Name=region738
-chr3	S-MART	transcript	8291701	8341700	.	+	.	nbElements=0;ID=region739;Name=region739
-chr3	S-MART	transcript	8341651	8391650	.	+	.	nbElements=0;ID=region740;Name=region740
-chr3	S-MART	transcript	8391601	8441600	.	+	.	nbElements=0;ID=region741;Name=region741
-chr3	S-MART	transcript	8441551	8491550	.	+	.	nbElements=0;ID=region742;Name=region742
-chr3	S-MART	transcript	8491501	8541500	.	+	.	nbElements=0;ID=region743;Name=region743
-chr3	S-MART	transcript	8541451	8591450	.	+	.	nbElements=0;ID=region744;Name=region744
-chr3	S-MART	transcript	8591401	8641400	.	+	.	nbElements=0;ID=region745;Name=region745
-chr3	S-MART	transcript	8641351	8691350	.	+	.	nbElements=0;ID=region746;Name=region746
-chr3	S-MART	transcript	8691301	8741300	.	+	.	nbElements=0;ID=region747;Name=region747
-chr3	S-MART	transcript	8741251	8791250	.	+	.	nbElements=0;ID=region748;Name=region748
-chr3	S-MART	transcript	8791201	8841200	.	+	.	nbElements=0;ID=region749;Name=region749
-chr3	S-MART	transcript	8841151	8891150	.	+	.	nbElements=0;ID=region750;Name=region750
-chr3	S-MART	transcript	8891101	8941100	.	+	.	nbElements=0;ID=region751;Name=region751
-chr3	S-MART	transcript	8941051	8991050	.	+	.	nbElements=0;ID=region752;Name=region752
-chr3	S-MART	transcript	8991001	9041000	.	+	.	nbElements=0;ID=region753;Name=region753
-chr3	S-MART	transcript	9040951	9090950	.	+	.	nbElements=0;ID=region754;Name=region754
-chr3	S-MART	transcript	9090901	9140900	.	+	.	nbElements=0;ID=region755;Name=region755
-chr3	S-MART	transcript	9140851	9190850	.	+	.	nbElements=0;ID=region756;Name=region756
-chr3	S-MART	transcript	9190801	9240800	.	+	.	nbElements=0;ID=region757;Name=region757
-chr3	S-MART	transcript	9240751	9290750	.	+	.	nbElements=0;ID=region758;Name=region758
-chr3	S-MART	transcript	9290701	9340700	.	+	.	nbElements=0;ID=region759;Name=region759
-chr3	S-MART	transcript	9340651	9390650	.	+	.	nbElements=0;ID=region760;Name=region760
-chr3	S-MART	transcript	9390601	9440600	.	+	.	nbElements=0;ID=region761;Name=region761
-chr3	S-MART	transcript	9440551	9490550	.	+	.	nbElements=0;ID=region762;Name=region762
-chr3	S-MART	transcript	9490501	9540500	.	+	.	nbElements=0;ID=region763;Name=region763
-chr3	S-MART	transcript	9540451	9590450	.	+	.	nbElements=0;ID=region764;Name=region764
-chr3	S-MART	transcript	9590401	9640400	.	+	.	nbElements=0;ID=region765;Name=region765
-chr3	S-MART	transcript	9640351	9690350	.	+	.	nbElements=0;ID=region766;Name=region766
-chr3	S-MART	transcript	9690301	9740300	.	+	.	nbElements=0;ID=region767;Name=region767
-chr3	S-MART	transcript	9740251	9790250	.	+	.	nbElements=0;ID=region768;Name=region768
-chr3	S-MART	transcript	9790201	9840200	.	+	.	nbElements=0;ID=region769;Name=region769
-chr3	S-MART	transcript	9840151	9890150	.	+	.	nbElements=0;ID=region770;Name=region770
-chr3	S-MART	transcript	9890101	9940100	.	+	.	nbElements=0;ID=region771;Name=region771
-chr3	S-MART	transcript	9940051	9990050	.	+	.	nbElements=0;ID=region772;Name=region772
-chr3	S-MART	transcript	9990001	10040000	.	+	.	nbElements=0;ID=region773;Name=region773
-chr3	S-MART	transcript	10039951	10089950	.	+	.	nbElements=0;ID=region774;Name=region774
-chr3	S-MART	transcript	10089901	10139900	.	+	.	nbElements=0;ID=region775;Name=region775
-chr3	S-MART	transcript	10139851	10189850	.	+	.	nbElements=0;ID=region776;Name=region776
-chr3	S-MART	transcript	10189801	10239800	.	+	.	nbElements=0;ID=region777;Name=region777
-chr3	S-MART	transcript	10239751	10289750	.	+	.	nbElements=0;ID=region778;Name=region778
-chr3	S-MART	transcript	10289701	10339700	.	+	.	nbElements=0;ID=region779;Name=region779
-chr3	S-MART	transcript	10339651	10389650	.	+	.	nbElements=0;ID=region780;Name=region780
-chr3	S-MART	transcript	10389601	10439600	.	+	.	nbElements=0;ID=region781;Name=region781
-chr3	S-MART	transcript	10439551	10489550	.	+	.	nbElements=0;ID=region782;Name=region782
-chr3	S-MART	transcript	10489501	10539500	.	+	.	nbElements=0;ID=region783;Name=region783
-chr3	S-MART	transcript	10539451	10589450	.	+	.	nbElements=0;ID=region784;Name=region784
-chr3	S-MART	transcript	10589401	10639400	.	+	.	nbElements=0;ID=region785;Name=region785
-chr3	S-MART	transcript	10639351	10689350	.	+	.	nbElements=0;ID=region786;Name=region786
-chr3	S-MART	transcript	10689301	10739300	.	+	.	nbElements=0;ID=region787;Name=region787
-chr3	S-MART	transcript	10739251	10789250	.	+	.	nbElements=0;ID=region788;Name=region788
-chr3	S-MART	transcript	10789201	10839200	.	+	.	nbElements=0;ID=region789;Name=region789
-chr3	S-MART	transcript	10839151	10889150	.	+	.	nbElements=0;ID=region790;Name=region790
-chr3	S-MART	transcript	10889101	10939100	.	+	.	nbElements=0;ID=region791;Name=region791
-chr3	S-MART	transcript	10939051	10989050	.	+	.	nbElements=0;ID=region792;Name=region792
-chr3	S-MART	transcript	10989001	11039000	.	+	.	nbElements=0;ID=region793;Name=region793
-chr3	S-MART	transcript	11038951	11088950	.	+	.	nbElements=0;ID=region794;Name=region794
-chr3	S-MART	transcript	11088901	11138900	.	+	.	nbElements=0;ID=region795;Name=region795
-chr3	S-MART	transcript	11138851	11188850	.	+	.	nbElements=0;ID=region796;Name=region796
-chr3	S-MART	transcript	11188801	11238800	.	+	.	nbElements=0;ID=region797;Name=region797
-chr3	S-MART	transcript	11238751	11288750	.	+	.	nbElements=0;ID=region798;Name=region798
-chr3	S-MART	transcript	11288701	11338700	.	+	.	nbElements=0;ID=region799;Name=region799
-chr3	S-MART	transcript	11338651	11388650	.	+	.	nbElements=0;ID=region800;Name=region800
-chr3	S-MART	transcript	11388601	11438600	.	+	.	nbElements=0;ID=region801;Name=region801
-chr3	S-MART	transcript	11438551	11488550	.	+	.	nbElements=0;ID=region802;Name=region802
-chr3	S-MART	transcript	11488501	11538500	.	+	.	nbElements=0;ID=region803;Name=region803
-chr3	S-MART	transcript	11538451	11588450	.	+	.	nbElements=0;ID=region804;Name=region804
-chr3	S-MART	transcript	11588401	11638400	.	+	.	nbElements=0;ID=region805;Name=region805
-chr3	S-MART	transcript	11638351	11688350	.	+	.	nbElements=0;ID=region806;Name=region806
-chr3	S-MART	transcript	11688301	11738300	.	+	.	nbElements=0;ID=region807;Name=region807
-chr3	S-MART	transcript	11738251	11788250	.	+	.	nbElements=0;ID=region808;Name=region808
-chr3	S-MART	transcript	11788201	11838200	.	+	.	nbElements=0;ID=region809;Name=region809
-chr3	S-MART	transcript	11838151	11888150	.	+	.	nbElements=0;ID=region810;Name=region810
-chr3	S-MART	transcript	11888101	11938100	.	+	.	nbElements=0;ID=region811;Name=region811
-chr3	S-MART	transcript	11938051	11988050	.	+	.	nbElements=0;ID=region812;Name=region812
-chr3	S-MART	transcript	11988001	12038000	.	+	.	nbElements=0;ID=region813;Name=region813
-chr3	S-MART	transcript	12037951	12087950	.	+	.	nbElements=0;ID=region814;Name=region814
-chr3	S-MART	transcript	12087901	12137900	.	+	.	nbElements=0;ID=region815;Name=region815
-chr3	S-MART	transcript	12137851	12187850	.	+	.	nbElements=0;ID=region816;Name=region816
-chr3	S-MART	transcript	12187801	12237800	.	+	.	nbElements=0;ID=region817;Name=region817
-chr3	S-MART	transcript	12237751	12287750	.	+	.	nbElements=0;ID=region818;Name=region818
-chr3	S-MART	transcript	12287701	12337700	.	+	.	nbElements=0;ID=region819;Name=region819
-chr3	S-MART	transcript	12337651	12387650	.	+	.	nbElements=0;ID=region820;Name=region820
-chr3	S-MART	transcript	12387601	12437600	.	+	.	nbElements=0;ID=region821;Name=region821
-chr3	S-MART	transcript	12437551	12487550	.	+	.	nbElements=0;ID=region822;Name=region822
-chr3	S-MART	transcript	12487501	12537500	.	+	.	nbElements=0;ID=region823;Name=region823
-chr3	S-MART	transcript	12537451	12587450	.	+	.	nbElements=0;ID=region824;Name=region824
-chr3	S-MART	transcript	12587401	12637400	.	+	.	nbElements=0;ID=region825;Name=region825
-chr3	S-MART	transcript	12637351	12687350	.	+	.	nbElements=0;ID=region826;Name=region826
-chr3	S-MART	transcript	12687301	12737300	.	+	.	nbElements=0;ID=region827;Name=region827
-chr3	S-MART	transcript	12737251	12787250	.	+	.	nbElements=0;ID=region828;Name=region828
-chr3	S-MART	transcript	12787201	12837200	.	+	.	nbElements=0;ID=region829;Name=region829
-chr3	S-MART	transcript	12837151	12887150	.	+	.	nbElements=0;ID=region830;Name=region830
-chr3	S-MART	transcript	12887101	12937100	.	+	.	nbElements=0;ID=region831;Name=region831
-chr3	S-MART	transcript	12937051	12987050	.	+	.	nbElements=0;ID=region832;Name=region832
-chr3	S-MART	transcript	12987001	13037000	.	+	.	nbElements=0;ID=region833;Name=region833
-chr3	S-MART	transcript	13036951	13086950	.	+	.	nbElements=0;ID=region834;Name=region834
-chr3	S-MART	transcript	13086901	13136900	.	+	.	nbElements=0;ID=region835;Name=region835
-chr3	S-MART	transcript	13136851	13186850	.	+	.	nbElements=0;ID=region836;Name=region836
-chr3	S-MART	transcript	13186801	13236800	.	+	.	nbElements=0;ID=region837;Name=region837
-chr3	S-MART	transcript	13236751	13286750	.	+	.	nbElements=0;ID=region838;Name=region838
-chr3	S-MART	transcript	13286701	13336700	.	+	.	nbElements=0;ID=region839;Name=region839
-chr3	S-MART	transcript	13336651	13386650	.	+	.	nbElements=0;ID=region840;Name=region840
-chr3	S-MART	transcript	13386601	13436600	.	+	.	nbElements=0;ID=region841;Name=region841
-chr3	S-MART	transcript	13436551	13486550	.	+	.	nbElements=0;ID=region842;Name=region842
-chr3	S-MART	transcript	13486501	13536500	.	+	.	nbElements=0;ID=region843;Name=region843
-chr3	S-MART	transcript	13536451	13586450	.	+	.	nbElements=0;ID=region844;Name=region844
-chr3	S-MART	transcript	13586401	13636400	.	+	.	nbElements=0;ID=region845;Name=region845
-chr3	S-MART	transcript	13636351	13686350	.	+	.	nbElements=0;ID=region846;Name=region846
-chr3	S-MART	transcript	13686301	13736300	.	+	.	nbElements=0;ID=region847;Name=region847
-chr3	S-MART	transcript	13736251	13786250	.	+	.	nbElements=0;ID=region848;Name=region848
-chr3	S-MART	transcript	13786201	13836200	.	+	.	nbElements=0;ID=region849;Name=region849
-chr3	S-MART	transcript	13836151	13886150	.	+	.	nbElements=0;ID=region850;Name=region850
-chr3	S-MART	transcript	13886101	13936100	.	+	.	nbElements=0;ID=region851;Name=region851
-chr3	S-MART	transcript	13936051	13986050	.	+	.	nbElements=0;ID=region852;Name=region852
-chr3	S-MART	transcript	13986001	14036000	.	+	.	nbElements=0;ID=region853;Name=region853
-chr3	S-MART	transcript	14035951	14085950	.	+	.	nbElements=0;ID=region854;Name=region854
-chr3	S-MART	transcript	14085901	14135900	.	+	.	nbElements=0;ID=region855;Name=region855
-chr3	S-MART	transcript	14135851	14185850	.	+	.	nbElements=0;ID=region856;Name=region856
-chr3	S-MART	transcript	14185801	14235800	.	+	.	nbElements=0;ID=region857;Name=region857
-chr3	S-MART	transcript	14235751	14285750	.	+	.	nbElements=0;ID=region858;Name=region858
-chr3	S-MART	transcript	14285701	14335700	.	+	.	nbElements=0;ID=region859;Name=region859
-chr3	S-MART	transcript	14335651	14385650	.	+	.	nbElements=0;ID=region860;Name=region860
-chr3	S-MART	transcript	14385601	14435600	.	+	.	nbElements=0;ID=region861;Name=region861
-chr3	S-MART	transcript	14435551	14485550	.	+	.	nbElements=0;ID=region862;Name=region862
-chr3	S-MART	transcript	14485501	14535500	.	+	.	nbElements=0;ID=region863;Name=region863
-chr3	S-MART	transcript	14535451	14585450	.	+	.	nbElements=0;ID=region864;Name=region864
-chr3	S-MART	transcript	14585401	14635400	.	+	.	nbElements=0;ID=region865;Name=region865
-chr3	S-MART	transcript	14635351	14685350	.	+	.	nbElements=0;ID=region866;Name=region866
-chr3	S-MART	transcript	14685301	14735300	.	+	.	nbElements=0;ID=region867;Name=region867
-chr3	S-MART	transcript	14735251	14785250	.	+	.	nbElements=0;ID=region868;Name=region868
-chr3	S-MART	transcript	14785201	14835200	.	+	.	nbElements=0;ID=region869;Name=region869
-chr3	S-MART	transcript	14835151	14885150	.	+	.	nbElements=0;ID=region870;Name=region870
-chr3	S-MART	transcript	14885101	14935100	.	+	.	nbElements=0;ID=region871;Name=region871
-chr3	S-MART	transcript	14935051	14985050	.	+	.	nbElements=0;ID=region872;Name=region872
-chr3	S-MART	transcript	14985001	15035000	.	+	.	nbElements=0;ID=region873;Name=region873
-chr3	S-MART	transcript	15034951	15084950	.	+	.	nbElements=0;ID=region874;Name=region874
-chr3	S-MART	transcript	15084901	15134900	.	+	.	nbElements=0;ID=region875;Name=region875
-chr3	S-MART	transcript	15134851	15184850	.	+	.	nbElements=0;ID=region876;Name=region876
-chr3	S-MART	transcript	15184801	15234800	.	+	.	nbElements=0;ID=region877;Name=region877
-chr3	S-MART	transcript	15234751	15284750	.	+	.	nbElements=0;ID=region878;Name=region878
-chr3	S-MART	transcript	15284701	15334700	.	+	.	nbElements=0;ID=region879;Name=region879
-chr3	S-MART	transcript	15334651	15384650	.	+	.	nbElements=0;ID=region880;Name=region880
-chr3	S-MART	transcript	15384601	15434600	.	+	.	nbElements=0;ID=region881;Name=region881
-chr3	S-MART	transcript	15434551	15484550	.	+	.	nbElements=0;ID=region882;Name=region882
-chr3	S-MART	transcript	15484501	15534500	.	+	.	nbElements=0;ID=region883;Name=region883
-chr3	S-MART	transcript	15534451	15584450	.	+	.	nbElements=0;ID=region884;Name=region884
-chr3	S-MART	transcript	15584401	15634400	.	+	.	nbElements=0;ID=region885;Name=region885
-chr3	S-MART	transcript	15634351	15684350	.	+	.	nbElements=0;ID=region886;Name=region886
-chr3	S-MART	transcript	15684301	15734300	.	+	.	nbElements=0;ID=region887;Name=region887
-chr3	S-MART	transcript	15734251	15784250	.	+	.	nbElements=0;ID=region888;Name=region888
-chr3	S-MART	transcript	15784201	15834200	.	+	.	nbElements=0;ID=region889;Name=region889
-chr3	S-MART	transcript	15834151	15884150	.	+	.	nbElements=0;ID=region890;Name=region890
-chr3	S-MART	transcript	15884101	15934100	.	+	.	nbElements=0;ID=region891;Name=region891
-chr3	S-MART	transcript	15934051	15984050	.	+	.	nbElements=0;ID=region892;Name=region892
-chr3	S-MART	transcript	15984001	16034000	.	+	.	nbElements=0;ID=region893;Name=region893
-chr3	S-MART	transcript	16033951	16083950	.	+	.	nbElements=0;ID=region894;Name=region894
-chr3	S-MART	transcript	16083901	16133900	.	+	.	nbElements=0;ID=region895;Name=region895
-chr3	S-MART	transcript	16133851	16183850	.	+	.	nbElements=0;ID=region896;Name=region896
-chr3	S-MART	transcript	16183801	16233800	.	+	.	nbElements=0;ID=region897;Name=region897
-chr3	S-MART	transcript	16233751	16283750	.	+	.	nbElements=0;ID=region898;Name=region898
-chr3	S-MART	transcript	16283701	16333700	.	+	.	nbElements=0;ID=region899;Name=region899
-chr3	S-MART	transcript	16333651	16383650	.	+	.	nbElements=0;ID=region900;Name=region900
-chr3	S-MART	transcript	16383601	16433600	.	+	.	nbElements=0;ID=region901;Name=region901
-chr3	S-MART	transcript	16433551	16483550	.	+	.	nbElements=0;ID=region902;Name=region902
-chr3	S-MART	transcript	16483501	16533500	.	+	.	nbElements=0;ID=region903;Name=region903
-chr3	S-MART	transcript	16533451	16583450	.	+	.	nbElements=0;ID=region904;Name=region904
-chr3	S-MART	transcript	16583401	16633400	.	+	.	nbElements=0;ID=region905;Name=region905
-chr3	S-MART	transcript	16633351	16683350	.	+	.	nbElements=0;ID=region906;Name=region906
-chr3	S-MART	transcript	16683301	16733300	.	+	.	nbElements=0;ID=region907;Name=region907
-chr3	S-MART	transcript	16733251	16783250	.	+	.	nbElements=0;ID=region908;Name=region908
-chr3	S-MART	transcript	16783201	16833200	.	+	.	nbElements=0;ID=region909;Name=region909
-chr3	S-MART	transcript	16833151	16883150	.	+	.	nbElements=0;ID=region910;Name=region910
-chr3	S-MART	transcript	16883101	16933100	.	+	.	nbElements=0;ID=region911;Name=region911
-chr3	S-MART	transcript	16933051	16983050	.	+	.	nbElements=0;ID=region912;Name=region912
-chr3	S-MART	transcript	16983001	17033000	.	+	.	nbElements=0;ID=region913;Name=region913
-chr3	S-MART	transcript	17032951	17082950	.	+	.	nbElements=0;ID=region914;Name=region914
-chr3	S-MART	transcript	17082901	17132900	.	+	.	nbElements=0;ID=region915;Name=region915
-chr3	S-MART	transcript	17132851	17182850	.	+	.	nbElements=0;ID=region916;Name=region916
-chr3	S-MART	transcript	17182801	17232800	.	+	.	nbElements=0;ID=region917;Name=region917
-chr3	S-MART	transcript	17232751	17282750	.	+	.	nbElements=0;ID=region918;Name=region918
-chr3	S-MART	transcript	17282701	17332700	.	+	.	nbElements=0;ID=region919;Name=region919
-chr3	S-MART	transcript	17332651	17382650	.	+	.	nbElements=0;ID=region920;Name=region920
-chr3	S-MART	transcript	17382601	17432600	.	+	.	nbElements=0;ID=region921;Name=region921
-chr3	S-MART	transcript	17432551	17482550	.	+	.	nbElements=0;ID=region922;Name=region922
-chr3	S-MART	transcript	17482501	17532500	.	+	.	nbElements=0;ID=region923;Name=region923
-chr3	S-MART	transcript	17532451	17582450	.	+	.	nbElements=0;ID=region924;Name=region924
-chr3	S-MART	transcript	17582401	17632400	.	+	.	nbElements=0;ID=region925;Name=region925
-chr3	S-MART	transcript	17632351	17682350	.	+	.	nbElements=0;ID=region926;Name=region926
-chr3	S-MART	transcript	17682301	17732300	.	+	.	nbElements=0;ID=region927;Name=region927
-chr3	S-MART	transcript	17732251	17782250	.	+	.	nbElements=0;ID=region928;Name=region928
-chr3	S-MART	transcript	17782201	17832200	.	+	.	nbElements=0;ID=region929;Name=region929
-chr3	S-MART	transcript	17832151	17882150	.	+	.	nbElements=0;ID=region930;Name=region930
-chr3	S-MART	transcript	17882101	17932100	.	+	.	nbElements=0;ID=region931;Name=region931
-chr3	S-MART	transcript	17932051	17982050	.	+	.	nbElements=0;ID=region932;Name=region932
-chr3	S-MART	transcript	17982001	18032000	.	+	.	nbElements=0;ID=region933;Name=region933
-chr3	S-MART	transcript	18031951	18081950	.	+	.	nbElements=0;ID=region934;Name=region934
-chr3	S-MART	transcript	18081901	18131900	.	+	.	nbElements=0;ID=region935;Name=region935
-chr3	S-MART	transcript	18131851	18181850	.	+	.	nbElements=0;ID=region936;Name=region936
-chr3	S-MART	transcript	18181801	18231800	.	+	.	nbElements=0;ID=region937;Name=region937
-chr3	S-MART	transcript	18231751	18281750	.	+	.	nbElements=0;ID=region938;Name=region938
-chr3	S-MART	transcript	18281701	18331700	.	+	.	nbElements=0;ID=region939;Name=region939
-chr3	S-MART	transcript	18331651	18381650	.	+	.	nbElements=0;ID=region940;Name=region940
-chr3	S-MART	transcript	18381601	18431600	.	+	.	nbElements=0;ID=region941;Name=region941
-chr3	S-MART	transcript	18431551	18481550	.	+	.	nbElements=0;ID=region942;Name=region942
-chr3	S-MART	transcript	18481501	18531500	.	+	.	nbElements=0;ID=region943;Name=region943
-chr3	S-MART	transcript	18531451	18581450	.	+	.	nbElements=0;ID=region944;Name=region944
-chr3	S-MART	transcript	18581401	18631400	.	+	.	nbElements=0;ID=region945;Name=region945
-chr3	S-MART	transcript	18631351	18681350	.	+	.	nbElements=0;ID=region946;Name=region946
-chr3	S-MART	transcript	18681301	18731300	.	+	.	nbElements=0;ID=region947;Name=region947
-chr3	S-MART	transcript	18731251	18781250	.	+	.	nbElements=0;ID=region948;Name=region948
-chr3	S-MART	transcript	18781201	18831200	.	+	.	nbElements=0;ID=region949;Name=region949
-chr3	S-MART	transcript	18831151	18881150	.	+	.	nbElements=0;ID=region950;Name=region950
-chr3	S-MART	transcript	18881101	18931100	.	+	.	nbElements=0;ID=region951;Name=region951
-chr3	S-MART	transcript	18931051	18981050	.	+	.	nbElements=0;ID=region952;Name=region952
-chr3	S-MART	transcript	18981001	19031000	.	+	.	nbElements=0;ID=region953;Name=region953
-chr3	S-MART	transcript	19030951	19080950	.	+	.	nbElements=0;ID=region954;Name=region954
-chr3	S-MART	transcript	19080901	19130900	.	+	.	nbElements=0;ID=region955;Name=region955
-chr3	S-MART	transcript	19130851	19180850	.	+	.	nbElements=0;ID=region956;Name=region956
-chr3	S-MART	transcript	19180801	19230800	.	+	.	nbElements=0;ID=region957;Name=region957
-chr3	S-MART	transcript	19230751	19280750	.	+	.	nbElements=0;ID=region958;Name=region958
-chr3	S-MART	transcript	19280701	19330700	.	+	.	nbElements=0;ID=region959;Name=region959
-chr3	S-MART	transcript	19330651	19380650	.	+	.	nbElements=0;ID=region960;Name=region960
-chr3	S-MART	transcript	19380601	19430600	.	+	.	nbElements=0;ID=region961;Name=region961
-chr3	S-MART	transcript	19430551	19480550	.	+	.	nbElements=0;ID=region962;Name=region962
-chr3	S-MART	transcript	19480501	19530500	.	+	.	nbElements=0;ID=region963;Name=region963
-chr3	S-MART	transcript	19530451	19580450	.	+	.	nbElements=0;ID=region964;Name=region964
-chr3	S-MART	transcript	19580401	19630400	.	+	.	nbElements=0;ID=region965;Name=region965
-chr3	S-MART	transcript	19630351	19680350	.	+	.	nbElements=0;ID=region966;Name=region966
-chr3	S-MART	transcript	19680301	19730300	.	+	.	nbElements=0;ID=region967;Name=region967
-chr3	S-MART	transcript	19730251	19780250	.	+	.	nbElements=0;ID=region968;Name=region968
-chr3	S-MART	transcript	19780201	19830200	.	+	.	nbElements=0;ID=region969;Name=region969
-chr3	S-MART	transcript	19830151	19880150	.	+	.	nbElements=0;ID=region970;Name=region970
-chr3	S-MART	transcript	19880101	19930100	.	+	.	nbElements=0;ID=region971;Name=region971
-chr3	S-MART	transcript	19930051	19980050	.	+	.	nbElements=0;ID=region972;Name=region972
-chr3	S-MART	transcript	19980001	20030000	.	+	.	nbElements=0;ID=region973;Name=region973
-chr3	S-MART	transcript	20029951	20079950	.	+	.	nbElements=0;ID=region974;Name=region974
-chr3	S-MART	transcript	20079901	20129900	.	+	.	nbElements=0;ID=region975;Name=region975
-chr3	S-MART	transcript	20129851	20179850	.	+	.	nbElements=0;ID=region976;Name=region976
-chr3	S-MART	transcript	20179801	20229800	.	+	.	nbElements=0;ID=region977;Name=region977
-chr3	S-MART	transcript	20229751	20279750	.	+	.	nbElements=0;ID=region978;Name=region978
-chr3	S-MART	transcript	20279701	20329700	.	+	.	nbElements=0;ID=region979;Name=region979
-chr3	S-MART	transcript	20329651	20379650	.	+	.	nbElements=0;ID=region980;Name=region980
-chr3	S-MART	transcript	20379601	20429600	.	+	.	nbElements=0;ID=region981;Name=region981
-chr3	S-MART	transcript	20429551	20479550	.	+	.	nbElements=0;ID=region982;Name=region982
-chr3	S-MART	transcript	20479501	20529500	.	+	.	nbElements=0;ID=region983;Name=region983
-chr3	S-MART	transcript	20529451	20579450	.	+	.	nbElements=0;ID=region984;Name=region984
-chr3	S-MART	transcript	20579401	20629400	.	+	.	nbElements=0;ID=region985;Name=region985
-chr3	S-MART	transcript	20629351	20679350	.	+	.	nbElements=0;ID=region986;Name=region986
-chr3	S-MART	transcript	20679301	20729300	.	+	.	nbElements=0;ID=region987;Name=region987
-chr3	S-MART	transcript	20729251	20779250	.	+	.	nbElements=0;ID=region988;Name=region988
-chr3	S-MART	transcript	20779201	20829200	.	+	.	nbElements=0;ID=region989;Name=region989
-chr3	S-MART	transcript	20829151	20879150	.	+	.	nbElements=0;ID=region990;Name=region990
-chr3	S-MART	transcript	20879101	20929100	.	+	.	nbElements=0;ID=region991;Name=region991
-chr3	S-MART	transcript	20929051	20979050	.	+	.	nbElements=0;ID=region992;Name=region992
-chr3	S-MART	transcript	20979001	21029000	.	+	.	nbElements=0;ID=region993;Name=region993
-chr3	S-MART	transcript	21028951	21078950	.	+	.	nbElements=0;ID=region994;Name=region994
-chr3	S-MART	transcript	21078901	21128900	.	+	.	nbElements=0;ID=region995;Name=region995
-chr3	S-MART	transcript	21128851	21178850	.	+	.	nbElements=0;ID=region996;Name=region996
-chr3	S-MART	transcript	21178801	21228800	.	+	.	nbElements=0;ID=region997;Name=region997
-chr3	S-MART	transcript	21228751	21278750	.	+	.	nbElements=0;ID=region998;Name=region998
-chr3	S-MART	transcript	21278701	21328700	.	+	.	nbElements=0;ID=region999;Name=region999
-chr3	S-MART	transcript	21328651	21378650	.	+	.	nbElements=0;ID=region1000;Name=region1000
-chr3	S-MART	transcript	21378601	21428600	.	+	.	nbElements=0;ID=region1001;Name=region1001
-chr3	S-MART	transcript	21428551	21478550	.	+	.	nbElements=0;ID=region1002;Name=region1002
-chr3	S-MART	transcript	21478501	21528500	.	+	.	nbElements=0;ID=region1003;Name=region1003
-chr3	S-MART	transcript	21528451	21578450	.	+	.	nbElements=0;ID=region1004;Name=region1004
-chr3	S-MART	transcript	21578401	21628400	.	+	.	nbElements=0;ID=region1005;Name=region1005
-chr3	S-MART	transcript	21628351	21678350	.	+	.	nbElements=0;ID=region1006;Name=region1006
-chr3	S-MART	transcript	21678301	21728300	.	+	.	nbElements=0;ID=region1007;Name=region1007
-chr3	S-MART	transcript	21728251	21778250	.	+	.	nbElements=0;ID=region1008;Name=region1008
-chr3	S-MART	transcript	21778201	21828200	.	+	.	nbElements=0;ID=region1009;Name=region1009
-chr3	S-MART	transcript	21828151	21878150	.	+	.	nbElements=0;ID=region1010;Name=region1010
-chr3	S-MART	transcript	21878101	21928100	.	+	.	nbElements=0;ID=region1011;Name=region1011
-chr3	S-MART	transcript	21928051	21978050	.	+	.	nbElements=0;ID=region1012;Name=region1012
-chr3	S-MART	transcript	21978001	22028000	.	+	.	nbElements=0;ID=region1013;Name=region1013
-chr3	S-MART	transcript	22027951	22077950	.	+	.	nbElements=0;ID=region1014;Name=region1014
-chr3	S-MART	transcript	22077901	22127900	.	+	.	nbElements=0;ID=region1015;Name=region1015
-chr3	S-MART	transcript	22127851	22177850	.	+	.	nbElements=0;ID=region1016;Name=region1016
-chr3	S-MART	transcript	22177801	22227800	.	+	.	nbElements=0;ID=region1017;Name=region1017
-chr3	S-MART	transcript	22227751	22277750	.	+	.	nbElements=0;ID=region1018;Name=region1018
-chr3	S-MART	transcript	22277701	22327700	.	+	.	nbElements=0;ID=region1019;Name=region1019
-chr3	S-MART	transcript	22327651	22377650	.	+	.	nbElements=0;ID=region1020;Name=region1020
-chr3	S-MART	transcript	22377601	22427600	.	+	.	nbElements=0;ID=region1021;Name=region1021
-chr3	S-MART	transcript	22427551	22477550	.	+	.	nbElements=0;ID=region1022;Name=region1022
-chr3	S-MART	transcript	22477501	22527500	.	+	.	nbElements=0;ID=region1023;Name=region1023
-chr3	S-MART	transcript	22527451	22577450	.	+	.	nbElements=0;ID=region1024;Name=region1024
-chr3	S-MART	transcript	22577401	22627400	.	+	.	nbElements=0;ID=region1025;Name=region1025
-chr3	S-MART	transcript	22627351	22677350	.	+	.	nbElements=0;ID=region1026;Name=region1026
-chr3	S-MART	transcript	22677301	22727300	.	+	.	nbElements=0;ID=region1027;Name=region1027
-chr3	S-MART	transcript	22727251	22777250	.	+	.	nbElements=0;ID=region1028;Name=region1028
-chr3	S-MART	transcript	22777201	22827200	.	+	.	nbElements=0;ID=region1029;Name=region1029
-chr3	S-MART	transcript	22827151	22877150	.	+	.	nbElements=0;ID=region1030;Name=region1030
-chr3	S-MART	transcript	22877101	22927100	.	+	.	nbElements=0;ID=region1031;Name=region1031
-chr3	S-MART	transcript	22927051	22977050	.	+	.	nbElements=0;ID=region1032;Name=region1032
-chr3	S-MART	transcript	22977001	23027000	.	+	.	nbElements=0;ID=region1033;Name=region1033
-chr3	S-MART	transcript	23026951	23076950	.	+	.	nbElements=0;ID=region1034;Name=region1034
-chr3	S-MART	transcript	23076901	23126900	.	+	.	nbElements=0;ID=region1035;Name=region1035
-chr3	S-MART	transcript	23126851	23176850	.	+	.	nbElements=0;ID=region1036;Name=region1036
-chr3	S-MART	transcript	23176801	23226800	.	+	.	nbElements=0;ID=region1037;Name=region1037
-chr3	S-MART	transcript	23226751	23276750	.	+	.	nbElements=0;ID=region1038;Name=region1038
-chr3	S-MART	transcript	23276701	23326700	.	+	.	nbElements=0;ID=region1039;Name=region1039
-chr3	S-MART	transcript	23326651	23376650	.	+	.	nbElements=0;ID=region1040;Name=region1040
-chr3	S-MART	transcript	23376601	23426600	.	+	.	nbElements=0;ID=region1041;Name=region1041
-chr3	S-MART	transcript	23426551	23476550	.	+	.	nbElements=0;ID=region1042;Name=region1042
-chr3	S-MART	transcript	23476501	23526500	.	+	.	nbElements=0;ID=region1043;Name=region1043
-chr3	S-MART	transcript	23526451	23576450	.	+	.	nbElements=0;ID=region1044;Name=region1044
-chr3	S-MART	transcript	23576401	23626400	.	+	.	nbElements=0;ID=region1045;Name=region1045
-chr3	S-MART	transcript	23626351	23676350	.	+	.	nbElements=0;ID=region1046;Name=region1046
-chr3	S-MART	transcript	23676301	23726300	.	+	.	nbElements=0;ID=region1047;Name=region1047
-chr3	S-MART	transcript	23726251	23776250	.	+	.	nbElements=0;ID=region1048;Name=region1048
-chr3	S-MART	transcript	23776201	23826200	.	+	.	nbElements=0;ID=region1049;Name=region1049
-chr3	S-MART	transcript	23826151	23876150	.	+	.	nbElements=0;ID=region1050;Name=region1050
-chr3	S-MART	transcript	23876101	23926100	.	+	.	nbElements=0;ID=region1051;Name=region1051
-chr3	S-MART	transcript	23926051	23976050	.	+	.	nbElements=0;ID=region1052;Name=region1052
-chr3	S-MART	transcript	23976001	24026000	.	+	.	nbElements=0;ID=region1053;Name=region1053
-chr3	S-MART	transcript	24025951	24075950	.	+	.	nbElements=0;ID=region1054;Name=region1054
-chr3	S-MART	transcript	24075901	24125900	.	+	.	nbElements=0;ID=region1055;Name=region1055
-chr3	S-MART	transcript	24125851	24175850	.	+	.	nbElements=0;ID=region1056;Name=region1056
-chr3	S-MART	transcript	24175801	24225800	.	+	.	nbElements=0;ID=region1057;Name=region1057
-chr3	S-MART	transcript	24225751	24275750	.	+	.	nbElements=0;ID=region1058;Name=region1058
-chr3	S-MART	transcript	24275701	24325700	.	+	.	nbElements=0;ID=region1059;Name=region1059
-chr3	S-MART	transcript	24325651	24375650	.	+	.	nbElements=0;ID=region1060;Name=region1060
-chr3	S-MART	transcript	24375601	24425600	.	+	.	nbElements=0;ID=region1061;Name=region1061
-chr3	S-MART	transcript	24425551	24475550	.	+	.	nbElements=0;ID=region1062;Name=region1062
-chr3	S-MART	transcript	24475501	24525500	.	+	.	nbElements=0;ID=region1063;Name=region1063
-chr3	S-MART	transcript	24525451	24575450	.	+	.	nbElements=0;ID=region1064;Name=region1064
-chr3	S-MART	transcript	24575401	24625400	.	+	.	nbElements=0;ID=region1065;Name=region1065
-chr3	S-MART	transcript	24625351	24675350	.	+	.	nbElements=0;ID=region1066;Name=region1066
-chr3	S-MART	transcript	24675301	24725300	.	+	.	nbElements=0;ID=region1067;Name=region1067
-chr3	S-MART	transcript	24725251	24775250	.	+	.	nbElements=0;ID=region1068;Name=region1068
-chr3	S-MART	transcript	24775201	24825200	.	+	.	nbElements=0;ID=region1069;Name=region1069
-chr3	S-MART	transcript	24825151	24875150	.	+	.	nbElements=0;ID=region1070;Name=region1070
-chr3	S-MART	transcript	24875101	24925100	.	+	.	nbElements=0;ID=region1071;Name=region1071
-chr3	S-MART	transcript	24925051	24975050	.	+	.	nbElements=0;ID=region1072;Name=region1072
-chr3	S-MART	transcript	24975001	25025000	.	+	.	nbElements=0;ID=region1073;Name=region1073
-chr3	S-MART	transcript	25024951	25074950	.	+	.	nbElements=0;ID=region1074;Name=region1074
-chr3	S-MART	transcript	25074901	25124900	.	+	.	nbElements=0;ID=region1075;Name=region1075
-chr3	S-MART	transcript	25124851	25174850	.	+	.	nbElements=0;ID=region1076;Name=region1076
-chr3	S-MART	transcript	25174801	25224800	.	+	.	nbElements=0;ID=region1077;Name=region1077
-chr3	S-MART	transcript	25224751	25274750	.	+	.	nbElements=0;ID=region1078;Name=region1078
-chr3	S-MART	transcript	25274701	25324700	.	+	.	nbElements=0;ID=region1079;Name=region1079
-chr3	S-MART	transcript	25324651	25374650	.	+	.	nbElements=0;ID=region1080;Name=region1080
-chr3	S-MART	transcript	25374601	25424600	.	+	.	nbElements=0;ID=region1081;Name=region1081
-chr3	S-MART	transcript	25424551	25474550	.	+	.	nbElements=0;ID=region1082;Name=region1082
-chr3	S-MART	transcript	25474501	25524500	.	+	.	nbElements=0;ID=region1083;Name=region1083
-chr3	S-MART	transcript	25524451	25574450	.	+	.	nbElements=0;ID=region1084;Name=region1084
-chr3	S-MART	transcript	25574401	25624400	.	+	.	nbElements=0;ID=region1085;Name=region1085
-chr3	S-MART	transcript	25624351	25674350	.	+	.	nbElements=0;ID=region1086;Name=region1086
-chr3	S-MART	transcript	25674301	25724300	.	+	.	nbElements=0;ID=region1087;Name=region1087
-chr3	S-MART	transcript	25724251	25774250	.	+	.	nbElements=0;ID=region1088;Name=region1088
-chr3	S-MART	transcript	25774201	25824200	.	+	.	nbElements=0;ID=region1089;Name=region1089
-chr3	S-MART	transcript	25824151	25874150	.	+	.	nbElements=0;ID=region1090;Name=region1090
-chr3	S-MART	transcript	25874101	25924100	.	+	.	nbElements=0;ID=region1091;Name=region1091
-chr3	S-MART	transcript	25924051	25974050	.	+	.	nbElements=0;ID=region1092;Name=region1092
-chr3	S-MART	transcript	25974001	26024000	.	+	.	nbElements=0;ID=region1093;Name=region1093
-chr3	S-MART	transcript	26023951	26073950	.	+	.	nbElements=0;ID=region1094;Name=region1094
-chr3	S-MART	transcript	26073901	26123900	.	+	.	nbElements=0;ID=region1095;Name=region1095
-chr3	S-MART	transcript	26123851	26173850	.	+	.	nbElements=0;ID=region1096;Name=region1096
-chr3	S-MART	transcript	26173801	26223800	.	+	.	nbElements=0;ID=region1097;Name=region1097
-chr3	S-MART	transcript	26223751	26273750	.	+	.	nbElements=0;ID=region1098;Name=region1098
-chr3	S-MART	transcript	26273701	26323700	.	+	.	nbElements=0;ID=region1099;Name=region1099
-chr3	S-MART	transcript	26323651	26373650	.	+	.	nbElements=0;ID=region1100;Name=region1100
-chr3	S-MART	transcript	26373601	26423600	.	+	.	nbElements=0;ID=region1101;Name=region1101
-chr3	S-MART	transcript	26423551	26473550	.	+	.	nbElements=0;ID=region1102;Name=region1102
-chr3	S-MART	transcript	26473501	26523500	.	+	.	nbElements=0;ID=region1103;Name=region1103
-chr3	S-MART	transcript	26523451	26573450	.	+	.	nbElements=0;ID=region1104;Name=region1104
-chr3	S-MART	transcript	26573401	26623400	.	+	.	nbElements=0;ID=region1105;Name=region1105
-chr3	S-MART	transcript	26623351	26673350	.	+	.	nbElements=0;ID=region1106;Name=region1106
-chr3	S-MART	transcript	26673301	26723300	.	+	.	nbElements=0;ID=region1107;Name=region1107
-chr3	S-MART	transcript	26723251	26773250	.	+	.	nbElements=0;ID=region1108;Name=region1108
-chr3	S-MART	transcript	26773201	26823200	.	+	.	nbElements=0;ID=region1109;Name=region1109
-chr3	S-MART	transcript	26823151	26873150	.	+	.	nbElements=0;ID=region1110;Name=region1110
-chr3	S-MART	transcript	26873101	26923100	.	+	.	nbElements=0;ID=region1111;Name=region1111
-chr3	S-MART	transcript	26923051	26973050	.	+	.	nbElements=0;ID=region1112;Name=region1112
-chr3	S-MART	transcript	26973001	27023000	.	+	.	nbElements=0;ID=region1113;Name=region1113
-chr3	S-MART	transcript	27022951	27072950	.	+	.	nbElements=0;ID=region1114;Name=region1114
-chr3	S-MART	transcript	27072901	27122900	.	+	.	nbElements=0;ID=region1115;Name=region1115
-chr3	S-MART	transcript	27122851	27172850	.	+	.	nbElements=0;ID=region1116;Name=region1116
-chr3	S-MART	transcript	27172801	27222800	.	+	.	nbElements=0;ID=region1117;Name=region1117
-chr3	S-MART	transcript	27222751	27272750	.	+	.	nbElements=0;ID=region1118;Name=region1118
-chr3	S-MART	transcript	27272701	27322700	.	+	.	nbElements=0;ID=region1119;Name=region1119
-chr3	S-MART	transcript	27322651	27372650	.	+	.	nbElements=0;ID=region1120;Name=region1120
-chr3	S-MART	transcript	27372601	27422600	.	+	.	nbElements=0;ID=region1121;Name=region1121
-chr3	S-MART	transcript	27422551	27472550	.	+	.	nbElements=0;ID=region1122;Name=region1122
-chr3	S-MART	transcript	27472501	27522500	.	+	.	nbElements=0;ID=region1123;Name=region1123
-chr3	S-MART	transcript	27522451	27572450	.	+	.	nbElements=0;ID=region1124;Name=region1124
-chr3	S-MART	transcript	27572401	27622400	.	+	.	nbElements=0;ID=region1125;Name=region1125
-chr3	S-MART	transcript	27622351	27672350	.	+	.	nbElements=0;ID=region1126;Name=region1126
-chr3	S-MART	transcript	27672301	27722300	.	+	.	nbElements=0;ID=region1127;Name=region1127
-chr3	S-MART	transcript	27722251	27772250	.	+	.	nbElements=0;ID=region1128;Name=region1128
-chr3	S-MART	transcript	27772201	27822200	.	+	.	nbElements=0;ID=region1129;Name=region1129
-chr3	S-MART	transcript	27822151	27872150	.	+	.	nbElements=0;ID=region1130;Name=region1130
-chr3	S-MART	transcript	27872101	27922100	.	+	.	nbElements=0;ID=region1131;Name=region1131
-chr3	S-MART	transcript	27922051	27972050	.	+	.	nbElements=0;ID=region1132;Name=region1132
-chr3	S-MART	transcript	27972001	28022000	.	+	.	nbElements=0;ID=region1133;Name=region1133
-chr3	S-MART	transcript	28021951	28071950	.	+	.	nbElements=0;ID=region1134;Name=region1134
-chr3	S-MART	transcript	28071901	28121900	.	+	.	nbElements=0;ID=region1135;Name=region1135
-chr3	S-MART	transcript	28121851	28171850	.	+	.	nbElements=0;ID=region1136;Name=region1136
-chr3	S-MART	transcript	28171801	28221800	.	+	.	nbElements=0;ID=region1137;Name=region1137
-chr3	S-MART	transcript	28221751	28271750	.	+	.	nbElements=0;ID=region1138;Name=region1138
-chr3	S-MART	transcript	28271701	28321700	.	+	.	nbElements=0.333333333333;ID=region1139;Name=region1139
-chr2	S-MART	transcript	1	50000	.	+	.	nbElements=0;ID=region1140;Name=region1140
-chr2	S-MART	transcript	49951	99950	.	+	.	nbElements=0;ID=region1141;Name=region1141
-chr2	S-MART	transcript	99901	149900	.	+	.	nbElements=0;ID=region1142;Name=region1142
-chr2	S-MART	transcript	149851	199850	.	+	.	nbElements=0;ID=region1143;Name=region1143
-chr2	S-MART	transcript	199801	249800	.	+	.	nbElements=0;ID=region1144;Name=region1144
-chr2	S-MART	transcript	249751	299750	.	+	.	nbElements=0;ID=region1145;Name=region1145
-chr2	S-MART	transcript	299701	349700	.	+	.	nbElements=0;ID=region1146;Name=region1146
-chr2	S-MART	transcript	349651	399650	.	+	.	nbElements=0;ID=region1147;Name=region1147
-chr2	S-MART	transcript	399601	449600	.	+	.	nbElements=0;ID=region1148;Name=region1148
-chr2	S-MART	transcript	449551	499550	.	+	.	nbElements=0;ID=region1149;Name=region1149
-chr2	S-MART	transcript	499501	549500	.	+	.	nbElements=0;ID=region1150;Name=region1150
-chr2	S-MART	transcript	549451	599450	.	+	.	nbElements=0;ID=region1151;Name=region1151
-chr2	S-MART	transcript	599401	649400	.	+	.	nbElements=0;ID=region1152;Name=region1152
-chr2	S-MART	transcript	649351	699350	.	+	.	nbElements=0;ID=region1153;Name=region1153
-chr2	S-MART	transcript	699301	749300	.	+	.	nbElements=0;ID=region1154;Name=region1154
-chr2	S-MART	transcript	749251	799250	.	+	.	nbElements=0;ID=region1155;Name=region1155
-chr2	S-MART	transcript	799201	849200	.	+	.	nbElements=0;ID=region1156;Name=region1156
-chr2	S-MART	transcript	849151	899150	.	+	.	nbElements=0;ID=region1157;Name=region1157
-chr2	S-MART	transcript	899101	949100	.	+	.	nbElements=0;ID=region1158;Name=region1158
-chr2	S-MART	transcript	949051	999050	.	+	.	nbElements=0;ID=region1159;Name=region1159
-chr2	S-MART	transcript	999001	1049000	.	+	.	nbElements=0;ID=region1160;Name=region1160
-chr2	S-MART	transcript	1048951	1098950	.	+	.	nbElements=0;ID=region1161;Name=region1161
-chr2	S-MART	transcript	1098901	1148900	.	+	.	nbElements=0;ID=region1162;Name=region1162
-chr2	S-MART	transcript	1148851	1198850	.	+	.	nbElements=0;ID=region1163;Name=region1163
-chr2	S-MART	transcript	1198801	1248800	.	+	.	nbElements=0;ID=region1164;Name=region1164
-chr2	S-MART	transcript	1248751	1298750	.	+	.	nbElements=0;ID=region1165;Name=region1165
-chr2	S-MART	transcript	1298701	1348700	.	+	.	nbElements=0;ID=region1166;Name=region1166
-chr2	S-MART	transcript	1348651	1398650	.	+	.	nbElements=0;ID=region1167;Name=region1167
-chr2	S-MART	transcript	1398601	1448600	.	+	.	nbElements=0;ID=region1168;Name=region1168
-chr2	S-MART	transcript	1448551	1498550	.	+	.	nbElements=0;ID=region1169;Name=region1169
-chr2	S-MART	transcript	1498501	1548500	.	+	.	nbElements=0;ID=region1170;Name=region1170
-chr2	S-MART	transcript	1548451	1598450	.	+	.	nbElements=0;ID=region1171;Name=region1171
-chr2	S-MART	transcript	1598401	1648400	.	+	.	nbElements=0;ID=region1172;Name=region1172
-chr2	S-MART	transcript	1648351	1698350	.	+	.	nbElements=0;ID=region1173;Name=region1173
-chr2	S-MART	transcript	1698301	1748300	.	+	.	nbElements=0;ID=region1174;Name=region1174
-chr2	S-MART	transcript	1748251	1798250	.	+	.	nbElements=0;ID=region1175;Name=region1175
-chr2	S-MART	transcript	1798201	1848200	.	+	.	nbElements=0;ID=region1176;Name=region1176
-chr2	S-MART	transcript	1848151	1898150	.	+	.	nbElements=0;ID=region1177;Name=region1177
-chr2	S-MART	transcript	1898101	1948100	.	+	.	nbElements=0;ID=region1178;Name=region1178
-chr2	S-MART	transcript	1948051	1998050	.	+	.	nbElements=0;ID=region1179;Name=region1179
-chr2	S-MART	transcript	1998001	2048000	.	+	.	nbElements=0;ID=region1180;Name=region1180
-chr2	S-MART	transcript	2047951	2097950	.	+	.	nbElements=0;ID=region1181;Name=region1181
-chr2	S-MART	transcript	2097901	2147900	.	+	.	nbElements=0;ID=region1182;Name=region1182
-chr2	S-MART	transcript	2147851	2197850	.	+	.	nbElements=0;ID=region1183;Name=region1183
-chr2	S-MART	transcript	2197801	2247800	.	+	.	nbElements=0;ID=region1184;Name=region1184
-chr2	S-MART	transcript	2247751	2297750	.	+	.	nbElements=0;ID=region1185;Name=region1185
-chr2	S-MART	transcript	2297701	2347700	.	+	.	nbElements=0;ID=region1186;Name=region1186
-chr2	S-MART	transcript	2347651	2397650	.	+	.	nbElements=0;ID=region1187;Name=region1187
-chr2	S-MART	transcript	2397601	2447600	.	+	.	nbElements=0;ID=region1188;Name=region1188
-chr2	S-MART	transcript	2447551	2497550	.	+	.	nbElements=0;ID=region1189;Name=region1189
-chr2	S-MART	transcript	2497501	2547500	.	+	.	nbElements=0;ID=region1190;Name=region1190
-chr2	S-MART	transcript	2547451	2597450	.	+	.	nbElements=0;ID=region1191;Name=region1191
-chr2	S-MART	transcript	2597401	2647400	.	+	.	nbElements=0;ID=region1192;Name=region1192
-chr2	S-MART	transcript	2647351	2697350	.	+	.	nbElements=0;ID=region1193;Name=region1193
-chr2	S-MART	transcript	2697301	2747300	.	+	.	nbElements=0;ID=region1194;Name=region1194
-chr2	S-MART	transcript	2747251	2797250	.	+	.	nbElements=0;ID=region1195;Name=region1195
-chr2	S-MART	transcript	2797201	2847200	.	+	.	nbElements=0;ID=region1196;Name=region1196
-chr2	S-MART	transcript	2847151	2897150	.	+	.	nbElements=0;ID=region1197;Name=region1197
-chr2	S-MART	transcript	2897101	2947100	.	+	.	nbElements=0;ID=region1198;Name=region1198
-chr2	S-MART	transcript	2947051	2997050	.	+	.	nbElements=0;ID=region1199;Name=region1199
-chr2	S-MART	transcript	2997001	3047000	.	+	.	nbElements=0;ID=region1200;Name=region1200
-chr2	S-MART	transcript	3046951	3096950	.	+	.	nbElements=0;ID=region1201;Name=region1201
-chr2	S-MART	transcript	3096901	3146900	.	+	.	nbElements=0;ID=region1202;Name=region1202
-chr2	S-MART	transcript	3146851	3196850	.	+	.	nbElements=0;ID=region1203;Name=region1203
-chr2	S-MART	transcript	3196801	3246800	.	+	.	nbElements=0;ID=region1204;Name=region1204
-chr2	S-MART	transcript	3246751	3296750	.	+	.	nbElements=0;ID=region1205;Name=region1205
-chr2	S-MART	transcript	3296701	3346700	.	+	.	nbElements=0;ID=region1206;Name=region1206
-chr2	S-MART	transcript	3346651	3396650	.	+	.	nbElements=0;ID=region1207;Name=region1207
-chr2	S-MART	transcript	3396601	3446600	.	+	.	nbElements=0;ID=region1208;Name=region1208
-chr2	S-MART	transcript	3446551	3496550	.	+	.	nbElements=0;ID=region1209;Name=region1209
-chr2	S-MART	transcript	3496501	3546500	.	+	.	nbElements=0;ID=region1210;Name=region1210
-chr2	S-MART	transcript	3546451	3596450	.	+	.	nbElements=0;ID=region1211;Name=region1211
-chr2	S-MART	transcript	3596401	3646400	.	+	.	nbElements=0;ID=region1212;Name=region1212
-chr2	S-MART	transcript	3646351	3696350	.	+	.	nbElements=0;ID=region1213;Name=region1213
-chr2	S-MART	transcript	3696301	3746300	.	+	.	nbElements=0;ID=region1214;Name=region1214
-chr2	S-MART	transcript	3746251	3796250	.	+	.	nbElements=0;ID=region1215;Name=region1215
-chr2	S-MART	transcript	3796201	3846200	.	+	.	nbElements=0;ID=region1216;Name=region1216
-chr2	S-MART	transcript	3846151	3896150	.	+	.	nbElements=0;ID=region1217;Name=region1217
-chr2	S-MART	transcript	3896101	3946100	.	+	.	nbElements=0;ID=region1218;Name=region1218
-chr2	S-MART	transcript	3946051	3996050	.	+	.	nbElements=0;ID=region1219;Name=region1219
-chr2	S-MART	transcript	3996001	4046000	.	+	.	nbElements=0;ID=region1220;Name=region1220
-chr2	S-MART	transcript	4045951	4095950	.	+	.	nbElements=0;ID=region1221;Name=region1221
-chr2	S-MART	transcript	4095901	4145900	.	+	.	nbElements=0;ID=region1222;Name=region1222
-chr2	S-MART	transcript	4145851	4195850	.	+	.	nbElements=0;ID=region1223;Name=region1223
-chr2	S-MART	transcript	4195801	4245800	.	+	.	nbElements=0;ID=region1224;Name=region1224
-chr2	S-MART	transcript	4245751	4295750	.	+	.	nbElements=0;ID=region1225;Name=region1225
-chr2	S-MART	transcript	4295701	4345700	.	+	.	nbElements=0;ID=region1226;Name=region1226
-chr2	S-MART	transcript	4345651	4395650	.	+	.	nbElements=0;ID=region1227;Name=region1227
-chr2	S-MART	transcript	4395601	4445600	.	+	.	nbElements=0;ID=region1228;Name=region1228
-chr2	S-MART	transcript	4445551	4495550	.	+	.	nbElements=0;ID=region1229;Name=region1229
-chr2	S-MART	transcript	4495501	4545500	.	+	.	nbElements=0;ID=region1230;Name=region1230
-chr2	S-MART	transcript	4545451	4595450	.	+	.	nbElements=0;ID=region1231;Name=region1231
-chr2	S-MART	transcript	4595401	4645400	.	+	.	nbElements=0;ID=region1232;Name=region1232
-chr2	S-MART	transcript	4645351	4695350	.	+	.	nbElements=0;ID=region1233;Name=region1233
-chr2	S-MART	transcript	4695301	4745300	.	+	.	nbElements=0;ID=region1234;Name=region1234
-chr2	S-MART	transcript	4745251	4795250	.	+	.	nbElements=0;ID=region1235;Name=region1235
-chr2	S-MART	transcript	4795201	4845200	.	+	.	nbElements=0;ID=region1236;Name=region1236
-chr2	S-MART	transcript	4845151	4895150	.	+	.	nbElements=0;ID=region1237;Name=region1237
-chr2	S-MART	transcript	4895101	4945100	.	+	.	nbElements=0;ID=region1238;Name=region1238
-chr2	S-MART	transcript	4945051	4995050	.	+	.	nbElements=0;ID=region1239;Name=region1239
-chr2	S-MART	transcript	4995001	5045000	.	+	.	nbElements=0;ID=region1240;Name=region1240
-chr2	S-MART	transcript	5044951	5094950	.	+	.	nbElements=0;ID=region1241;Name=region1241
-chr2	S-MART	transcript	5094901	5144900	.	+	.	nbElements=0;ID=region1242;Name=region1242
-chr2	S-MART	transcript	5144851	5194850	.	+	.	nbElements=0;ID=region1243;Name=region1243
-chr2	S-MART	transcript	5194801	5244800	.	+	.	nbElements=0;ID=region1244;Name=region1244
-chr2	S-MART	transcript	5244751	5294750	.	+	.	nbElements=0;ID=region1245;Name=region1245
-chr2	S-MART	transcript	5294701	5344700	.	+	.	nbElements=0;ID=region1246;Name=region1246
-chr2	S-MART	transcript	5344651	5394650	.	+	.	nbElements=0;ID=region1247;Name=region1247
-chr2	S-MART	transcript	5394601	5444600	.	+	.	nbElements=0;ID=region1248;Name=region1248
-chr2	S-MART	transcript	5444551	5494550	.	+	.	nbElements=0;ID=region1249;Name=region1249
-chr2	S-MART	transcript	5494501	5544500	.	+	.	nbElements=0;ID=region1250;Name=region1250
-chr2	S-MART	transcript	5544451	5594450	.	+	.	nbElements=0;ID=region1251;Name=region1251
-chr2	S-MART	transcript	5594401	5644400	.	+	.	nbElements=0;ID=region1252;Name=region1252
-chr2	S-MART	transcript	5644351	5694350	.	+	.	nbElements=0;ID=region1253;Name=region1253
-chr2	S-MART	transcript	5694301	5744300	.	+	.	nbElements=0;ID=region1254;Name=region1254
-chr2	S-MART	transcript	5744251	5794250	.	+	.	nbElements=0;ID=region1255;Name=region1255
-chr2	S-MART	transcript	5794201	5844200	.	+	.	nbElements=0;ID=region1256;Name=region1256
-chr2	S-MART	transcript	5844151	5894150	.	+	.	nbElements=0;ID=region1257;Name=region1257
-chr2	S-MART	transcript	5894101	5944100	.	+	.	nbElements=0;ID=region1258;Name=region1258
-chr2	S-MART	transcript	5944051	5994050	.	+	.	nbElements=0;ID=region1259;Name=region1259
-chr2	S-MART	transcript	5994001	6044000	.	+	.	nbElements=0;ID=region1260;Name=region1260
-chr2	S-MART	transcript	6043951	6093950	.	+	.	nbElements=0;ID=region1261;Name=region1261
-chr2	S-MART	transcript	6093901	6143900	.	+	.	nbElements=0;ID=region1262;Name=region1262
-chr2	S-MART	transcript	6143851	6193850	.	+	.	nbElements=0;ID=region1263;Name=region1263
-chr2	S-MART	transcript	6193801	6243800	.	+	.	nbElements=0;ID=region1264;Name=region1264
-chr2	S-MART	transcript	6243751	6293750	.	+	.	nbElements=0;ID=region1265;Name=region1265
-chr2	S-MART	transcript	6293701	6343700	.	+	.	nbElements=0;ID=region1266;Name=region1266
-chr2	S-MART	transcript	6343651	6393650	.	+	.	nbElements=0;ID=region1267;Name=region1267
-chr2	S-MART	transcript	6393601	6443600	.	+	.	nbElements=0;ID=region1268;Name=region1268
-chr2	S-MART	transcript	6443551	6493550	.	+	.	nbElements=0;ID=region1269;Name=region1269
-chr2	S-MART	transcript	6493501	6543500	.	+	.	nbElements=0;ID=region1270;Name=region1270
-chr2	S-MART	transcript	6543451	6593450	.	+	.	nbElements=0;ID=region1271;Name=region1271
-chr2	S-MART	transcript	6593401	6643400	.	+	.	nbElements=0;ID=region1272;Name=region1272
-chr2	S-MART	transcript	6643351	6693350	.	+	.	nbElements=0;ID=region1273;Name=region1273
-chr2	S-MART	transcript	6693301	6743300	.	+	.	nbElements=0;ID=region1274;Name=region1274
-chr2	S-MART	transcript	6743251	6793250	.	+	.	nbElements=0;ID=region1275;Name=region1275
-chr2	S-MART	transcript	6793201	6843200	.	+	.	nbElements=0;ID=region1276;Name=region1276
-chr2	S-MART	transcript	6843151	6893150	.	+	.	nbElements=0;ID=region1277;Name=region1277
-chr2	S-MART	transcript	6893101	6943100	.	+	.	nbElements=0;ID=region1278;Name=region1278
-chr2	S-MART	transcript	6943051	6993050	.	+	.	nbElements=0;ID=region1279;Name=region1279
-chr2	S-MART	transcript	6993001	7043000	.	+	.	nbElements=0;ID=region1280;Name=region1280
-chr2	S-MART	transcript	7042951	7092950	.	+	.	nbElements=0;ID=region1281;Name=region1281
-chr2	S-MART	transcript	7092901	7142900	.	+	.	nbElements=0;ID=region1282;Name=region1282
-chr2	S-MART	transcript	7142851	7192850	.	+	.	nbElements=0;ID=region1283;Name=region1283
-chr2	S-MART	transcript	7192801	7242800	.	+	.	nbElements=0;ID=region1284;Name=region1284
-chr2	S-MART	transcript	7242751	7292750	.	+	.	nbElements=0;ID=region1285;Name=region1285
-chr2	S-MART	transcript	7292701	7342700	.	+	.	nbElements=0;ID=region1286;Name=region1286
-chr2	S-MART	transcript	7342651	7392650	.	+	.	nbElements=0;ID=region1287;Name=region1287
-chr2	S-MART	transcript	7392601	7442600	.	+	.	nbElements=0;ID=region1288;Name=region1288
-chr2	S-MART	transcript	7442551	7492550	.	+	.	nbElements=0;ID=region1289;Name=region1289
-chr2	S-MART	transcript	7492501	7542500	.	+	.	nbElements=0;ID=region1290;Name=region1290
-chr2	S-MART	transcript	7542451	7592450	.	+	.	nbElements=0;ID=region1291;Name=region1291
-chr2	S-MART	transcript	7592401	7642400	.	+	.	nbElements=0;ID=region1292;Name=region1292
-chr2	S-MART	transcript	7642351	7692350	.	+	.	nbElements=0;ID=region1293;Name=region1293
-chr2	S-MART	transcript	7692301	7742300	.	+	.	nbElements=0;ID=region1294;Name=region1294
-chr2	S-MART	transcript	7742251	7792250	.	+	.	nbElements=0;ID=region1295;Name=region1295
-chr2	S-MART	transcript	7792201	7842200	.	+	.	nbElements=0;ID=region1296;Name=region1296
-chr2	S-MART	transcript	7842151	7892150	.	+	.	nbElements=0;ID=region1297;Name=region1297
-chr2	S-MART	transcript	7892101	7942100	.	+	.	nbElements=0;ID=region1298;Name=region1298
-chr2	S-MART	transcript	7942051	7992050	.	+	.	nbElements=0;ID=region1299;Name=region1299
-chr2	S-MART	transcript	7992001	8042000	.	+	.	nbElements=0;ID=region1300;Name=region1300
-chr2	S-MART	transcript	8041951	8091950	.	+	.	nbElements=0;ID=region1301;Name=region1301
-chr2	S-MART	transcript	8091901	8141900	.	+	.	nbElements=0;ID=region1302;Name=region1302
-chr2	S-MART	transcript	8141851	8191850	.	+	.	nbElements=0;ID=region1303;Name=region1303
-chr2	S-MART	transcript	8191801	8241800	.	+	.	nbElements=0;ID=region1304;Name=region1304
-chr2	S-MART	transcript	8241751	8291750	.	+	.	nbElements=0;ID=region1305;Name=region1305
-chr2	S-MART	transcript	8291701	8341700	.	+	.	nbElements=0;ID=region1306;Name=region1306
-chr2	S-MART	transcript	8341651	8391650	.	+	.	nbElements=0;ID=region1307;Name=region1307
-chr2	S-MART	transcript	8391601	8441600	.	+	.	nbElements=0;ID=region1308;Name=region1308
-chr2	S-MART	transcript	8441551	8491550	.	+	.	nbElements=0;ID=region1309;Name=region1309
-chr2	S-MART	transcript	8491501	8541500	.	+	.	nbElements=0;ID=region1310;Name=region1310
-chr2	S-MART	transcript	8541451	8591450	.	+	.	nbElements=0;ID=region1311;Name=region1311
-chr2	S-MART	transcript	8591401	8641400	.	+	.	nbElements=0;ID=region1312;Name=region1312
-chr2	S-MART	transcript	8641351	8691350	.	+	.	nbElements=0;ID=region1313;Name=region1313
-chr2	S-MART	transcript	8691301	8741300	.	+	.	nbElements=0;ID=region1314;Name=region1314
-chr2	S-MART	transcript	8741251	8791250	.	+	.	nbElements=0;ID=region1315;Name=region1315
-chr2	S-MART	transcript	8791201	8841200	.	+	.	nbElements=0;ID=region1316;Name=region1316
-chr2	S-MART	transcript	8841151	8891150	.	+	.	nbElements=0;ID=region1317;Name=region1317
-chr2	S-MART	transcript	8891101	8941100	.	+	.	nbElements=0;ID=region1318;Name=region1318
-chr2	S-MART	transcript	8941051	8991050	.	+	.	nbElements=0;ID=region1319;Name=region1319
-chr2	S-MART	transcript	8991001	9041000	.	+	.	nbElements=0;ID=region1320;Name=region1320
-chr2	S-MART	transcript	9040951	9090950	.	+	.	nbElements=0;ID=region1321;Name=region1321
-chr2	S-MART	transcript	9090901	9140900	.	+	.	nbElements=0;ID=region1322;Name=region1322
-chr2	S-MART	transcript	9140851	9190850	.	+	.	nbElements=0;ID=region1323;Name=region1323
-chr2	S-MART	transcript	9190801	9240800	.	+	.	nbElements=0;ID=region1324;Name=region1324
-chr2	S-MART	transcript	9240751	9290750	.	+	.	nbElements=0;ID=region1325;Name=region1325
-chr2	S-MART	transcript	9290701	9340700	.	+	.	nbElements=0;ID=region1326;Name=region1326
-chr2	S-MART	transcript	9340651	9390650	.	+	.	nbElements=0;ID=region1327;Name=region1327
-chr2	S-MART	transcript	9390601	9440600	.	+	.	nbElements=0;ID=region1328;Name=region1328
-chr2	S-MART	transcript	9440551	9490550	.	+	.	nbElements=0;ID=region1329;Name=region1329
-chr2	S-MART	transcript	9490501	9540500	.	+	.	nbElements=0;ID=region1330;Name=region1330
-chr2	S-MART	transcript	9540451	9590450	.	+	.	nbElements=0;ID=region1331;Name=region1331
-chr2	S-MART	transcript	9590401	9640400	.	+	.	nbElements=0;ID=region1332;Name=region1332
-chr2	S-MART	transcript	9640351	9690350	.	+	.	nbElements=0;ID=region1333;Name=region1333
-chr2	S-MART	transcript	9690301	9740300	.	+	.	nbElements=0;ID=region1334;Name=region1334
-chr2	S-MART	transcript	9740251	9790250	.	+	.	nbElements=0;ID=region1335;Name=region1335
-chr2	S-MART	transcript	9790201	9840200	.	+	.	nbElements=0;ID=region1336;Name=region1336
-chr2	S-MART	transcript	9840151	9890150	.	+	.	nbElements=0;ID=region1337;Name=region1337
-chr2	S-MART	transcript	9890101	9940100	.	+	.	nbElements=0;ID=region1338;Name=region1338
-chr2	S-MART	transcript	9940051	9990050	.	+	.	nbElements=0;ID=region1339;Name=region1339
-chr2	S-MART	transcript	9990001	10040000	.	+	.	nbElements=0;ID=region1340;Name=region1340
-chr2	S-MART	transcript	10039951	10089950	.	+	.	nbElements=0;ID=region1341;Name=region1341
-chr2	S-MART	transcript	10089901	10139900	.	+	.	nbElements=0;ID=region1342;Name=region1342
-chr2	S-MART	transcript	10139851	10189850	.	+	.	nbElements=0;ID=region1343;Name=region1343
-chr2	S-MART	transcript	10189801	10239800	.	+	.	nbElements=0;ID=region1344;Name=region1344
-chr2	S-MART	transcript	10239751	10289750	.	+	.	nbElements=0;ID=region1345;Name=region1345
-chr2	S-MART	transcript	10289701	10339700	.	+	.	nbElements=0;ID=region1346;Name=region1346
-chr2	S-MART	transcript	10339651	10389650	.	+	.	nbElements=0;ID=region1347;Name=region1347
-chr2	S-MART	transcript	10389601	10439600	.	+	.	nbElements=0;ID=region1348;Name=region1348
-chr2	S-MART	transcript	10439551	10489550	.	+	.	nbElements=0;ID=region1349;Name=region1349
-chr2	S-MART	transcript	10489501	10539500	.	+	.	nbElements=0;ID=region1350;Name=region1350
-chr2	S-MART	transcript	10539451	10589450	.	+	.	nbElements=0;ID=region1351;Name=region1351
-chr2	S-MART	transcript	10589401	10639400	.	+	.	nbElements=0;ID=region1352;Name=region1352
-chr2	S-MART	transcript	10639351	10689350	.	+	.	nbElements=0;ID=region1353;Name=region1353
-chr2	S-MART	transcript	10689301	10739300	.	+	.	nbElements=0;ID=region1354;Name=region1354
-chr2	S-MART	transcript	10739251	10789250	.	+	.	nbElements=0;ID=region1355;Name=region1355
-chr2	S-MART	transcript	10789201	10839200	.	+	.	nbElements=0;ID=region1356;Name=region1356
-chr2	S-MART	transcript	10839151	10889150	.	+	.	nbElements=0;ID=region1357;Name=region1357
-chr2	S-MART	transcript	10889101	10939100	.	+	.	nbElements=0;ID=region1358;Name=region1358
-chr2	S-MART	transcript	10939051	10989050	.	+	.	nbElements=0;ID=region1359;Name=region1359
-chr2	S-MART	transcript	10989001	11039000	.	+	.	nbElements=0;ID=region1360;Name=region1360
-chr2	S-MART	transcript	11038951	11088950	.	+	.	nbElements=0;ID=region1361;Name=region1361
-chr2	S-MART	transcript	11088901	11138900	.	+	.	nbElements=0;ID=region1362;Name=region1362
-chr2	S-MART	transcript	11138851	11188850	.	+	.	nbElements=0;ID=region1363;Name=region1363
-chr2	S-MART	transcript	11188801	11238800	.	+	.	nbElements=0;ID=region1364;Name=region1364
-chr2	S-MART	transcript	11238751	11288750	.	+	.	nbElements=0;ID=region1365;Name=region1365
-chr2	S-MART	transcript	11288701	11338700	.	+	.	nbElements=0;ID=region1366;Name=region1366
-chr2	S-MART	transcript	11338651	11388650	.	+	.	nbElements=0;ID=region1367;Name=region1367
-chr2	S-MART	transcript	11388601	11438600	.	+	.	nbElements=0;ID=region1368;Name=region1368
-chr2	S-MART	transcript	11438551	11488550	.	+	.	nbElements=0;ID=region1369;Name=region1369
-chr2	S-MART	transcript	11488501	11538500	.	+	.	nbElements=0;ID=region1370;Name=region1370
-chr2	S-MART	transcript	11538451	11588450	.	+	.	nbElements=0;ID=region1371;Name=region1371
-chr2	S-MART	transcript	11588401	11638400	.	+	.	nbElements=0;ID=region1372;Name=region1372
-chr2	S-MART	transcript	11638351	11688350	.	+	.	nbElements=0;ID=region1373;Name=region1373
-chr2	S-MART	transcript	11688301	11738300	.	+	.	nbElements=0;ID=region1374;Name=region1374
-chr2	S-MART	transcript	11738251	11788250	.	+	.	nbElements=0;ID=region1375;Name=region1375
-chr2	S-MART	transcript	11788201	11838200	.	+	.	nbElements=0;ID=region1376;Name=region1376
-chr2	S-MART	transcript	11838151	11888150	.	+	.	nbElements=0;ID=region1377;Name=region1377
-chr2	S-MART	transcript	11888101	11938100	.	+	.	nbElements=0;ID=region1378;Name=region1378
-chr2	S-MART	transcript	11938051	11988050	.	+	.	nbElements=0;ID=region1379;Name=region1379
-chr2	S-MART	transcript	11988001	12038000	.	+	.	nbElements=0;ID=region1380;Name=region1380
-chr2	S-MART	transcript	12037951	12087950	.	+	.	nbElements=0;ID=region1381;Name=region1381
-chr2	S-MART	transcript	12087901	12137900	.	+	.	nbElements=0;ID=region1382;Name=region1382
-chr2	S-MART	transcript	12137851	12187850	.	+	.	nbElements=0;ID=region1383;Name=region1383
-chr2	S-MART	transcript	12187801	12237800	.	+	.	nbElements=0;ID=region1384;Name=region1384
-chr2	S-MART	transcript	12237751	12287750	.	+	.	nbElements=0;ID=region1385;Name=region1385
-chr2	S-MART	transcript	12287701	12337700	.	+	.	nbElements=0;ID=region1386;Name=region1386
-chr2	S-MART	transcript	12337651	12387650	.	+	.	nbElements=0;ID=region1387;Name=region1387
-chr2	S-MART	transcript	12387601	12437600	.	+	.	nbElements=0;ID=region1388;Name=region1388
-chr2	S-MART	transcript	12437551	12487550	.	+	.	nbElements=0;ID=region1389;Name=region1389
-chr2	S-MART	transcript	12487501	12537500	.	+	.	nbElements=0;ID=region1390;Name=region1390
-chr2	S-MART	transcript	12537451	12587450	.	+	.	nbElements=0;ID=region1391;Name=region1391
-chr2	S-MART	transcript	12587401	12637400	.	+	.	nbElements=0;ID=region1392;Name=region1392
-chr2	S-MART	transcript	12637351	12687350	.	+	.	nbElements=0;ID=region1393;Name=region1393
-chr2	S-MART	transcript	12687301	12737300	.	+	.	nbElements=0;ID=region1394;Name=region1394
-chr2	S-MART	transcript	12737251	12787250	.	+	.	nbElements=0;ID=region1395;Name=region1395
-chr2	S-MART	transcript	12787201	12837200	.	+	.	nbElements=0;ID=region1396;Name=region1396
-chr2	S-MART	transcript	12837151	12887150	.	+	.	nbElements=0;ID=region1397;Name=region1397
-chr2	S-MART	transcript	12887101	12937100	.	+	.	nbElements=0;ID=region1398;Name=region1398
-chr2	S-MART	transcript	12937051	12987050	.	+	.	nbElements=0;ID=region1399;Name=region1399
-chr2	S-MART	transcript	12987001	13037000	.	+	.	nbElements=0;ID=region1400;Name=region1400
-chr2	S-MART	transcript	13036951	13086950	.	+	.	nbElements=0;ID=region1401;Name=region1401
-chr2	S-MART	transcript	13086901	13136900	.	+	.	nbElements=0;ID=region1402;Name=region1402
-chr2	S-MART	transcript	13136851	13186850	.	+	.	nbElements=0;ID=region1403;Name=region1403
-chr2	S-MART	transcript	13186801	13236800	.	+	.	nbElements=0;ID=region1404;Name=region1404
-chr2	S-MART	transcript	13236751	13286750	.	+	.	nbElements=0;ID=region1405;Name=region1405
-chr2	S-MART	transcript	13286701	13336700	.	+	.	nbElements=0;ID=region1406;Name=region1406
-chr2	S-MART	transcript	13336651	13386650	.	+	.	nbElements=0;ID=region1407;Name=region1407
-chr2	S-MART	transcript	13386601	13436600	.	+	.	nbElements=0;ID=region1408;Name=region1408
-chr2	S-MART	transcript	13436551	13486550	.	+	.	nbElements=0;ID=region1409;Name=region1409
-chr2	S-MART	transcript	13486501	13536500	.	+	.	nbElements=0;ID=region1410;Name=region1410
-chr2	S-MART	transcript	13536451	13586450	.	+	.	nbElements=0;ID=region1411;Name=region1411
-chr2	S-MART	transcript	13586401	13636400	.	+	.	nbElements=0;ID=region1412;Name=region1412
-chr2	S-MART	transcript	13636351	13686350	.	+	.	nbElements=0;ID=region1413;Name=region1413
-chr2	S-MART	transcript	13686301	13736300	.	+	.	nbElements=0;ID=region1414;Name=region1414
-chr2	S-MART	transcript	13736251	13786250	.	+	.	nbElements=0;ID=region1415;Name=region1415
-chr2	S-MART	transcript	13786201	13836200	.	+	.	nbElements=0;ID=region1416;Name=region1416
-chr2	S-MART	transcript	13836151	13886150	.	+	.	nbElements=0;ID=region1417;Name=region1417
-chr2	S-MART	transcript	13886101	13936100	.	+	.	nbElements=0;ID=region1418;Name=region1418
-chr2	S-MART	transcript	13936051	13986050	.	+	.	nbElements=0;ID=region1419;Name=region1419
-chr2	S-MART	transcript	13986001	14036000	.	+	.	nbElements=0;ID=region1420;Name=region1420
-chr2	S-MART	transcript	14035951	14085950	.	+	.	nbElements=0;ID=region1421;Name=region1421
-chr2	S-MART	transcript	14085901	14135900	.	+	.	nbElements=0;ID=region1422;Name=region1422
-chr2	S-MART	transcript	14135851	14185850	.	+	.	nbElements=0;ID=region1423;Name=region1423
-chr2	S-MART	transcript	14185801	14235800	.	+	.	nbElements=0;ID=region1424;Name=region1424
-chr2	S-MART	transcript	14235751	14285750	.	+	.	nbElements=0;ID=region1425;Name=region1425
-chr2	S-MART	transcript	14285701	14335700	.	+	.	nbElements=0;ID=region1426;Name=region1426
-chr2	S-MART	transcript	14335651	14385650	.	+	.	nbElements=0;ID=region1427;Name=region1427
-chr2	S-MART	transcript	14385601	14435600	.	+	.	nbElements=0;ID=region1428;Name=region1428
-chr2	S-MART	transcript	14435551	14485550	.	+	.	nbElements=0;ID=region1429;Name=region1429
-chr2	S-MART	transcript	14485501	14535500	.	+	.	nbElements=0;ID=region1430;Name=region1430
-chr2	S-MART	transcript	14535451	14585450	.	+	.	nbElements=0;ID=region1431;Name=region1431
-chr2	S-MART	transcript	14585401	14635400	.	+	.	nbElements=0;ID=region1432;Name=region1432
-chr2	S-MART	transcript	14635351	14685350	.	+	.	nbElements=0;ID=region1433;Name=region1433
-chr2	S-MART	transcript	14685301	14735300	.	+	.	nbElements=0;ID=region1434;Name=region1434
-chr2	S-MART	transcript	14735251	14785250	.	+	.	nbElements=0;ID=region1435;Name=region1435
-chr2	S-MART	transcript	14785201	14835200	.	+	.	nbElements=0;ID=region1436;Name=region1436
-chr2	S-MART	transcript	14835151	14885150	.	+	.	nbElements=0;ID=region1437;Name=region1437
-chr2	S-MART	transcript	14885101	14935100	.	+	.	nbElements=0;ID=region1438;Name=region1438
-chr2	S-MART	transcript	14935051	14985050	.	+	.	nbElements=0;ID=region1439;Name=region1439
-chr2	S-MART	transcript	14985001	15035000	.	+	.	nbElements=0;ID=region1440;Name=region1440
-chr2	S-MART	transcript	15034951	15084950	.	+	.	nbElements=0;ID=region1441;Name=region1441
-chr2	S-MART	transcript	15084901	15134900	.	+	.	nbElements=0;ID=region1442;Name=region1442
-chr2	S-MART	transcript	15134851	15184850	.	+	.	nbElements=0;ID=region1443;Name=region1443
-chr2	S-MART	transcript	15184801	15234800	.	+	.	nbElements=0;ID=region1444;Name=region1444
-chr2	S-MART	transcript	15234751	15284750	.	+	.	nbElements=0;ID=region1445;Name=region1445
-chr2	S-MART	transcript	15284701	15334700	.	+	.	nbElements=0;ID=region1446;Name=region1446
-chr2	S-MART	transcript	15334651	15384650	.	+	.	nbElements=0;ID=region1447;Name=region1447
-chr2	S-MART	transcript	15384601	15434600	.	+	.	nbElements=0;ID=region1448;Name=region1448
-chr2	S-MART	transcript	15434551	15484550	.	+	.	nbElements=0;ID=region1449;Name=region1449
-chr2	S-MART	transcript	15484501	15534500	.	+	.	nbElements=0;ID=region1450;Name=region1450
-chr2	S-MART	transcript	15534451	15584450	.	+	.	nbElements=0;ID=region1451;Name=region1451
-chr2	S-MART	transcript	15584401	15634400	.	+	.	nbElements=0;ID=region1452;Name=region1452
-chr2	S-MART	transcript	15634351	15684350	.	+	.	nbElements=0;ID=region1453;Name=region1453
-chr2	S-MART	transcript	15684301	15734300	.	+	.	nbElements=0;ID=region1454;Name=region1454
-chr2	S-MART	transcript	15734251	15784250	.	+	.	nbElements=0;ID=region1455;Name=region1455
-chr2	S-MART	transcript	15784201	15834200	.	+	.	nbElements=0;ID=region1456;Name=region1456
-chr2	S-MART	transcript	15834151	15884150	.	+	.	nbElements=0;ID=region1457;Name=region1457
-chr2	S-MART	transcript	15884101	15934100	.	+	.	nbElements=0;ID=region1458;Name=region1458
-chr2	S-MART	transcript	15934051	15984050	.	+	.	nbElements=0;ID=region1459;Name=region1459
-chr2	S-MART	transcript	15984001	16034000	.	+	.	nbElements=0;ID=region1460;Name=region1460
-chr2	S-MART	transcript	16033951	16083950	.	+	.	nbElements=0;ID=region1461;Name=region1461
-chr2	S-MART	transcript	16083901	16133900	.	+	.	nbElements=0;ID=region1462;Name=region1462
-chr2	S-MART	transcript	16133851	16183850	.	+	.	nbElements=0;ID=region1463;Name=region1463
-chr2	S-MART	transcript	16183801	16233800	.	+	.	nbElements=0;ID=region1464;Name=region1464
-chr2	S-MART	transcript	16233751	16283750	.	+	.	nbElements=0;ID=region1465;Name=region1465
-chr2	S-MART	transcript	16283701	16333700	.	+	.	nbElements=0;ID=region1466;Name=region1466
-chr2	S-MART	transcript	16333651	16383650	.	+	.	nbElements=0;ID=region1467;Name=region1467
-chr2	S-MART	transcript	16383601	16433600	.	+	.	nbElements=0;ID=region1468;Name=region1468
-chr2	S-MART	transcript	16433551	16483550	.	+	.	nbElements=0;ID=region1469;Name=region1469
-chr2	S-MART	transcript	16483501	16533500	.	+	.	nbElements=0;ID=region1470;Name=region1470
-chr2	S-MART	transcript	16533451	16583450	.	+	.	nbElements=0;ID=region1471;Name=region1471
-chr2	S-MART	transcript	16583401	16633400	.	+	.	nbElements=0;ID=region1472;Name=region1472
-chr2	S-MART	transcript	16633351	16683350	.	+	.	nbElements=0;ID=region1473;Name=region1473
-chr2	S-MART	transcript	16683301	16733300	.	+	.	nbElements=0;ID=region1474;Name=region1474
-chr2	S-MART	transcript	16733251	16783250	.	+	.	nbElements=0;ID=region1475;Name=region1475
-chr2	S-MART	transcript	16783201	16833200	.	+	.	nbElements=0;ID=region1476;Name=region1476
-chr2	S-MART	transcript	16833151	16883150	.	+	.	nbElements=0;ID=region1477;Name=region1477
-chr2	S-MART	transcript	16883101	16933100	.	+	.	nbElements=0;ID=region1478;Name=region1478
-chr2	S-MART	transcript	16933051	16983050	.	+	.	nbElements=0;ID=region1479;Name=region1479
-chr2	S-MART	transcript	16983001	17033000	.	+	.	nbElements=0;ID=region1480;Name=region1480
-chr2	S-MART	transcript	17032951	17082950	.	+	.	nbElements=0;ID=region1481;Name=region1481
-chr2	S-MART	transcript	17082901	17132900	.	+	.	nbElements=0;ID=region1482;Name=region1482
-chr2	S-MART	transcript	17132851	17182850	.	+	.	nbElements=0;ID=region1483;Name=region1483
-chr2	S-MART	transcript	17182801	17232800	.	+	.	nbElements=0;ID=region1484;Name=region1484
-chr2	S-MART	transcript	17232751	17282750	.	+	.	nbElements=0;ID=region1485;Name=region1485
-chr2	S-MART	transcript	17282701	17332700	.	+	.	nbElements=0;ID=region1486;Name=region1486
-chr2	S-MART	transcript	17332651	17382650	.	+	.	nbElements=0;ID=region1487;Name=region1487
-chr2	S-MART	transcript	17382601	17432600	.	+	.	nbElements=0;ID=region1488;Name=region1488
-chr2	S-MART	transcript	17432551	17482550	.	+	.	nbElements=0;ID=region1489;Name=region1489
-chr2	S-MART	transcript	17482501	17532500	.	+	.	nbElements=0;ID=region1490;Name=region1490
-chr2	S-MART	transcript	17532451	17582450	.	+	.	nbElements=0;ID=region1491;Name=region1491
-chr2	S-MART	transcript	17582401	17632400	.	+	.	nbElements=0;ID=region1492;Name=region1492
-chr2	S-MART	transcript	17632351	17682350	.	+	.	nbElements=0;ID=region1493;Name=region1493
-chr2	S-MART	transcript	17682301	17732300	.	+	.	nbElements=0;ID=region1494;Name=region1494
-chr2	S-MART	transcript	17732251	17782250	.	+	.	nbElements=0;ID=region1495;Name=region1495
-chr2	S-MART	transcript	17782201	17832200	.	+	.	nbElements=0;ID=region1496;Name=region1496
-chr2	S-MART	transcript	17832151	17882150	.	+	.	nbElements=0;ID=region1497;Name=region1497
-chr2	S-MART	transcript	17882101	17932100	.	+	.	nbElements=0;ID=region1498;Name=region1498
-chr2	S-MART	transcript	17932051	17982050	.	+	.	nbElements=0;ID=region1499;Name=region1499
-chr2	S-MART	transcript	17982001	18032000	.	+	.	nbElements=0;ID=region1500;Name=region1500
-chr2	S-MART	transcript	18031951	18081950	.	+	.	nbElements=0;ID=region1501;Name=region1501
-chr2	S-MART	transcript	18081901	18131900	.	+	.	nbElements=0;ID=region1502;Name=region1502
-chr2	S-MART	transcript	18131851	18181850	.	+	.	nbElements=0;ID=region1503;Name=region1503
-chr2	S-MART	transcript	18181801	18231800	.	+	.	nbElements=0;ID=region1504;Name=region1504
-chr2	S-MART	transcript	18231751	18281750	.	+	.	nbElements=0;ID=region1505;Name=region1505
-chr2	S-MART	transcript	18281701	18331700	.	+	.	nbElements=0;ID=region1506;Name=region1506
-chr2	S-MART	transcript	18331651	18381650	.	+	.	nbElements=0;ID=region1507;Name=region1507
-chr2	S-MART	transcript	18381601	18431600	.	+	.	nbElements=0;ID=region1508;Name=region1508
-chr2	S-MART	transcript	18431551	18481550	.	+	.	nbElements=0;ID=region1509;Name=region1509
-chr2	S-MART	transcript	18481501	18531500	.	+	.	nbElements=0;ID=region1510;Name=region1510
-chr2	S-MART	transcript	18531451	18581450	.	+	.	nbElements=0;ID=region1511;Name=region1511
-chr2	S-MART	transcript	18581401	18631400	.	+	.	nbElements=0;ID=region1512;Name=region1512
-chr2	S-MART	transcript	18631351	18681350	.	+	.	nbElements=0;ID=region1513;Name=region1513
-chr2	S-MART	transcript	18681301	18731300	.	+	.	nbElements=0;ID=region1514;Name=region1514
-chr2	S-MART	transcript	18731251	18781250	.	+	.	nbElements=0;ID=region1515;Name=region1515
-chr2	S-MART	transcript	18781201	18831200	.	+	.	nbElements=0;ID=region1516;Name=region1516
-chr2	S-MART	transcript	18831151	18881150	.	+	.	nbElements=0;ID=region1517;Name=region1517
-chr2	S-MART	transcript	18881101	18931100	.	+	.	nbElements=0;ID=region1518;Name=region1518
-chr2	S-MART	transcript	18931051	18981050	.	+	.	nbElements=0;ID=region1519;Name=region1519
-chr2	S-MART	transcript	18981001	19031000	.	+	.	nbElements=0;ID=region1520;Name=region1520
-chr2	S-MART	transcript	19030951	19080950	.	+	.	nbElements=0;ID=region1521;Name=region1521
-chr2	S-MART	transcript	19080901	19130900	.	+	.	nbElements=0;ID=region1522;Name=region1522
-chr2	S-MART	transcript	19130851	19180850	.	+	.	nbElements=0;ID=region1523;Name=region1523
-chr2	S-MART	transcript	19180801	19230800	.	+	.	nbElements=0;ID=region1524;Name=region1524
-chr2	S-MART	transcript	19230751	19280750	.	+	.	nbElements=0;ID=region1525;Name=region1525
-chr2	S-MART	transcript	19280701	19330700	.	+	.	nbElements=0;ID=region1526;Name=region1526
-chr2	S-MART	transcript	19330651	19380650	.	+	.	nbElements=0;ID=region1527;Name=region1527
-chr2	S-MART	transcript	19380601	19430600	.	+	.	nbElements=0;ID=region1528;Name=region1528
-chr2	S-MART	transcript	19430551	19480550	.	+	.	nbElements=0;ID=region1529;Name=region1529
-chr2	S-MART	transcript	19480501	19530500	.	+	.	nbElements=0;ID=region1530;Name=region1530
-chr2	S-MART	transcript	19530451	19580450	.	+	.	nbElements=0;ID=region1531;Name=region1531
-chr2	S-MART	transcript	19580401	19630400	.	+	.	nbElements=0;ID=region1532;Name=region1532
-chr2	S-MART	transcript	19630351	19680350	.	+	.	nbElements=0;ID=region1533;Name=region1533
-chr2	S-MART	transcript	19680301	19730300	.	+	.	nbElements=0;ID=region1534;Name=region1534
-chr2	S-MART	transcript	19730251	19780250	.	+	.	nbElements=0;ID=region1535;Name=region1535
-chr2	S-MART	transcript	19780201	19830200	.	+	.	nbElements=0;ID=region1536;Name=region1536
-chr2	S-MART	transcript	19830151	19880150	.	+	.	nbElements=0;ID=region1537;Name=region1537
-chr2	S-MART	transcript	19880101	19930100	.	+	.	nbElements=0;ID=region1538;Name=region1538
-chr2	S-MART	transcript	19930051	19980050	.	+	.	nbElements=0;ID=region1539;Name=region1539
-chr2	S-MART	transcript	19980001	20030000	.	+	.	nbElements=0;ID=region1540;Name=region1540
-chr2	S-MART	transcript	20029951	20079950	.	+	.	nbElements=0;ID=region1541;Name=region1541
-chr2	S-MART	transcript	20079901	20129900	.	+	.	nbElements=0;ID=region1542;Name=region1542
-chr2	S-MART	transcript	20129851	20179850	.	+	.	nbElements=0;ID=region1543;Name=region1543
-chr2	S-MART	transcript	20179801	20229800	.	+	.	nbElements=0;ID=region1544;Name=region1544
-chr2	S-MART	transcript	20229751	20279750	.	+	.	nbElements=0;ID=region1545;Name=region1545
-chr2	S-MART	transcript	20279701	20329700	.	+	.	nbElements=0;ID=region1546;Name=region1546
-chr2	S-MART	transcript	20329651	20379650	.	+	.	nbElements=0;ID=region1547;Name=region1547
-chr2	S-MART	transcript	20379601	20429600	.	+	.	nbElements=0;ID=region1548;Name=region1548
-chr2	S-MART	transcript	20429551	20479550	.	+	.	nbElements=0;ID=region1549;Name=region1549
-chr2	S-MART	transcript	20479501	20529500	.	+	.	nbElements=0;ID=region1550;Name=region1550
-chr2	S-MART	transcript	20529451	20579450	.	+	.	nbElements=0;ID=region1551;Name=region1551
-chr2	S-MART	transcript	20579401	20629400	.	+	.	nbElements=0;ID=region1552;Name=region1552
-chr2	S-MART	transcript	20629351	20679350	.	+	.	nbElements=0;ID=region1553;Name=region1553
-chr2	S-MART	transcript	20679301	20729300	.	+	.	nbElements=0;ID=region1554;Name=region1554
-chr2	S-MART	transcript	20729251	20779250	.	+	.	nbElements=0;ID=region1555;Name=region1555
-chr2	S-MART	transcript	20779201	20829200	.	+	.	nbElements=0;ID=region1556;Name=region1556
-chr2	S-MART	transcript	20829151	20879150	.	+	.	nbElements=0;ID=region1557;Name=region1557
-chr2	S-MART	transcript	20879101	20929100	.	+	.	nbElements=0;ID=region1558;Name=region1558
-chr2	S-MART	transcript	20929051	20979050	.	+	.	nbElements=0;ID=region1559;Name=region1559
-chr2	S-MART	transcript	20979001	21029000	.	+	.	nbElements=0;ID=region1560;Name=region1560
-chr2	S-MART	transcript	21028951	21078950	.	+	.	nbElements=0;ID=region1561;Name=region1561
-chr2	S-MART	transcript	21078901	21128900	.	+	.	nbElements=0;ID=region1562;Name=region1562
-chr2	S-MART	transcript	21128851	21178850	.	+	.	nbElements=0;ID=region1563;Name=region1563
-chr2	S-MART	transcript	21178801	21228800	.	+	.	nbElements=0;ID=region1564;Name=region1564
-chr2	S-MART	transcript	21228751	21278750	.	+	.	nbElements=0;ID=region1565;Name=region1565
-chr2	S-MART	transcript	21278701	21328700	.	+	.	nbElements=0;ID=region1566;Name=region1566
-chr2	S-MART	transcript	21328651	21378650	.	+	.	nbElements=0;ID=region1567;Name=region1567
-chr2	S-MART	transcript	21378601	21428600	.	+	.	nbElements=0;ID=region1568;Name=region1568
-chr2	S-MART	transcript	21428551	21478550	.	+	.	nbElements=0;ID=region1569;Name=region1569
-chr2	S-MART	transcript	21478501	21528500	.	+	.	nbElements=0;ID=region1570;Name=region1570
-chr2	S-MART	transcript	21528451	21578450	.	+	.	nbElements=0;ID=region1571;Name=region1571
-chr2	S-MART	transcript	21578401	21628400	.	+	.	nbElements=0;ID=region1572;Name=region1572
-chr2	S-MART	transcript	21628351	21678350	.	+	.	nbElements=0;ID=region1573;Name=region1573
-chr2	S-MART	transcript	21678301	21728300	.	+	.	nbElements=0;ID=region1574;Name=region1574
-chr2	S-MART	transcript	21728251	21778250	.	+	.	nbElements=0;ID=region1575;Name=region1575
-chr2	S-MART	transcript	21778201	21828200	.	+	.	nbElements=0;ID=region1576;Name=region1576
-chr2	S-MART	transcript	21828151	21878150	.	+	.	nbElements=0;ID=region1577;Name=region1577
-chr2	S-MART	transcript	21878101	21928100	.	+	.	nbElements=0;ID=region1578;Name=region1578
-chr2	S-MART	transcript	21928051	21978050	.	+	.	nbElements=0;ID=region1579;Name=region1579
-chr2	S-MART	transcript	21978001	22028000	.	+	.	nbElements=0;ID=region1580;Name=region1580
-chr2	S-MART	transcript	22027951	22077950	.	+	.	nbElements=0;ID=region1581;Name=region1581
-chr2	S-MART	transcript	22077901	22127900	.	+	.	nbElements=0;ID=region1582;Name=region1582
-chr2	S-MART	transcript	22127851	22177850	.	+	.	nbElements=0;ID=region1583;Name=region1583
-chr2	S-MART	transcript	22177801	22227800	.	+	.	nbElements=0;ID=region1584;Name=region1584
-chr2	S-MART	transcript	22227751	22277750	.	+	.	nbElements=0;ID=region1585;Name=region1585
-chr2	S-MART	transcript	22277701	22327700	.	+	.	nbElements=0;ID=region1586;Name=region1586
-chr2	S-MART	transcript	22327651	22377650	.	+	.	nbElements=0;ID=region1587;Name=region1587
-chr2	S-MART	transcript	22377601	22427600	.	+	.	nbElements=0;ID=region1588;Name=region1588
-chr2	S-MART	transcript	22427551	22477550	.	+	.	nbElements=0;ID=region1589;Name=region1589
-chr2	S-MART	transcript	22477501	22527500	.	+	.	nbElements=0;ID=region1590;Name=region1590
-chr2	S-MART	transcript	22527451	22577450	.	+	.	nbElements=0;ID=region1591;Name=region1591
-chr2	S-MART	transcript	22577401	22627400	.	+	.	nbElements=0;ID=region1592;Name=region1592
-chr2	S-MART	transcript	22627351	22677350	.	+	.	nbElements=0;ID=region1593;Name=region1593
-chr2	S-MART	transcript	22677301	22727300	.	+	.	nbElements=0;ID=region1594;Name=region1594
-chr2	S-MART	transcript	22727251	22777250	.	+	.	nbElements=0;ID=region1595;Name=region1595
-chr2	S-MART	transcript	22777201	22827200	.	+	.	nbElements=0;ID=region1596;Name=region1596
-chr2	S-MART	transcript	22827151	22877150	.	+	.	nbElements=0;ID=region1597;Name=region1597
-chr2	S-MART	transcript	22877101	22927100	.	+	.	nbElements=0;ID=region1598;Name=region1598
-chr2	S-MART	transcript	22927051	22977050	.	+	.	nbElements=0;ID=region1599;Name=region1599
-chr2	S-MART	transcript	22977001	23027000	.	+	.	nbElements=0;ID=region1600;Name=region1600
-chr2	S-MART	transcript	23026951	23076950	.	+	.	nbElements=0;ID=region1601;Name=region1601
-chr2	S-MART	transcript	23076901	23126900	.	+	.	nbElements=0;ID=region1602;Name=region1602
-chr2	S-MART	transcript	23126851	23176850	.	+	.	nbElements=0;ID=region1603;Name=region1603
-chr2	S-MART	transcript	23176801	23226800	.	+	.	nbElements=0;ID=region1604;Name=region1604
-chr2	S-MART	transcript	23226751	23276750	.	+	.	nbElements=0;ID=region1605;Name=region1605
-chr2	S-MART	transcript	23276701	23326700	.	+	.	nbElements=0;ID=region1606;Name=region1606
-chr2	S-MART	transcript	23326651	23376650	.	+	.	nbElements=0;ID=region1607;Name=region1607
-chr2	S-MART	transcript	23376601	23426600	.	+	.	nbElements=0;ID=region1608;Name=region1608
-chr2	S-MART	transcript	23426551	23476550	.	+	.	nbElements=0;ID=region1609;Name=region1609
-chr2	S-MART	transcript	23476501	23526500	.	+	.	nbElements=0;ID=region1610;Name=region1610
-chr2	S-MART	transcript	23526451	23576450	.	+	.	nbElements=0;ID=region1611;Name=region1611
-chr2	S-MART	transcript	23576401	23626400	.	+	.	nbElements=0;ID=region1612;Name=region1612
-chr2	S-MART	transcript	23626351	23676350	.	+	.	nbElements=0;ID=region1613;Name=region1613
-chr2	S-MART	transcript	23676301	23726300	.	+	.	nbElements=0;ID=region1614;Name=region1614
-chr2	S-MART	transcript	23726251	23776250	.	+	.	nbElements=0;ID=region1615;Name=region1615
-chr2	S-MART	transcript	23776201	23826200	.	+	.	nbElements=0;ID=region1616;Name=region1616
-chr2	S-MART	transcript	23826151	23876150	.	+	.	nbElements=0;ID=region1617;Name=region1617
-chr2	S-MART	transcript	23876101	23926100	.	+	.	nbElements=0;ID=region1618;Name=region1618
-chr2	S-MART	transcript	23926051	23976050	.	+	.	nbElements=0;ID=region1619;Name=region1619
-chr2	S-MART	transcript	23976001	24026000	.	+	.	nbElements=0;ID=region1620;Name=region1620
-chr2	S-MART	transcript	24025951	24075950	.	+	.	nbElements=0;ID=region1621;Name=region1621
-chr2	S-MART	transcript	24075901	24125900	.	+	.	nbElements=0;ID=region1622;Name=region1622
-chr2	S-MART	transcript	24125851	24175850	.	+	.	nbElements=0;ID=region1623;Name=region1623
-chr2	S-MART	transcript	24175801	24225800	.	+	.	nbElements=0;ID=region1624;Name=region1624
-chr2	S-MART	transcript	24225751	24275750	.	+	.	nbElements=0;ID=region1625;Name=region1625
-chr2	S-MART	transcript	24275701	24325700	.	+	.	nbElements=0;ID=region1626;Name=region1626
-chr2	S-MART	transcript	24325651	24375650	.	+	.	nbElements=0;ID=region1627;Name=region1627
-chr2	S-MART	transcript	24375601	24425600	.	+	.	nbElements=0;ID=region1628;Name=region1628
-chr2	S-MART	transcript	24425551	24475550	.	+	.	nbElements=0;ID=region1629;Name=region1629
-chr2	S-MART	transcript	24475501	24525500	.	+	.	nbElements=0;ID=region1630;Name=region1630
-chr2	S-MART	transcript	24525451	24575450	.	+	.	nbElements=0;ID=region1631;Name=region1631
-chr2	S-MART	transcript	24575401	24625400	.	+	.	nbElements=0;ID=region1632;Name=region1632
-chr2	S-MART	transcript	24625351	24675350	.	+	.	nbElements=0;ID=region1633;Name=region1633
-chr2	S-MART	transcript	24675301	24725300	.	+	.	nbElements=0;ID=region1634;Name=region1634
-chr2	S-MART	transcript	24725251	24775250	.	+	.	nbElements=0;ID=region1635;Name=region1635
-chr2	S-MART	transcript	24775201	24825200	.	+	.	nbElements=0;ID=region1636;Name=region1636
-chr2	S-MART	transcript	24825151	24875150	.	+	.	nbElements=0;ID=region1637;Name=region1637
-chr2	S-MART	transcript	24875101	24925100	.	+	.	nbElements=0;ID=region1638;Name=region1638
-chr2	S-MART	transcript	24925051	24975050	.	+	.	nbElements=0;ID=region1639;Name=region1639
-chr2	S-MART	transcript	24975001	25025000	.	+	.	nbElements=0;ID=region1640;Name=region1640
-chr2	S-MART	transcript	25024951	25074950	.	+	.	nbElements=0;ID=region1641;Name=region1641
-chr2	S-MART	transcript	25074901	25124900	.	+	.	nbElements=0;ID=region1642;Name=region1642
-chr2	S-MART	transcript	25124851	25174850	.	+	.	nbElements=0;ID=region1643;Name=region1643
-chr2	S-MART	transcript	25174801	25224800	.	+	.	nbElements=0;ID=region1644;Name=region1644
-chr2	S-MART	transcript	25224751	25274750	.	+	.	nbElements=0;ID=region1645;Name=region1645
-chr2	S-MART	transcript	25274701	25324700	.	+	.	nbElements=0;ID=region1646;Name=region1646
-chr2	S-MART	transcript	25324651	25374650	.	+	.	nbElements=0;ID=region1647;Name=region1647
-chr2	S-MART	transcript	25374601	25424600	.	+	.	nbElements=0;ID=region1648;Name=region1648
-chr2	S-MART	transcript	25424551	25474550	.	+	.	nbElements=0;ID=region1649;Name=region1649
-chr2	S-MART	transcript	25474501	25524500	.	+	.	nbElements=0;ID=region1650;Name=region1650
-chr2	S-MART	transcript	25524451	25574450	.	+	.	nbElements=0;ID=region1651;Name=region1651
-chr2	S-MART	transcript	25574401	25624400	.	+	.	nbElements=0;ID=region1652;Name=region1652
-chr2	S-MART	transcript	25624351	25674350	.	+	.	nbElements=0;ID=region1653;Name=region1653
-chr2	S-MART	transcript	25674301	25724300	.	+	.	nbElements=0;ID=region1654;Name=region1654
-chr2	S-MART	transcript	25724251	25774250	.	+	.	nbElements=0;ID=region1655;Name=region1655
-chr2	S-MART	transcript	25774201	25824200	.	+	.	nbElements=0;ID=region1656;Name=region1656
-chr2	S-MART	transcript	25824151	25874150	.	+	.	nbElements=0;ID=region1657;Name=region1657
-chr2	S-MART	transcript	25874101	25924100	.	+	.	nbElements=0;ID=region1658;Name=region1658
-chr2	S-MART	transcript	25924051	25974050	.	+	.	nbElements=0;ID=region1659;Name=region1659
-chr2	S-MART	transcript	25974001	26024000	.	+	.	nbElements=0;ID=region1660;Name=region1660
-chr2	S-MART	transcript	26023951	26073950	.	+	.	nbElements=0;ID=region1661;Name=region1661
-chr2	S-MART	transcript	26073901	26123900	.	+	.	nbElements=0;ID=region1662;Name=region1662
-chr2	S-MART	transcript	26123851	26173850	.	+	.	nbElements=0;ID=region1663;Name=region1663
-chr2	S-MART	transcript	26173801	26223800	.	+	.	nbElements=0;ID=region1664;Name=region1664
-chr2	S-MART	transcript	26223751	26273750	.	+	.	nbElements=0;ID=region1665;Name=region1665
-chr2	S-MART	transcript	26273701	26323700	.	+	.	nbElements=0.333333333333;ID=region1666;Name=region1666
-chr1	S-MART	transcript	1	50000	.	+	.	nbElements=0;ID=region1667;Name=region1667
-chr1	S-MART	transcript	49951	99950	.	+	.	nbElements=0;ID=region1668;Name=region1668
-chr1	S-MART	transcript	99901	149900	.	+	.	nbElements=0;ID=region1669;Name=region1669
-chr1	S-MART	transcript	149851	199850	.	+	.	nbElements=0;ID=region1670;Name=region1670
-chr1	S-MART	transcript	199801	249800	.	+	.	nbElements=0;ID=region1671;Name=region1671
-chr1	S-MART	transcript	249751	299750	.	+	.	nbElements=0;ID=region1672;Name=region1672
-chr1	S-MART	transcript	299701	349700	.	+	.	nbElements=0;ID=region1673;Name=region1673
-chr1	S-MART	transcript	349651	399650	.	+	.	nbElements=0;ID=region1674;Name=region1674
-chr1	S-MART	transcript	399601	449600	.	+	.	nbElements=0;ID=region1675;Name=region1675
-chr1	S-MART	transcript	449551	499550	.	+	.	nbElements=0;ID=region1676;Name=region1676
-chr1	S-MART	transcript	499501	549500	.	+	.	nbElements=0;ID=region1677;Name=region1677
-chr1	S-MART	transcript	549451	599450	.	+	.	nbElements=0;ID=region1678;Name=region1678
-chr1	S-MART	transcript	599401	649400	.	+	.	nbElements=0;ID=region1679;Name=region1679
-chr1	S-MART	transcript	649351	699350	.	+	.	nbElements=0;ID=region1680;Name=region1680
-chr1	S-MART	transcript	699301	749300	.	+	.	nbElements=0;ID=region1681;Name=region1681
-chr1	S-MART	transcript	749251	799250	.	+	.	nbElements=0;ID=region1682;Name=region1682
-chr1	S-MART	transcript	799201	849200	.	+	.	nbElements=0;ID=region1683;Name=region1683
-chr1	S-MART	transcript	849151	899150	.	+	.	nbElements=0;ID=region1684;Name=region1684
-chr1	S-MART	transcript	899101	949100	.	+	.	nbElements=0;ID=region1685;Name=region1685
-chr1	S-MART	transcript	949051	999050	.	+	.	nbElements=0;ID=region1686;Name=region1686
-chr1	S-MART	transcript	999001	1049000	.	+	.	nbElements=0;ID=region1687;Name=region1687
-chr1	S-MART	transcript	1048951	1098950	.	+	.	nbElements=0;ID=region1688;Name=region1688
-chr1	S-MART	transcript	1098901	1148900	.	+	.	nbElements=0;ID=region1689;Name=region1689
-chr1	S-MART	transcript	1148851	1198850	.	+	.	nbElements=0;ID=region1690;Name=region1690
-chr1	S-MART	transcript	1198801	1248800	.	+	.	nbElements=0;ID=region1691;Name=region1691
-chr1	S-MART	transcript	1248751	1298750	.	+	.	nbElements=0;ID=region1692;Name=region1692
-chr1	S-MART	transcript	1298701	1348700	.	+	.	nbElements=0;ID=region1693;Name=region1693
-chr1	S-MART	transcript	1348651	1398650	.	+	.	nbElements=0;ID=region1694;Name=region1694
-chr1	S-MART	transcript	1398601	1448600	.	+	.	nbElements=0;ID=region1695;Name=region1695
-chr1	S-MART	transcript	1448551	1498550	.	+	.	nbElements=0;ID=region1696;Name=region1696
-chr1	S-MART	transcript	1498501	1548500	.	+	.	nbElements=0;ID=region1697;Name=region1697
-chr1	S-MART	transcript	1548451	1598450	.	+	.	nbElements=0;ID=region1698;Name=region1698
-chr1	S-MART	transcript	1598401	1648400	.	+	.	nbElements=0;ID=region1699;Name=region1699
-chr1	S-MART	transcript	1648351	1698350	.	+	.	nbElements=0;ID=region1700;Name=region1700
-chr1	S-MART	transcript	1698301	1748300	.	+	.	nbElements=0;ID=region1701;Name=region1701
-chr1	S-MART	transcript	1748251	1798250	.	+	.	nbElements=0;ID=region1702;Name=region1702
-chr1	S-MART	transcript	1798201	1848200	.	+	.	nbElements=0;ID=region1703;Name=region1703
-chr1	S-MART	transcript	1848151	1898150	.	+	.	nbElements=0;ID=region1704;Name=region1704
-chr1	S-MART	transcript	1898101	1948100	.	+	.	nbElements=0;ID=region1705;Name=region1705
-chr1	S-MART	transcript	1948051	1998050	.	+	.	nbElements=0;ID=region1706;Name=region1706
-chr1	S-MART	transcript	1998001	2048000	.	+	.	nbElements=0;ID=region1707;Name=region1707
-chr1	S-MART	transcript	2047951	2097950	.	+	.	nbElements=0;ID=region1708;Name=region1708
-chr1	S-MART	transcript	2097901	2147900	.	+	.	nbElements=0;ID=region1709;Name=region1709
-chr1	S-MART	transcript	2147851	2197850	.	+	.	nbElements=0;ID=region1710;Name=region1710
-chr1	S-MART	transcript	2197801	2247800	.	+	.	nbElements=0;ID=region1711;Name=region1711
-chr1	S-MART	transcript	2247751	2297750	.	+	.	nbElements=0;ID=region1712;Name=region1712
-chr1	S-MART	transcript	2297701	2347700	.	+	.	nbElements=0;ID=region1713;Name=region1713
-chr1	S-MART	transcript	2347651	2397650	.	+	.	nbElements=0;ID=region1714;Name=region1714
-chr1	S-MART	transcript	2397601	2447600	.	+	.	nbElements=0;ID=region1715;Name=region1715
-chr1	S-MART	transcript	2447551	2497550	.	+	.	nbElements=0;ID=region1716;Name=region1716
-chr1	S-MART	transcript	2497501	2547500	.	+	.	nbElements=0;ID=region1717;Name=region1717
-chr1	S-MART	transcript	2547451	2597450	.	+	.	nbElements=0;ID=region1718;Name=region1718
-chr1	S-MART	transcript	2597401	2647400	.	+	.	nbElements=0;ID=region1719;Name=region1719
-chr1	S-MART	transcript	2647351	2697350	.	+	.	nbElements=0;ID=region1720;Name=region1720
-chr1	S-MART	transcript	2697301	2747300	.	+	.	nbElements=0;ID=region1721;Name=region1721
-chr1	S-MART	transcript	2747251	2797250	.	+	.	nbElements=0;ID=region1722;Name=region1722
-chr1	S-MART	transcript	2797201	2847200	.	+	.	nbElements=0;ID=region1723;Name=region1723
-chr1	S-MART	transcript	2847151	2897150	.	+	.	nbElements=0;ID=region1724;Name=region1724
-chr1	S-MART	transcript	2897101	2947100	.	+	.	nbElements=0;ID=region1725;Name=region1725
-chr1	S-MART	transcript	2947051	2997050	.	+	.	nbElements=0;ID=region1726;Name=region1726
-chr1	S-MART	transcript	2997001	3047000	.	+	.	nbElements=0;ID=region1727;Name=region1727
-chr1	S-MART	transcript	3046951	3096950	.	+	.	nbElements=0;ID=region1728;Name=region1728
-chr1	S-MART	transcript	3096901	3146900	.	+	.	nbElements=0;ID=region1729;Name=region1729
-chr1	S-MART	transcript	3146851	3196850	.	+	.	nbElements=0;ID=region1730;Name=region1730
-chr1	S-MART	transcript	3196801	3246800	.	+	.	nbElements=0;ID=region1731;Name=region1731
-chr1	S-MART	transcript	3246751	3296750	.	+	.	nbElements=0;ID=region1732;Name=region1732
-chr1	S-MART	transcript	3296701	3346700	.	+	.	nbElements=0;ID=region1733;Name=region1733
-chr1	S-MART	transcript	3346651	3396650	.	+	.	nbElements=0;ID=region1734;Name=region1734
-chr1	S-MART	transcript	3396601	3446600	.	+	.	nbElements=0;ID=region1735;Name=region1735
-chr1	S-MART	transcript	3446551	3496550	.	+	.	nbElements=0;ID=region1736;Name=region1736
-chr1	S-MART	transcript	3496501	3546500	.	+	.	nbElements=0;ID=region1737;Name=region1737
-chr1	S-MART	transcript	3546451	3596450	.	+	.	nbElements=0;ID=region1738;Name=region1738
-chr1	S-MART	transcript	3596401	3646400	.	+	.	nbElements=0;ID=region1739;Name=region1739
-chr1	S-MART	transcript	3646351	3696350	.	+	.	nbElements=0;ID=region1740;Name=region1740
-chr1	S-MART	transcript	3696301	3746300	.	+	.	nbElements=0;ID=region1741;Name=region1741
-chr1	S-MART	transcript	3746251	3796250	.	+	.	nbElements=0;ID=region1742;Name=region1742
-chr1	S-MART	transcript	3796201	3846200	.	+	.	nbElements=0;ID=region1743;Name=region1743
-chr1	S-MART	transcript	3846151	3896150	.	+	.	nbElements=0;ID=region1744;Name=region1744
-chr1	S-MART	transcript	3896101	3946100	.	+	.	nbElements=0;ID=region1745;Name=region1745
-chr1	S-MART	transcript	3946051	3996050	.	+	.	nbElements=0;ID=region1746;Name=region1746
-chr1	S-MART	transcript	3996001	4046000	.	+	.	nbElements=0;ID=region1747;Name=region1747
-chr1	S-MART	transcript	4045951	4095950	.	+	.	nbElements=0;ID=region1748;Name=region1748
-chr1	S-MART	transcript	4095901	4145900	.	+	.	nbElements=0;ID=region1749;Name=region1749
-chr1	S-MART	transcript	4145851	4195850	.	+	.	nbElements=0;ID=region1750;Name=region1750
-chr1	S-MART	transcript	4195801	4245800	.	+	.	nbElements=0;ID=region1751;Name=region1751
-chr1	S-MART	transcript	4245751	4295750	.	+	.	nbElements=0;ID=region1752;Name=region1752
-chr1	S-MART	transcript	4295701	4345700	.	+	.	nbElements=0;ID=region1753;Name=region1753
-chr1	S-MART	transcript	4345651	4395650	.	+	.	nbElements=0;ID=region1754;Name=region1754
-chr1	S-MART	transcript	4395601	4445600	.	+	.	nbElements=0;ID=region1755;Name=region1755
-chr1	S-MART	transcript	4445551	4495550	.	+	.	nbElements=0;ID=region1756;Name=region1756
-chr1	S-MART	transcript	4495501	4545500	.	+	.	nbElements=0;ID=region1757;Name=region1757
-chr1	S-MART	transcript	4545451	4595450	.	+	.	nbElements=0;ID=region1758;Name=region1758
-chr1	S-MART	transcript	4595401	4645400	.	+	.	nbElements=0;ID=region1759;Name=region1759
-chr1	S-MART	transcript	4645351	4695350	.	+	.	nbElements=0;ID=region1760;Name=region1760
-chr1	S-MART	transcript	4695301	4745300	.	+	.	nbElements=0;ID=region1761;Name=region1761
-chr1	S-MART	transcript	4745251	4795250	.	+	.	nbElements=0;ID=region1762;Name=region1762
-chr1	S-MART	transcript	4795201	4845200	.	+	.	nbElements=0;ID=region1763;Name=region1763
-chr1	S-MART	transcript	4845151	4895150	.	+	.	nbElements=0;ID=region1764;Name=region1764
-chr1	S-MART	transcript	4895101	4945100	.	+	.	nbElements=0;ID=region1765;Name=region1765
-chr1	S-MART	transcript	4945051	4995050	.	+	.	nbElements=0;ID=region1766;Name=region1766
-chr1	S-MART	transcript	4995001	5045000	.	+	.	nbElements=0;ID=region1767;Name=region1767
-chr1	S-MART	transcript	5044951	5094950	.	+	.	nbElements=0;ID=region1768;Name=region1768
-chr1	S-MART	transcript	5094901	5144900	.	+	.	nbElements=0;ID=region1769;Name=region1769
-chr1	S-MART	transcript	5144851	5194850	.	+	.	nbElements=0;ID=region1770;Name=region1770
-chr1	S-MART	transcript	5194801	5244800	.	+	.	nbElements=0;ID=region1771;Name=region1771
-chr1	S-MART	transcript	5244751	5294750	.	+	.	nbElements=0;ID=region1772;Name=region1772
-chr1	S-MART	transcript	5294701	5344700	.	+	.	nbElements=0;ID=region1773;Name=region1773
-chr1	S-MART	transcript	5344651	5394650	.	+	.	nbElements=0;ID=region1774;Name=region1774
-chr1	S-MART	transcript	5394601	5444600	.	+	.	nbElements=0;ID=region1775;Name=region1775
-chr1	S-MART	transcript	5444551	5494550	.	+	.	nbElements=0;ID=region1776;Name=region1776
-chr1	S-MART	transcript	5494501	5544500	.	+	.	nbElements=0;ID=region1777;Name=region1777
-chr1	S-MART	transcript	5544451	5594450	.	+	.	nbElements=0;ID=region1778;Name=region1778
-chr1	S-MART	transcript	5594401	5644400	.	+	.	nbElements=0;ID=region1779;Name=region1779
-chr1	S-MART	transcript	5644351	5694350	.	+	.	nbElements=0;ID=region1780;Name=region1780
-chr1	S-MART	transcript	5694301	5744300	.	+	.	nbElements=0;ID=region1781;Name=region1781
-chr1	S-MART	transcript	5744251	5794250	.	+	.	nbElements=0;ID=region1782;Name=region1782
-chr1	S-MART	transcript	5794201	5844200	.	+	.	nbElements=0;ID=region1783;Name=region1783
-chr1	S-MART	transcript	5844151	5894150	.	+	.	nbElements=0;ID=region1784;Name=region1784
-chr1	S-MART	transcript	5894101	5944100	.	+	.	nbElements=0;ID=region1785;Name=region1785
-chr1	S-MART	transcript	5944051	5994050	.	+	.	nbElements=0;ID=region1786;Name=region1786
-chr1	S-MART	transcript	5994001	6044000	.	+	.	nbElements=0;ID=region1787;Name=region1787
-chr1	S-MART	transcript	6043951	6093950	.	+	.	nbElements=0;ID=region1788;Name=region1788
-chr1	S-MART	transcript	6093901	6143900	.	+	.	nbElements=0;ID=region1789;Name=region1789
-chr1	S-MART	transcript	6143851	6193850	.	+	.	nbElements=1.0;ID=region1790;Name=region1790
--- a/SMART/Java/Python/TestFiles/clusterize_default_expected.map	Mon Apr 29 03:30:11 2013 -0400
+++ /dev/null	Thu Jan 01 00:00:00 1970 +0000
@@ -1,1790 +0,0 @@
-region1	chr4	1	50001
-region2	chr4	49951	99951
-region3	chr4	99901	149901
-region4	chr4	149851	199851
-region5	chr4	199801	249801
-region6	chr4	249751	299751
-region7	chr4	299701	349701
-region8	chr4	349651	399651
-region9	chr4	399601	449601
-region10	chr4	449551	499551
-region11	chr4	499501	549501
-region12	chr4	549451	599451
-region13	chr4	599401	649401
-region14	chr4	649351	699351
-region15	chr4	699301	749301
-region16	chr4	749251	799251
-region17	chr4	799201	849201
-region18	chr4	849151	899151
-region19	chr4	899101	949101
-region20	chr4	949051	999051
-region21	chr4	999001	1049001
-region22	chr4	1048951	1098951
-region23	chr4	1098901	1148901
-region24	chr4	1148851	1198851
-region25	chr4	1198801	1248801
-region26	chr4	1248751	1298751
-region27	chr4	1298701	1348701
-region28	chr4	1348651	1398651
-region29	chr4	1398601	1448601
-region30	chr4	1448551	1498551
-region31	chr4	1498501	1548501
-region32	chr4	1548451	1598451
-region33	chr4	1598401	1648401
-region34	chr4	1648351	1698351
-region35	chr4	1698301	1748301
-region36	chr4	1748251	1798251
-region37	chr4	1798201	1848201
-region38	chr4	1848151	1898151
-region39	chr4	1898101	1948101
-region40	chr4	1948051	1998051
-region41	chr4	1998001	2048001
-region42	chr4	2047951	2097951
-region43	chr4	2097901	2147901
-region44	chr4	2147851	2197851
-region45	chr4	2197801	2247801
-region46	chr4	2247751	2297751
-region47	chr4	2297701	2347701
-region48	chr4	2347651	2397651
-region49	chr4	2397601	2447601
-region50	chr4	2447551	2497551
-region51	chr4	2497501	2547501
-region52	chr4	2547451	2597451
-region53	chr4	2597401	2647401
-region54	chr4	2647351	2697351
-region55	chr4	2697301	2747301
-region56	chr4	2747251	2797251
-region57	chr4	2797201	2847201
-region58	chr4	2847151	2897151
-region59	chr4	2897101	2947101
-region60	chr4	2947051	2997051
-region61	chr4	2997001	3047001
-region62	chr4	3046951	3096951
-region63	chr4	3096901	3146901
-region64	chr4	3146851	3196851
-region65	chr4	3196801	3246801
-region66	chr4	3246751	3296751
-region67	chr4	3296701	3346701
-region68	chr4	3346651	3396651
-region69	chr4	3396601	3446601
-region70	chr4	3446551	3496551
-region71	chr4	3496501	3546501
-region72	chr4	3546451	3596451
-region73	chr4	3596401	3646401
-region74	chr4	3646351	3696351
-region75	chr4	3696301	3746301
-region76	chr4	3746251	3796251
-region77	chr4	3796201	3846201
-region78	chr4	3846151	3896151
-region79	chr4	3896101	3946101
-region80	chr4	3946051	3996051
-region81	chr4	3996001	4046001
-region82	chr4	4045951	4095951
-region83	chr4	4095901	4145901
-region84	chr4	4145851	4195851
-region85	chr4	4195801	4245801
-region86	chr4	4245751	4295751
-region87	chr4	4295701	4345701
-region88	chr4	4345651	4395651
-region89	chr4	4395601	4445601
-region90	chr4	4445551	4495551
-region91	chr4	4495501	4545501
-region92	chr4	4545451	4595451
-region93	chr4	4595401	4645401
-region94	chr4	4645351	4695351
-region95	chr4	4695301	4745301
-region96	chr4	4745251	4795251
-region97	chr4	4795201	4845201
-region98	chr4	4845151	4895151
-region99	chr4	4895101	4945101
-region100	chr4	4945051	4995051
-region101	chr4	4995001	5045001
-region102	chr4	5044951	5094951
-region103	chr4	5094901	5144901
-region104	chr4	5144851	5194851
-region105	chr4	5194801	5244801
-region106	chr4	5244751	5294751
-region107	chr4	5294701	5344701
-region108	chr4	5344651	5394651
-region109	chr4	5394601	5444601
-region110	chr4	5444551	5494551
-region111	chr4	5494501	5544501
-region112	chr4	5544451	5594451
-region113	chr4	5594401	5644401
-region114	chr4	5644351	5694351
-region115	chr4	5694301	5744301
-region116	chr4	5744251	5794251
-region117	chr4	5794201	5844201
-region118	chr4	5844151	5894151
-region119	chr4	5894101	5944101
-region120	chr4	5944051	5994051
-region121	chr4	5994001	6044001
-region122	chr4	6043951	6093951
-region123	chr4	6093901	6143901
-region124	chr4	6143851	6193851
-region125	chr4	6193801	6243801
-region126	chr4	6243751	6293751
-region127	chr4	6293701	6343701
-region128	chr4	6343651	6393651
-region129	chr4	6393601	6443601
-region130	chr4	6443551	6493551
-region131	chr4	6493501	6543501
-region132	chr4	6543451	6593451
-region133	chr4	6593401	6643401
-region134	chr4	6643351	6693351
-region135	chr4	6693301	6743301
-region136	chr4	6743251	6793251
-region137	chr4	6793201	6843201
-region138	chr4	6843151	6893151
-region139	chr4	6893101	6943101
-region140	chr4	6943051	6993051
-region141	chr4	6993001	7043001
-region142	chr4	7042951	7092951
-region143	chr4	7092901	7142901
-region144	chr4	7142851	7192851
-region145	chr4	7192801	7242801
-region146	chr4	7242751	7292751
-region147	chr4	7292701	7342701
-region148	chr4	7342651	7392651
-region149	chr4	7392601	7442601
-region150	chr4	7442551	7492551
-region151	chr4	7492501	7542501
-region152	chr4	7542451	7592451
-region153	chr4	7592401	7642401
-region154	chr4	7642351	7692351
-region155	chr4	7692301	7742301
-region156	chr4	7742251	7792251
-region157	chr4	7792201	7842201
-region158	chr4	7842151	7892151
-region159	chr4	7892101	7942101
-region160	chr4	7942051	7992051
-region161	chr4	7992001	8042001
-region162	chr4	8041951	8091951
-region163	chr4	8091901	8141901
-region164	chr4	8141851	8191851
-region165	chr4	8191801	8241801
-region166	chr4	8241751	8291751
-region167	chr4	8291701	8341701
-region168	chr4	8341651	8391651
-region169	chr4	8391601	8441601
-region170	chr4	8441551	8491551
-region171	chr4	8491501	8541501
-region172	chr4	8541451	8591451
-region173	chr4	8591401	8641401
-region174	chr4	8641351	8691351
-region175	chr4	8691301	8741301
-region176	chr4	8741251	8791251
-region177	chr4	8791201	8841201
-region178	chr4	8841151	8891151
-region179	chr4	8891101	8941101
-region180	chr4	8941051	8991051
-region181	chr4	8991001	9041001
-region182	chr4	9040951	9090951
-region183	chr4	9090901	9140901
-region184	chr4	9140851	9190851
-region185	chr4	9190801	9240801
-region186	chr4	9240751	9290751
-region187	chr4	9290701	9340701
-region188	chr4	9340651	9390651
-region189	chr4	9390601	9440601
-region190	chr4	9440551	9490551
-region191	chr4	9490501	9540501
-region192	chr4	9540451	9590451
-region193	chr4	9590401	9640401
-region194	chr4	9640351	9690351
-region195	chr4	9690301	9740301
-region196	chr4	9740251	9790251
-region197	chr4	9790201	9840201
-region198	chr4	9840151	9890151
-region199	chr4	9890101	9940101
-region200	chr4	9940051	9990051
-region201	chr4	9990001	10040001
-region202	chr4	10039951	10089951
-region203	chr4	10089901	10139901
-region204	chr4	10139851	10189851
-region205	chr4	10189801	10239801
-region206	chr4	10239751	10289751
-region207	chr4	10289701	10339701
-region208	chr4	10339651	10389651
-region209	chr4	10389601	10439601
-region210	chr4	10439551	10489551
-region211	chr4	10489501	10539501
-region212	chr4	10539451	10589451
-region213	chr4	10589401	10639401
-region214	chr4	10639351	10689351
-region215	chr4	10689301	10739301
-region216	chr4	10739251	10789251
-region217	chr4	10789201	10839201
-region218	chr4	10839151	10889151
-region219	chr4	10889101	10939101
-region220	chr4	10939051	10989051
-region221	chr4	10989001	11039001
-region222	chr4	11038951	11088951
-region223	chr4	11088901	11138901
-region224	chr4	11138851	11188851
-region225	chr4	11188801	11238801
-region226	chr4	11238751	11288751
-region227	chr4	11288701	11338701
-region228	chr4	11338651	11388651
-region229	chr4	11388601	11438601
-region230	chr4	11438551	11488551
-region231	chr4	11488501	11538501
-region232	chr4	11538451	11588451
-region233	chr4	11588401	11638401
-region234	chr4	11638351	11688351
-region235	chr4	11688301	11738301
-region236	chr4	11738251	11788251
-region237	chr4	11788201	11838201
-region238	chr4	11838151	11888151
-region239	chr4	11888101	11938101
-region240	chr4	11938051	11988051
-region241	chr4	11988001	12038001
-region242	chr4	12037951	12087951
-region243	chr4	12087901	12137901
-region244	chr4	12137851	12187851
-region245	chr4	12187801	12237801
-region246	chr4	12237751	12287751
-region247	chr4	12287701	12337701
-region248	chr4	12337651	12387651
-region249	chr4	12387601	12437601
-region250	chr4	12437551	12487551
-region251	chr4	12487501	12537501
-region252	chr4	12537451	12587451
-region253	chr4	12587401	12637401
-region254	chr4	12637351	12687351
-region255	chr4	12687301	12737301
-region256	chr4	12737251	12787251
-region257	chr4	12787201	12837201
-region258	chr4	12837151	12887151
-region259	chr4	12887101	12937101
-region260	chr4	12937051	12987051
-region261	chr4	12987001	13037001
-region262	chr4	13036951	13086951
-region263	chr4	13086901	13136901
-region264	chr4	13136851	13186851
-region265	chr4	13186801	13236801
-region266	chr4	13236751	13286751
-region267	chr4	13286701	13336701
-region268	chr4	13336651	13386651
-region269	chr4	13386601	13436601
-region270	chr4	13436551	13486551
-region271	chr4	13486501	13536501
-region272	chr4	13536451	13586451
-region273	chr4	13586401	13636401
-region274	chr4	13636351	13686351
-region275	chr4	13686301	13736301
-region276	chr4	13736251	13786251
-region277	chr4	13786201	13836201
-region278	chr4	13836151	13886151
-region279	chr4	13886101	13936101
-region280	chr4	13936051	13986051
-region281	chr4	13986001	14036001
-region282	chr4	14035951	14085951
-region283	chr4	14085901	14135901
-region284	chr4	14135851	14185851
-region285	chr4	14185801	14235801
-region286	chr4	14235751	14285751
-region287	chr4	14285701	14335701
-region288	chr4	14335651	14385651
-region289	chr4	14385601	14435601
-region290	chr4	14435551	14485551
-region291	chr4	14485501	14535501
-region292	chr4	14535451	14585451
-region293	chr4	14585401	14635401
-region294	chr4	14635351	14685351
-region295	chr4	14685301	14735301
-region296	chr4	14735251	14785251
-region297	chr4	14785201	14835201
-region298	chr4	14835151	14885151
-region299	chr4	14885101	14935101
-region300	chr4	14935051	14985051
-region301	chr4	14985001	15035001
-region302	chr4	15034951	15084951
-region303	chr4	15084901	15134901
-region304	chr4	15134851	15184851
-region305	chr4	15184801	15234801
-region306	chr4	15234751	15284751
-region307	chr4	15284701	15334701
-region308	chr4	15334651	15384651
-region309	chr4	15384601	15434601
-region310	chr4	15434551	15484551
-region311	chr4	15484501	15534501
-region312	chr4	15534451	15584451
-region313	chr4	15584401	15634401
-region314	chr4	15634351	15684351
-region315	chr4	15684301	15734301
-region316	chr4	15734251	15784251
-region317	chr4	15784201	15834201
-region318	chr4	15834151	15884151
-region319	chr4	15884101	15934101
-region320	chr4	15934051	15984051
-region321	chr4	15984001	16034001
-region322	chr4	16033951	16083951
-region323	chr4	16083901	16133901
-region324	chr4	16133851	16183851
-region325	chr4	16183801	16233801
-region326	chr4	16233751	16283751
-region327	chr4	16283701	16333701
-region328	chr4	16333651	16383651
-region329	chr4	16383601	16433601
-region330	chr4	16433551	16483551
-region331	chr4	16483501	16533501
-region332	chr4	16533451	16583451
-region333	chr4	16583401	16633401
-region334	chr4	16633351	16683351
-region335	chr4	16683301	16733301
-region336	chr4	16733251	16783251
-region337	chr4	16783201	16833201
-region338	chr4	16833151	16883151
-region339	chr4	16883101	16933101
-region340	chr4	16933051	16983051
-region341	chr4	16983001	17033001
-region342	chr4	17032951	17082951
-region343	chr4	17082901	17132901
-region344	chr4	17132851	17182851
-region345	chr4	17182801	17232801
-region346	chr4	17232751	17282751
-region347	chr4	17282701	17332701
-region348	chr4	17332651	17382651
-region349	chr4	17382601	17432601
-region350	chr4	17432551	17482551
-region351	chr4	17482501	17532501
-region352	chr4	17532451	17582451
-region353	chr4	17582401	17632401
-region354	chr4	17632351	17682351
-region355	chr4	17682301	17732301
-region356	chr4	17732251	17782251
-region357	chr4	17782201	17832201
-region358	chr4	17832151	17882151
-region359	chr4	17882101	17932101
-region360	chr4	17932051	17982051
-region361	chr4	17982001	18032001
-region362	chr4	18031951	18081951
-region363	chr4	18081901	18131901
-region364	chr4	18131851	18181851
-region365	chr4	18181801	18231801
-region366	chr4	18231751	18281751
-region367	chr4	18281701	18331701
-region368	chr4	18331651	18381651
-region369	chr4	18381601	18431601
-region370	chr4	18431551	18481551
-region371	chr4	18481501	18531501
-region372	chr4	18531451	18581451
-region373	chr4	18581401	18631401
-region374	chr4	18631351	18681351
-region375	chr4	18681301	18731301
-region376	chr4	18731251	18781251
-region377	chr4	18781201	18831201
-region378	chr4	18831151	18881151
-region379	chr4	18881101	18931101
-region380	chr4	18931051	18981051
-region381	chr4	18981001	19031001
-region382	chr4	19030951	19080951
-region383	chr4	19080901	19130901
-region384	chr4	19130851	19180851
-region385	chr4	19180801	19230801
-region386	chr4	19230751	19280751
-region387	chr4	19280701	19330701
-region388	chr4	19330651	19380651
-region389	chr4	19380601	19430601
-region390	chr4	19430551	19480551
-region391	chr4	19480501	19530501
-region392	chr4	19530451	19580451
-region393	chr4	19580401	19630401
-region394	chr4	19630351	19680351
-region395	chr4	19680301	19730301
-region396	chr4	19730251	19780251
-region397	chr4	19780201	19830201
-region398	chr4	19830151	19880151
-region399	chr4	19880101	19930101
-region400	chr4	19930051	19980051
-region401	chr4	19980001	20030001
-region402	chr4	20029951	20079951
-region403	chr4	20079901	20129901
-region404	chr4	20129851	20179851
-region405	chr4	20179801	20229801
-region406	chr4	20229751	20279751
-region407	chr4	20279701	20329701
-region408	chr4	20329651	20379651
-region409	chr4	20379601	20429601
-region410	chr4	20429551	20479551
-region411	chr4	20479501	20529501
-region412	chr4	20529451	20579451
-region413	chr4	20579401	20629401
-region414	chr4	20629351	20679351
-region415	chr4	20679301	20729301
-region416	chr4	20729251	20779251
-region417	chr4	20779201	20829201
-region418	chr4	20829151	20879151
-region419	chr4	20879101	20929101
-region420	chr4	20929051	20979051
-region421	chr4	20979001	21029001
-region422	chr4	21028951	21078951
-region423	chr4	21078901	21128901
-region424	chr4	21128851	21178851
-region425	chr4	21178801	21228801
-region426	chr4	21228751	21278751
-region427	chr4	21278701	21328701
-region428	chr4	21328651	21378651
-region429	chr4	21378601	21428601
-region430	chr4	21428551	21478551
-region431	chr4	21478501	21528501
-region432	chr4	21528451	21578451
-region433	chr4	21578401	21628401
-region434	chr4	21628351	21678351
-region435	chr4	21678301	21728301
-region436	chr4	21728251	21778251
-region437	chr4	21778201	21828201
-region438	chr4	21828151	21878151
-region439	chr4	21878101	21928101
-region440	chr4	21928051	21978051
-region441	chr4	21978001	22028001
-region442	chr4	22027951	22077951
-region443	chr4	22077901	22127901
-region444	chr4	22127851	22177851
-region445	chr4	22177801	22227801
-region446	chr4	22227751	22277751
-region447	chr4	22277701	22327701
-region448	chr4	22327651	22377651
-region449	chr4	22377601	22427601
-region450	chr4	22427551	22477551
-region451	chr4	22477501	22527501
-region452	chr4	22527451	22577451
-region453	chr4	22577401	22627401
-region454	chr4	22627351	22677351
-region455	chr4	22677301	22727301
-region456	chr4	22727251	22777251
-region457	chr4	22777201	22827201
-region458	chr4	22827151	22877151
-region459	chr4	22877101	22927101
-region460	chr4	22927051	22977051
-region461	chr4	22977001	23027001
-region462	chr4	23026951	23076951
-region463	chr4	23076901	23126901
-region464	chr4	23126851	23176851
-region465	chr4	23176801	23226801
-region466	chr4	23226751	23276751
-region467	chr4	23276701	23326701
-region468	chr4	23326651	23376651
-region469	chr4	23376601	23426601
-region470	chr4	23426551	23476551
-region471	chr4	23476501	23526501
-region472	chr4	23526451	23576451
-region473	chr4	23576401	23626401
-region474	chr4	23626351	23676351
-region475	chr4	23676301	23726301
-region476	chr4	23726251	23776251
-region477	chr4	23776201	23826201
-region478	chr4	23826151	23876151
-region479	chr4	23876101	23926101
-region480	chr4	23926051	23976051
-region481	chr4	23976001	24026001
-region482	chr4	24025951	24075951
-region483	chr4	24075901	24125901
-region484	chr4	24125851	24175851
-region485	chr4	24175801	24225801
-region486	chr4	24225751	24275751
-region487	chr4	24275701	24325701
-region488	chr4	24325651	24375651
-region489	chr4	24375601	24425601
-region490	chr4	24425551	24475551
-region491	chr4	24475501	24525501
-region492	chr4	24525451	24575451
-region493	chr4	24575401	24625401
-region494	chr4	24625351	24675351
-region495	chr4	24675301	24725301
-region496	chr4	24725251	24775251
-region497	chr4	24775201	24825201
-region498	chr4	24825151	24875151
-region499	chr4	24875101	24925101
-region500	chr4	24925051	24975051
-region501	chr4	24975001	25025001
-region502	chr4	25024951	25074951
-region503	chr4	25074901	25124901
-region504	chr4	25124851	25174851
-region505	chr4	25174801	25224801
-region506	chr4	25224751	25274751
-region507	chr4	25274701	25324701
-region508	chr4	25324651	25374651
-region509	chr4	25374601	25424601
-region510	chr4	25424551	25474551
-region511	chr4	25474501	25524501
-region512	chr4	25524451	25574451
-region513	chr4	25574401	25624401
-region514	chr4	25624351	25674351
-region515	chr4	25674301	25724301
-region516	chr4	25724251	25774251
-region517	chr4	25774201	25824201
-region518	chr4	25824151	25874151
-region519	chr4	25874101	25924101
-region520	chr4	25924051	25974051
-region521	chr4	25974001	26024001
-region522	chr4	26023951	26073951
-region523	chr4	26073901	26123901
-region524	chr4	26123851	26173851
-region525	chr4	26173801	26223801
-region526	chr4	26223751	26273751
-region527	chr4	26273701	26323701
-region528	chr4	26323651	26373651
-region529	chr4	26373601	26423601
-region530	chr4	26423551	26473551
-region531	chr4	26473501	26523501
-region532	chr4	26523451	26573451
-region533	chr4	26573401	26623401
-region534	chr4	26623351	26673351
-region535	chr4	26673301	26723301
-region536	chr4	26723251	26773251
-region537	chr4	26773201	26823201
-region538	chr4	26823151	26873151
-region539	chr4	26873101	26923101
-region540	chr4	26923051	26973051
-region541	chr4	26973001	27023001
-region542	chr4	27022951	27072951
-region543	chr4	27072901	27122901
-region544	chr4	27122851	27172851
-region545	chr4	27172801	27222801
-region546	chr4	27222751	27272751
-region547	chr4	27272701	27322701
-region548	chr4	27322651	27372651
-region549	chr4	27372601	27422601
-region550	chr4	27422551	27472551
-region551	chr4	27472501	27522501
-region552	chr4	27522451	27572451
-region553	chr4	27572401	27622401
-region554	chr4	27622351	27672351
-region555	chr4	27672301	27722301
-region556	chr4	27722251	27772251
-region557	chr4	27772201	27822201
-region558	chr4	27822151	27872151
-region559	chr4	27872101	27922101
-region560	chr4	27922051	27972051
-region561	chr4	27972001	28022001
-region562	chr4	28021951	28071951
-region563	chr4	28071901	28121901
-region564	chr4	28121851	28171851
-region565	chr4	28171801	28221801
-region566	chr4	28221751	28271751
-region567	chr4	28271701	28321701
-region568	chr4	28321651	28371651
-region569	chr4	28371601	28421601
-region570	chr4	28421551	28471551
-region571	chr4	28471501	28521501
-region572	chr4	28521451	28571451
-region573	chr3	1	50001
-region574	chr3	49951	99951
-region575	chr3	99901	149901
-region576	chr3	149851	199851
-region577	chr3	199801	249801
-region578	chr3	249751	299751
-region579	chr3	299701	349701
-region580	chr3	349651	399651
-region581	chr3	399601	449601
-region582	chr3	449551	499551
-region583	chr3	499501	549501
-region584	chr3	549451	599451
-region585	chr3	599401	649401
-region586	chr3	649351	699351
-region587	chr3	699301	749301
-region588	chr3	749251	799251
-region589	chr3	799201	849201
-region590	chr3	849151	899151
-region591	chr3	899101	949101
-region592	chr3	949051	999051
-region593	chr3	999001	1049001
-region594	chr3	1048951	1098951
-region595	chr3	1098901	1148901
-region596	chr3	1148851	1198851
-region597	chr3	1198801	1248801
-region598	chr3	1248751	1298751
-region599	chr3	1298701	1348701
-region600	chr3	1348651	1398651
-region601	chr3	1398601	1448601
-region602	chr3	1448551	1498551
-region603	chr3	1498501	1548501
-region604	chr3	1548451	1598451
-region605	chr3	1598401	1648401
-region606	chr3	1648351	1698351
-region607	chr3	1698301	1748301
-region608	chr3	1748251	1798251
-region609	chr3	1798201	1848201
-region610	chr3	1848151	1898151
-region611	chr3	1898101	1948101
-region612	chr3	1948051	1998051
-region613	chr3	1998001	2048001
-region614	chr3	2047951	2097951
-region615	chr3	2097901	2147901
-region616	chr3	2147851	2197851
-region617	chr3	2197801	2247801
-region618	chr3	2247751	2297751
-region619	chr3	2297701	2347701
-region620	chr3	2347651	2397651
-region621	chr3	2397601	2447601
-region622	chr3	2447551	2497551
-region623	chr3	2497501	2547501
-region624	chr3	2547451	2597451
-region625	chr3	2597401	2647401
-region626	chr3	2647351	2697351
-region627	chr3	2697301	2747301
-region628	chr3	2747251	2797251
-region629	chr3	2797201	2847201
-region630	chr3	2847151	2897151
-region631	chr3	2897101	2947101
-region632	chr3	2947051	2997051
-region633	chr3	2997001	3047001
-region634	chr3	3046951	3096951
-region635	chr3	3096901	3146901
-region636	chr3	3146851	3196851
-region637	chr3	3196801	3246801
-region638	chr3	3246751	3296751
-region639	chr3	3296701	3346701
-region640	chr3	3346651	3396651
-region641	chr3	3396601	3446601
-region642	chr3	3446551	3496551
-region643	chr3	3496501	3546501
-region644	chr3	3546451	3596451
-region645	chr3	3596401	3646401
-region646	chr3	3646351	3696351
-region647	chr3	3696301	3746301
-region648	chr3	3746251	3796251
-region649	chr3	3796201	3846201
-region650	chr3	3846151	3896151
-region651	chr3	3896101	3946101
-region652	chr3	3946051	3996051
-region653	chr3	3996001	4046001
-region654	chr3	4045951	4095951
-region655	chr3	4095901	4145901
-region656	chr3	4145851	4195851
-region657	chr3	4195801	4245801
-region658	chr3	4245751	4295751
-region659	chr3	4295701	4345701
-region660	chr3	4345651	4395651
-region661	chr3	4395601	4445601
-region662	chr3	4445551	4495551
-region663	chr3	4495501	4545501
-region664	chr3	4545451	4595451
-region665	chr3	4595401	4645401
-region666	chr3	4645351	4695351
-region667	chr3	4695301	4745301
-region668	chr3	4745251	4795251
-region669	chr3	4795201	4845201
-region670	chr3	4845151	4895151
-region671	chr3	4895101	4945101
-region672	chr3	4945051	4995051
-region673	chr3	4995001	5045001
-region674	chr3	5044951	5094951
-region675	chr3	5094901	5144901
-region676	chr3	5144851	5194851
-region677	chr3	5194801	5244801
-region678	chr3	5244751	5294751
-region679	chr3	5294701	5344701
-region680	chr3	5344651	5394651
-region681	chr3	5394601	5444601
-region682	chr3	5444551	5494551
-region683	chr3	5494501	5544501
-region684	chr3	5544451	5594451
-region685	chr3	5594401	5644401
-region686	chr3	5644351	5694351
-region687	chr3	5694301	5744301
-region688	chr3	5744251	5794251
-region689	chr3	5794201	5844201
-region690	chr3	5844151	5894151
-region691	chr3	5894101	5944101
-region692	chr3	5944051	5994051
-region693	chr3	5994001	6044001
-region694	chr3	6043951	6093951
-region695	chr3	6093901	6143901
-region696	chr3	6143851	6193851
-region697	chr3	6193801	6243801
-region698	chr3	6243751	6293751
-region699	chr3	6293701	6343701
-region700	chr3	6343651	6393651
-region701	chr3	6393601	6443601
-region702	chr3	6443551	6493551
-region703	chr3	6493501	6543501
-region704	chr3	6543451	6593451
-region705	chr3	6593401	6643401
-region706	chr3	6643351	6693351
-region707	chr3	6693301	6743301
-region708	chr3	6743251	6793251
-region709	chr3	6793201	6843201
-region710	chr3	6843151	6893151
-region711	chr3	6893101	6943101
-region712	chr3	6943051	6993051
-region713	chr3	6993001	7043001
-region714	chr3	7042951	7092951
-region715	chr3	7092901	7142901
-region716	chr3	7142851	7192851
-region717	chr3	7192801	7242801
-region718	chr3	7242751	7292751
-region719	chr3	7292701	7342701
-region720	chr3	7342651	7392651
-region721	chr3	7392601	7442601
-region722	chr3	7442551	7492551
-region723	chr3	7492501	7542501
-region724	chr3	7542451	7592451
-region725	chr3	7592401	7642401
-region726	chr3	7642351	7692351
-region727	chr3	7692301	7742301
-region728	chr3	7742251	7792251
-region729	chr3	7792201	7842201
-region730	chr3	7842151	7892151
-region731	chr3	7892101	7942101
-region732	chr3	7942051	7992051
-region733	chr3	7992001	8042001
-region734	chr3	8041951	8091951
-region735	chr3	8091901	8141901
-region736	chr3	8141851	8191851
-region737	chr3	8191801	8241801
-region738	chr3	8241751	8291751
-region739	chr3	8291701	8341701
-region740	chr3	8341651	8391651
-region741	chr3	8391601	8441601
-region742	chr3	8441551	8491551
-region743	chr3	8491501	8541501
-region744	chr3	8541451	8591451
-region745	chr3	8591401	8641401
-region746	chr3	8641351	8691351
-region747	chr3	8691301	8741301
-region748	chr3	8741251	8791251
-region749	chr3	8791201	8841201
-region750	chr3	8841151	8891151
-region751	chr3	8891101	8941101
-region752	chr3	8941051	8991051
-region753	chr3	8991001	9041001
-region754	chr3	9040951	9090951
-region755	chr3	9090901	9140901
-region756	chr3	9140851	9190851
-region757	chr3	9190801	9240801
-region758	chr3	9240751	9290751
-region759	chr3	9290701	9340701
-region760	chr3	9340651	9390651
-region761	chr3	9390601	9440601
-region762	chr3	9440551	9490551
-region763	chr3	9490501	9540501
-region764	chr3	9540451	9590451
-region765	chr3	9590401	9640401
-region766	chr3	9640351	9690351
-region767	chr3	9690301	9740301
-region768	chr3	9740251	9790251
-region769	chr3	9790201	9840201
-region770	chr3	9840151	9890151
-region771	chr3	9890101	9940101
-region772	chr3	9940051	9990051
-region773	chr3	9990001	10040001
-region774	chr3	10039951	10089951
-region775	chr3	10089901	10139901
-region776	chr3	10139851	10189851
-region777	chr3	10189801	10239801
-region778	chr3	10239751	10289751
-region779	chr3	10289701	10339701
-region780	chr3	10339651	10389651
-region781	chr3	10389601	10439601
-region782	chr3	10439551	10489551
-region783	chr3	10489501	10539501
-region784	chr3	10539451	10589451
-region785	chr3	10589401	10639401
-region786	chr3	10639351	10689351
-region787	chr3	10689301	10739301
-region788	chr3	10739251	10789251
-region789	chr3	10789201	10839201
-region790	chr3	10839151	10889151
-region791	chr3	10889101	10939101
-region792	chr3	10939051	10989051
-region793	chr3	10989001	11039001
-region794	chr3	11038951	11088951
-region795	chr3	11088901	11138901
-region796	chr3	11138851	11188851
-region797	chr3	11188801	11238801
-region798	chr3	11238751	11288751
-region799	chr3	11288701	11338701
-region800	chr3	11338651	11388651
-region801	chr3	11388601	11438601
-region802	chr3	11438551	11488551
-region803	chr3	11488501	11538501
-region804	chr3	11538451	11588451
-region805	chr3	11588401	11638401
-region806	chr3	11638351	11688351
-region807	chr3	11688301	11738301
-region808	chr3	11738251	11788251
-region809	chr3	11788201	11838201
-region810	chr3	11838151	11888151
-region811	chr3	11888101	11938101
-region812	chr3	11938051	11988051
-region813	chr3	11988001	12038001
-region814	chr3	12037951	12087951
-region815	chr3	12087901	12137901
-region816	chr3	12137851	12187851
-region817	chr3	12187801	12237801
-region818	chr3	12237751	12287751
-region819	chr3	12287701	12337701
-region820	chr3	12337651	12387651
-region821	chr3	12387601	12437601
-region822	chr3	12437551	12487551
-region823	chr3	12487501	12537501
-region824	chr3	12537451	12587451
-region825	chr3	12587401	12637401
-region826	chr3	12637351	12687351
-region827	chr3	12687301	12737301
-region828	chr3	12737251	12787251
-region829	chr3	12787201	12837201
-region830	chr3	12837151	12887151
-region831	chr3	12887101	12937101
-region832	chr3	12937051	12987051
-region833	chr3	12987001	13037001
-region834	chr3	13036951	13086951
-region835	chr3	13086901	13136901
-region836	chr3	13136851	13186851
-region837	chr3	13186801	13236801
-region838	chr3	13236751	13286751
-region839	chr3	13286701	13336701
-region840	chr3	13336651	13386651
-region841	chr3	13386601	13436601
-region842	chr3	13436551	13486551
-region843	chr3	13486501	13536501
-region844	chr3	13536451	13586451
-region845	chr3	13586401	13636401
-region846	chr3	13636351	13686351
-region847	chr3	13686301	13736301
-region848	chr3	13736251	13786251
-region849	chr3	13786201	13836201
-region850	chr3	13836151	13886151
-region851	chr3	13886101	13936101
-region852	chr3	13936051	13986051
-region853	chr3	13986001	14036001
-region854	chr3	14035951	14085951
-region855	chr3	14085901	14135901
-region856	chr3	14135851	14185851
-region857	chr3	14185801	14235801
-region858	chr3	14235751	14285751
-region859	chr3	14285701	14335701
-region860	chr3	14335651	14385651
-region861	chr3	14385601	14435601
-region862	chr3	14435551	14485551
-region863	chr3	14485501	14535501
-region864	chr3	14535451	14585451
-region865	chr3	14585401	14635401
-region866	chr3	14635351	14685351
-region867	chr3	14685301	14735301
-region868	chr3	14735251	14785251
-region869	chr3	14785201	14835201
-region870	chr3	14835151	14885151
-region871	chr3	14885101	14935101
-region872	chr3	14935051	14985051
-region873	chr3	14985001	15035001
-region874	chr3	15034951	15084951
-region875	chr3	15084901	15134901
-region876	chr3	15134851	15184851
-region877	chr3	15184801	15234801
-region878	chr3	15234751	15284751
-region879	chr3	15284701	15334701
-region880	chr3	15334651	15384651
-region881	chr3	15384601	15434601
-region882	chr3	15434551	15484551
-region883	chr3	15484501	15534501
-region884	chr3	15534451	15584451
-region885	chr3	15584401	15634401
-region886	chr3	15634351	15684351
-region887	chr3	15684301	15734301
-region888	chr3	15734251	15784251
-region889	chr3	15784201	15834201
-region890	chr3	15834151	15884151
-region891	chr3	15884101	15934101
-region892	chr3	15934051	15984051
-region893	chr3	15984001	16034001
-region894	chr3	16033951	16083951
-region895	chr3	16083901	16133901
-region896	chr3	16133851	16183851
-region897	chr3	16183801	16233801
-region898	chr3	16233751	16283751
-region899	chr3	16283701	16333701
-region900	chr3	16333651	16383651
-region901	chr3	16383601	16433601
-region902	chr3	16433551	16483551
-region903	chr3	16483501	16533501
-region904	chr3	16533451	16583451
-region905	chr3	16583401	16633401
-region906	chr3	16633351	16683351
-region907	chr3	16683301	16733301
-region908	chr3	16733251	16783251
-region909	chr3	16783201	16833201
-region910	chr3	16833151	16883151
-region911	chr3	16883101	16933101
-region912	chr3	16933051	16983051
-region913	chr3	16983001	17033001
-region914	chr3	17032951	17082951
-region915	chr3	17082901	17132901
-region916	chr3	17132851	17182851
-region917	chr3	17182801	17232801
-region918	chr3	17232751	17282751
-region919	chr3	17282701	17332701
-region920	chr3	17332651	17382651
-region921	chr3	17382601	17432601
-region922	chr3	17432551	17482551
-region923	chr3	17482501	17532501
-region924	chr3	17532451	17582451
-region925	chr3	17582401	17632401
-region926	chr3	17632351	17682351
-region927	chr3	17682301	17732301
-region928	chr3	17732251	17782251
-region929	chr3	17782201	17832201
-region930	chr3	17832151	17882151
-region931	chr3	17882101	17932101
-region932	chr3	17932051	17982051
-region933	chr3	17982001	18032001
-region934	chr3	18031951	18081951
-region935	chr3	18081901	18131901
-region936	chr3	18131851	18181851
-region937	chr3	18181801	18231801
-region938	chr3	18231751	18281751
-region939	chr3	18281701	18331701
-region940	chr3	18331651	18381651
-region941	chr3	18381601	18431601
-region942	chr3	18431551	18481551
-region943	chr3	18481501	18531501
-region944	chr3	18531451	18581451
-region945	chr3	18581401	18631401
-region946	chr3	18631351	18681351
-region947	chr3	18681301	18731301
-region948	chr3	18731251	18781251
-region949	chr3	18781201	18831201
-region950	chr3	18831151	18881151
-region951	chr3	18881101	18931101
-region952	chr3	18931051	18981051
-region953	chr3	18981001	19031001
-region954	chr3	19030951	19080951
-region955	chr3	19080901	19130901
-region956	chr3	19130851	19180851
-region957	chr3	19180801	19230801
-region958	chr3	19230751	19280751
-region959	chr3	19280701	19330701
-region960	chr3	19330651	19380651
-region961	chr3	19380601	19430601
-region962	chr3	19430551	19480551
-region963	chr3	19480501	19530501
-region964	chr3	19530451	19580451
-region965	chr3	19580401	19630401
-region966	chr3	19630351	19680351
-region967	chr3	19680301	19730301
-region968	chr3	19730251	19780251
-region969	chr3	19780201	19830201
-region970	chr3	19830151	19880151
-region971	chr3	19880101	19930101
-region972	chr3	19930051	19980051
-region973	chr3	19980001	20030001
-region974	chr3	20029951	20079951
-region975	chr3	20079901	20129901
-region976	chr3	20129851	20179851
-region977	chr3	20179801	20229801
-region978	chr3	20229751	20279751
-region979	chr3	20279701	20329701
-region980	chr3	20329651	20379651
-region981	chr3	20379601	20429601
-region982	chr3	20429551	20479551
-region983	chr3	20479501	20529501
-region984	chr3	20529451	20579451
-region985	chr3	20579401	20629401
-region986	chr3	20629351	20679351
-region987	chr3	20679301	20729301
-region988	chr3	20729251	20779251
-region989	chr3	20779201	20829201
-region990	chr3	20829151	20879151
-region991	chr3	20879101	20929101
-region992	chr3	20929051	20979051
-region993	chr3	20979001	21029001
-region994	chr3	21028951	21078951
-region995	chr3	21078901	21128901
-region996	chr3	21128851	21178851
-region997	chr3	21178801	21228801
-region998	chr3	21228751	21278751
-region999	chr3	21278701	21328701
-region1000	chr3	21328651	21378651
-region1001	chr3	21378601	21428601
-region1002	chr3	21428551	21478551
-region1003	chr3	21478501	21528501
-region1004	chr3	21528451	21578451
-region1005	chr3	21578401	21628401
-region1006	chr3	21628351	21678351
-region1007	chr3	21678301	21728301
-region1008	chr3	21728251	21778251
-region1009	chr3	21778201	21828201
-region1010	chr3	21828151	21878151
-region1011	chr3	21878101	21928101
-region1012	chr3	21928051	21978051
-region1013	chr3	21978001	22028001
-region1014	chr3	22027951	22077951
-region1015	chr3	22077901	22127901
-region1016	chr3	22127851	22177851
-region1017	chr3	22177801	22227801
-region1018	chr3	22227751	22277751
-region1019	chr3	22277701	22327701
-region1020	chr3	22327651	22377651
-region1021	chr3	22377601	22427601
-region1022	chr3	22427551	22477551
-region1023	chr3	22477501	22527501
-region1024	chr3	22527451	22577451
-region1025	chr3	22577401	22627401
-region1026	chr3	22627351	22677351
-region1027	chr3	22677301	22727301
-region1028	chr3	22727251	22777251
-region1029	chr3	22777201	22827201
-region1030	chr3	22827151	22877151
-region1031	chr3	22877101	22927101
-region1032	chr3	22927051	22977051
-region1033	chr3	22977001	23027001
-region1034	chr3	23026951	23076951
-region1035	chr3	23076901	23126901
-region1036	chr3	23126851	23176851
-region1037	chr3	23176801	23226801
-region1038	chr3	23226751	23276751
-region1039	chr3	23276701	23326701
-region1040	chr3	23326651	23376651
-region1041	chr3	23376601	23426601
-region1042	chr3	23426551	23476551
-region1043	chr3	23476501	23526501
-region1044	chr3	23526451	23576451
-region1045	chr3	23576401	23626401
-region1046	chr3	23626351	23676351
-region1047	chr3	23676301	23726301
-region1048	chr3	23726251	23776251
-region1049	chr3	23776201	23826201
-region1050	chr3	23826151	23876151
-region1051	chr3	23876101	23926101
-region1052	chr3	23926051	23976051
-region1053	chr3	23976001	24026001
-region1054	chr3	24025951	24075951
-region1055	chr3	24075901	24125901
-region1056	chr3	24125851	24175851
-region1057	chr3	24175801	24225801
-region1058	chr3	24225751	24275751
-region1059	chr3	24275701	24325701
-region1060	chr3	24325651	24375651
-region1061	chr3	24375601	24425601
-region1062	chr3	24425551	24475551
-region1063	chr3	24475501	24525501
-region1064	chr3	24525451	24575451
-region1065	chr3	24575401	24625401
-region1066	chr3	24625351	24675351
-region1067	chr3	24675301	24725301
-region1068	chr3	24725251	24775251
-region1069	chr3	24775201	24825201
-region1070	chr3	24825151	24875151
-region1071	chr3	24875101	24925101
-region1072	chr3	24925051	24975051
-region1073	chr3	24975001	25025001
-region1074	chr3	25024951	25074951
-region1075	chr3	25074901	25124901
-region1076	chr3	25124851	25174851
-region1077	chr3	25174801	25224801
-region1078	chr3	25224751	25274751
-region1079	chr3	25274701	25324701
-region1080	chr3	25324651	25374651
-region1081	chr3	25374601	25424601
-region1082	chr3	25424551	25474551
-region1083	chr3	25474501	25524501
-region1084	chr3	25524451	25574451
-region1085	chr3	25574401	25624401
-region1086	chr3	25624351	25674351
-region1087	chr3	25674301	25724301
-region1088	chr3	25724251	25774251
-region1089	chr3	25774201	25824201
-region1090	chr3	25824151	25874151
-region1091	chr3	25874101	25924101
-region1092	chr3	25924051	25974051
-region1093	chr3	25974001	26024001
-region1094	chr3	26023951	26073951
-region1095	chr3	26073901	26123901
-region1096	chr3	26123851	26173851
-region1097	chr3	26173801	26223801
-region1098	chr3	26223751	26273751
-region1099	chr3	26273701	26323701
-region1100	chr3	26323651	26373651
-region1101	chr3	26373601	26423601
-region1102	chr3	26423551	26473551
-region1103	chr3	26473501	26523501
-region1104	chr3	26523451	26573451
-region1105	chr3	26573401	26623401
-region1106	chr3	26623351	26673351
-region1107	chr3	26673301	26723301
-region1108	chr3	26723251	26773251
-region1109	chr3	26773201	26823201
-region1110	chr3	26823151	26873151
-region1111	chr3	26873101	26923101
-region1112	chr3	26923051	26973051
-region1113	chr3	26973001	27023001
-region1114	chr3	27022951	27072951
-region1115	chr3	27072901	27122901
-region1116	chr3	27122851	27172851
-region1117	chr3	27172801	27222801
-region1118	chr3	27222751	27272751
-region1119	chr3	27272701	27322701
-region1120	chr3	27322651	27372651
-region1121	chr3	27372601	27422601
-region1122	chr3	27422551	27472551
-region1123	chr3	27472501	27522501
-region1124	chr3	27522451	27572451
-region1125	chr3	27572401	27622401
-region1126	chr3	27622351	27672351
-region1127	chr3	27672301	27722301
-region1128	chr3	27722251	27772251
-region1129	chr3	27772201	27822201
-region1130	chr3	27822151	27872151
-region1131	chr3	27872101	27922101
-region1132	chr3	27922051	27972051
-region1133	chr3	27972001	28022001
-region1134	chr3	28021951	28071951
-region1135	chr3	28071901	28121901
-region1136	chr3	28121851	28171851
-region1137	chr3	28171801	28221801
-region1138	chr3	28221751	28271751
-region1139	chr3	28271701	28321701
-region1140	chr2	1	50001
-region1141	chr2	49951	99951
-region1142	chr2	99901	149901
-region1143	chr2	149851	199851
-region1144	chr2	199801	249801
-region1145	chr2	249751	299751
-region1146	chr2	299701	349701
-region1147	chr2	349651	399651
-region1148	chr2	399601	449601
-region1149	chr2	449551	499551
-region1150	chr2	499501	549501
-region1151	chr2	549451	599451
-region1152	chr2	599401	649401
-region1153	chr2	649351	699351
-region1154	chr2	699301	749301
-region1155	chr2	749251	799251
-region1156	chr2	799201	849201
-region1157	chr2	849151	899151
-region1158	chr2	899101	949101
-region1159	chr2	949051	999051
-region1160	chr2	999001	1049001
-region1161	chr2	1048951	1098951
-region1162	chr2	1098901	1148901
-region1163	chr2	1148851	1198851
-region1164	chr2	1198801	1248801
-region1165	chr2	1248751	1298751
-region1166	chr2	1298701	1348701
-region1167	chr2	1348651	1398651
-region1168	chr2	1398601	1448601
-region1169	chr2	1448551	1498551
-region1170	chr2	1498501	1548501
-region1171	chr2	1548451	1598451
-region1172	chr2	1598401	1648401
-region1173	chr2	1648351	1698351
-region1174	chr2	1698301	1748301
-region1175	chr2	1748251	1798251
-region1176	chr2	1798201	1848201
-region1177	chr2	1848151	1898151
-region1178	chr2	1898101	1948101
-region1179	chr2	1948051	1998051
-region1180	chr2	1998001	2048001
-region1181	chr2	2047951	2097951
-region1182	chr2	2097901	2147901
-region1183	chr2	2147851	2197851
-region1184	chr2	2197801	2247801
-region1185	chr2	2247751	2297751
-region1186	chr2	2297701	2347701
-region1187	chr2	2347651	2397651
-region1188	chr2	2397601	2447601
-region1189	chr2	2447551	2497551
-region1190	chr2	2497501	2547501
-region1191	chr2	2547451	2597451
-region1192	chr2	2597401	2647401
-region1193	chr2	2647351	2697351
-region1194	chr2	2697301	2747301
-region1195	chr2	2747251	2797251
-region1196	chr2	2797201	2847201
-region1197	chr2	2847151	2897151
-region1198	chr2	2897101	2947101
-region1199	chr2	2947051	2997051
-region1200	chr2	2997001	3047001
-region1201	chr2	3046951	3096951
-region1202	chr2	3096901	3146901
-region1203	chr2	3146851	3196851
-region1204	chr2	3196801	3246801
-region1205	chr2	3246751	3296751
-region1206	chr2	3296701	3346701
-region1207	chr2	3346651	3396651
-region1208	chr2	3396601	3446601
-region1209	chr2	3446551	3496551
-region1210	chr2	3496501	3546501
-region1211	chr2	3546451	3596451
-region1212	chr2	3596401	3646401
-region1213	chr2	3646351	3696351
-region1214	chr2	3696301	3746301
-region1215	chr2	3746251	3796251
-region1216	chr2	3796201	3846201
-region1217	chr2	3846151	3896151
-region1218	chr2	3896101	3946101
-region1219	chr2	3946051	3996051
-region1220	chr2	3996001	4046001
-region1221	chr2	4045951	4095951
-region1222	chr2	4095901	4145901
-region1223	chr2	4145851	4195851
-region1224	chr2	4195801	4245801
-region1225	chr2	4245751	4295751
-region1226	chr2	4295701	434570