annotate test-data/phmmer.out @ 0:f239ab5f45f4 draft

planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
author iuc
date Sat, 25 Jun 2016 15:07:17 -0400
children be0cc39776f9
Ignore whitespace changes - Everywhere: Within whitespace: At end of lines:
rev   line source
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1 # phmmer :: search a protein sequence against a protein database
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
2 # HMMER 3.1b1 (May 2013);
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
3 # Copyright (C) 2013 Howard Hughes Medical Institute.
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
4 # Freely distributed under the GNU General Public License (GPLv3).
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
6 # query sequence file: test-data/globins45.fa
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
7 # target sequence database: test-data/uniprot_matches.fasta
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
8 # per-seq hits tabular output: test-data/phmmer.tblout
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
9 # per-dom hits tabular output: test-data/phmmer.domtblout
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
10 # pfam-style tabular hit output: test-data/phmmer.pfamtblout
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
11 # max ASCII text line length: unlimited
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
12 # Vit filter P threshold: <= 0.001
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
13 # Fwd filter P threshold: <= 1e-05
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
14 # random number seed set to: 4
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
15 # number of worker threads: 2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
16 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
18 Query: MYG_ESCGI [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
19 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
20 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
21 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
22 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
23 1.9e-97 310.4 5.6 2.1e-97 310.3 5.6 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
24 3.2e-11 30.7 0.1 3.5e-11 30.6 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
27 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
28 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
29 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
30 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
31 1 ! 310.3 5.6 2.1e-97 2.1e-97 1 153 [] 2 154 .] 2 154 .] 1.00
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
33 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
34 == domain 1 score: 310.3 bits; conditional E-value: 2.1e-97
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
35 MYG_ESCGI 1 vlsdaewqlvlniwakveadvaghgqdilirlfkghpetlekfdkfkhlkteaemkasedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpgdfgadaqaamnkalelfrkdiaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
36 vls+ ewqlvl++wakveadvaghgqdilirlfk+hpetlekfd+fkhlkteaemkasedlkkhg tvltalg+ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhsrhpgdfgadaq amnkalelfrkdiaakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
38 79******************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
40 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
41 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
42 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
43 1 ! 30.6 0.1 3.5e-11 3.5e-11 6 146 .. 8 146 .. 3 147 .] 0.91
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
45 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
46 == domain 1 score: 30.6 bits; conditional E-value: 3.5e-11
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
47 MYG_ESCGI 6 ewqlvlniwakveadvaghgqdilirlfkghpetlekfdkfkhlkteaemkasedlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrhpgdfgadaqaamnkalelfrkdiaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
48 e v +w kv d g + l rl+ +p t f+ f l t + + +k hg vl a++ l + + + l++ h k + + ++++ + ++ vl + +f qaa k + +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
50 6677889******99876..57899**********************9999*****************9999999****************99999999***********8888889**********99887777777776 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
54 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
55 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
56 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
57 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
58 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
59 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
60 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
61 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
62 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
63 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
64 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
65 # Mc/sec: 1.54
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
66 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
67 Query: MYG_HORSE [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
68 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
69 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
70 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
71 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
72 7.1e-93 295.7 5.0 7.9e-93 295.6 5.0 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
73 7.5e-12 32.7 0.1 9e-12 32.5 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
76 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
77 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
78 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
79 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
80 1 ! 295.6 5.0 7.9e-93 7.9e-93 2 153 .] 3 154 .] 2 154 .] 0.99
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
82 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
83 == domain 1 score: 295.6 bits; conditional E-value: 7.9e-93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
84 MYG_HORSE 2 lsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkasedlkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhpgnfgadaqgamtkalelfrndiaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
85 ls+gewq vl+vw+kvead+aghgq++lirlf +hpetlekfd+fkhlkteaemkasedlkkhg vltalg+ilkkkghheaelkplaqshatkhkipikylefis+aiihvlhs+hpg+fgadaqgam kalelfr diaakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
87 89*****************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
89 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
90 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
91 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
92 1 ! 32.5 0.1 9e-12 9e-12 7 146 .. 9 146 .. 4 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
94 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
95 == domain 1 score: 32.5 bits; conditional E-value: 9e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
96 MYG_HORSE 7 wqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkasedlkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhpgnfgadaqgamtkalelfrndiaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
97 v +wgkv d g e l rl+ +p t f+ f l t + + +k hg vl a++ l + + + l++ h k + + ++++ + ++ vl f q+a k + n +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
99 5668889*****99875..699************************9999*****************9999999****************99999999**********987777789***********999999999998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
103 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
104 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
105 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
106 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
107 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
108 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
109 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
110 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
111 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
112 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
113 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
114 # Mc/sec: 1.15
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
115 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
116 Query: MYG_PROGU [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
117 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
118 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
119 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
120 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
121 7.4e-88 279.4 3.7 8.3e-88 279.2 3.7 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
122 1.5e-12 35.0 0.1 1.6e-12 34.9 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
125 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
126 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
127 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
128 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
129 1 ! 279.2 3.7 8.3e-88 8.3e-88 2 153 .] 3 154 .] 2 154 .] 0.99
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
131 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
132 == domain 1 score: 279.2 bits; conditional E-value: 8.3e-88
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
133 MYG_PROGU 2 lsdgewqlvlnvwgkvegdlsghgqevlirlfkghpetlekfdkfkhlkaedemraseelkkhgttvltalggilkkkgqhaaelaplaqshatkhkipvkylefiseaiiqvlqskhpgdfgadaqgamskalelfrndiaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
134 ls+gewqlvl+vw+kve+d++ghgq++lirlfk+hpetlekfd+fkhlk e em+ase+lkkhg tvltalg+ilkkkg h ael plaqshatkhkip+kylefiseaii vl s+hpgdfgadaqgam+kalelfr diaakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
136 89*****************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
138 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
139 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
140 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
141 1 ! 34.9 0.1 1.6e-12 1.6e-12 6 146 .. 8 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
143 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
144 == domain 1 score: 34.9 bits; conditional E-value: 1.6e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
145 MYG_PROGU 6 ewqlvlnvwgkvegdlsghgqevlirlfkghpetlekfdkfkhlkaedemraseelkkhgttvltalggilkkkgqhaaelaplaqshatkhkipvkylefiseaiiqvlqskhpgdfgadaqgamskalelfrndiaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
146 e v +wgkv d g e l rl+ +p t f+ f l d + + ++k hg vl a++ l +a l++ h k + + ++++ ++ vl +f q+a k + n +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
148 56678889****98865..6799********************************************999999999999************99999999***********9888889*************99999999998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
152 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
153 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
154 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
155 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
156 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
157 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
158 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
159 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
160 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
161 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
162 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
163 # Mc/sec: 1.54
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
164 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
165 Query: MYG_SAISC [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
166 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
167 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
168 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
169 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
170 5e-87 276.6 4.6 5.5e-87 276.5 4.6 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
171 1e-12 35.5 0.1 1.1e-12 35.3 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
174 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
175 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
176 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
177 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
178 1 ! 276.5 4.6 5.5e-87 5.5e-87 2 153 .] 3 154 .] 2 154 .] 0.99
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
180 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
181 == domain 1 score: 276.5 bits; conditional E-value: 5.5e-87
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
182 MYG_SAISC 2 lsdgewqlvlniwgkveadipshgqevlislfkghpetlekfdkfkhlksedemkaseelkkhgttvltalggilkkkgqheaelkplaqshatkhkipvkylelisdaivhvlqkkhpgdfgadaqgamkkalelfrndmaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
183 ls+gewqlvl++w+kvead+ hgq++li lfk+hpetlekfd+fkhlk+e emkase+lkkhg tvltalg+ilkkkg heaelkplaqshatkhkip+kyle+is+ai+hvl +hpgdfgadaqgam kalelfr d+aakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
185 89*****************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
187 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
188 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
189 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
190 1 ! 35.3 0.1 1.1e-12 1.1e-12 6 146 .. 8 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
192 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
193 == domain 1 score: 35.3 bits; conditional E-value: 1.1e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
194 MYG_SAISC 6 ewqlvlniwgkveadipshgqevlislfkghpetlekfdkfkhlksedemkaseelkkhgttvltalggilkkkgqheaelkplaqshatkhkipvkylelisdaivhvlqkkhpgdfgadaqgamkkalelfrndmaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
195 e v +wgkv d g e l l+ +p t f+ f l + d + + ++k hg vl a++ l + + l++ h k + + ++l+ + +v vl +f q+a +k + n +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
197 5667889*****877..6799**********************************************9999999999**************99999999***********998899**************99999999998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
201 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
202 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
203 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
204 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
205 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
206 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
207 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
208 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
209 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
210 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
211 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
212 # Mc/sec: 1.54
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
213 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
214 Query: MYG_LYCPI [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
215 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
216 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
217 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
218 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
219 7e-86 272.9 4.1 7.8e-86 272.8 4.1 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
220 5.6e-15 42.8 0.0 6.1e-15 42.7 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
223 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
224 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
225 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
226 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
227 1 ! 272.8 4.1 7.8e-86 7.8e-86 2 153 .] 3 154 .] 2 154 .] 0.99
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
229 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
230 == domain 1 score: 272.8 bits; conditional E-value: 7.8e-86
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
231 MYG_LYCPI 2 lsdgewqivlniwgkvetdlaghgqevlirlfknhpetldkfdkfkhlktedemkgsedlkkhgntvltalggilkkkghheaelkplaqshatkhkipvkylefisdaiiqvlqnkhsgdfhadteaamkkalelfrndiaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
232 ls+gewq+vl++w+kve d+aghgq++lirlfk+hpetl+kfd+fkhlkte emk+sedlkkhg tvltalg+ilkkkghheaelkplaqshatkhkip+kylefis+aii vl ++h gdf ad + am kalelfr diaakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
234 89*****************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
236 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
237 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
238 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
239 1 ! 42.7 0.0 6.1e-15 6.1e-15 6 146 .. 8 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
241 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
242 == domain 1 score: 42.7 bits; conditional E-value: 6.1e-15
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
243 MYG_LYCPI 6 ewqivlniwgkvetdlaghgqevlirlfknhpetldkfdkfkhlktedemkgsedlkkhgntvltalggilkkkghheaelkplaqshatkhkipvkylefisdaiiqvlqnkhsgdfhadteaamkkalelfrndiaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
244 e v +wgkv d g e l rl+ +p t f+ f l t d + g+ +k hg vl a++ l + + + l++ h k + + ++++ + ++ vl + +f +aa +k + n +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
246 5667889*******9875..699*********************************************9999999****************99999999************99999***************9999999998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
250 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
251 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
252 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
253 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
254 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
255 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
256 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
257 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
258 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
259 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
260 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
261 # Mc/sec: 1.15
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
262 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
263 Query: MYG_MOUSE [L=153]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
264 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
265 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
266 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
267 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
268 6e-85 270.1 2.6 6.7e-85 269.9 2.6 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
269 3.2e-12 34.0 0.0 3.5e-12 33.9 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
272 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
273 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
274 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
275 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
276 1 ! 269.9 2.6 6.7e-85 6.7e-85 2 153 .] 3 154 .] 2 154 .] 0.99
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
278 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
279 == domain 1 score: 269.9 bits; conditional E-value: 6.7e-85
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
280 MYG_MOUSE 2 lsdgewqlvlnvwgkveadlaghgqevliglfkthpetldkfdkfknlkseedmkgsedlkkhgctvltalgtilkkkgqhaaeiqplaqshatkhkipvkylefiseiiievlkkrhsgdfgadaqgamskalelfrndiaakykelgfqg 153
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
281 ls+gewqlvl+vw+kvead+aghgq++li lfk+hpetl+kfd+fk+lk+e +mk+sedlkkhg tvltalg ilkkkg h ae++plaqshatkhkip+kylefise ii vl rh gdfgadaqgam+kalelfr diaakykelg+qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
283 89*****************************************************************************************************************************************************8 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
285 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
286 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
287 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
288 1 ! 33.9 0.0 3.5e-12 3.5e-12 6 146 .. 8 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
290 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
291 == domain 1 score: 33.9 bits; conditional E-value: 3.5e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
292 MYG_MOUSE 6 ewqlvlnvwgkveadlaghgqevliglfkthpetldkfdkfknlkseedmkgsedlkkhgctvltalgtilkkkgqhaaeiqplaqshatkhkipvkylefiseiiievlkkrhsgdfgadaqgamskalelfrndiaaky 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
293 e v +wgkv d g e l l+ +p t f+ f +l + + + g+ +k hg vl a++ l + l++ h k + + ++++ +++ vl + +f q+a k + n +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
295 56678889******9876..589999*********************************************999999999***********99999999***********999999**************99999999998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
299 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
300 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
301 Query model(s): 1 (153 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
302 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
303 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
304 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
305 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
306 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
307 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
308 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
309 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
310 # Mc/sec: 1.54
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
311 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
312 Query: MYG_MUSAN [L=148]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
313 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
314 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
315 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
316 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
317 1e-35 110.0 0.1 1.1e-35 109.9 0.1 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
318 8.3e-09 22.9 0.0 9.1e-09 22.7 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
321 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
322 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
323 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
324 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
325 1 ! 109.9 0.1 1.1e-35 1.1e-35 2 148 .] 7 154 .] 6 154 .] 0.98
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
327 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
328 == domain 1 score: 109.9 bits; conditional E-value: 1.1e-35
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
329 MYG_MUSAN 2 dwekvnsvwsavesdltaigqnillrlfeqypesqnhfpkfkn.kslgelkdtadikaqadtvlsalgnivkkkgshsqpvkalaathitthkipphyftkittiavdvlsemypsemnaqvqaafsgafkiicsdiekeykaanfqg 148
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
330 +w+ v vw+ ve+d+ gq+il+rlf+ +pe+ f +fk+ k+ +e+k + d+k tvl+alg i+kkkg h +k la +h t hkip y+ i+ + vl +p ++ a q a++ a++++ di +yk +qg
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
332 7*****************************************867889************************************************************************************************9998 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
334 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
335 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
336 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
337 1 ! 22.7 0.0 9.1e-09 9.1e-09 6 131 .. 12 136 .. 7 147 .] 0.87
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
339 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
340 == domain 1 score: 22.7 bits; conditional E-value: 9.1e-09
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
341 MYG_MUSAN 6 vnsvwsavesdltaigqnillrlfeqypesqnhfpkfknkslge.lkdtadikaqadtvlsalgnivkkkgshsqpvkalaathitthkipphyftkittiavdvlsemypsemnaqvqaafsgafk 131
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
342 v ++w v d +g l rl+ yp +q f f + s + + +ka vl a+++ + + l+ h + p+ f + + v vl+ + e+ vqaa+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
344 77899988766..78999*********************998762678999***********999998888888888999999**9999********************************986655 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
348 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
349 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
350 Query model(s): 1 (148 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
351 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
352 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
353 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
354 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
355 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
356 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
357 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
358 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
359 # Mc/sec: 1.48
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
360 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
361 Query: HBA_AILME [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
362 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
363 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
364 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
365 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
366 1.4e-34 106.1 0.2 1.7e-34 105.9 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
367 5.4e-11 29.8 0.5 6.4e-11 29.6 0.5 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
370 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
371 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
372 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
373 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
374 1 ! 105.9 0.2 1.7e-34 1.7e-34 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
376 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
377 == domain 1 score: 105.9 bits; conditional E-value: 1.7e-34
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
378 HBA_AILME 2 lspadktnvkatwdkigghageyggealertfasfpttktyfphf.dlsp.....gsaqvkahgkkvadalttavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpaeftpavhasldkffsavstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
379 l+p +k+ v a w k++ e ggeal r + +p t+ +f f dls g+ +vkahgkkv a++ ++hld+l g ++ ls+lh kl+vdp nfkll + l+ la h eftp v+a+ k + v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
381 789************95..78*********************99977774244448889***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
383 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
384 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
385 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
386 1 ! 29.6 0.5 6.4e-11 6.4e-11 3 140 .. 4 147 .. 2 148 .. 0.77
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
388 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
389 == domain 1 score: 29.6 bits; conditional E-value: 6.4e-11
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
390 HBA_AILME 3 spadktnvkatwdkigghageyggealertfasfpttktyfphfdlspgsaqvka......hgkkvadalttavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpaeftpavhasldkffsavstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
391 s + v w k+ + + +g + l r f s p t f +f a++ka hg v al + + l l+ ha k ++ ++++s++++ l s+hp +f + +++k + + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
393 55555667789*******999****************9999888766555555542211116666666666665555666678999******999997777799*****************99999999998887777777777 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
397 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
398 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
399 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
400 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
401 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
402 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
403 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
404 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
405 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
406 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
407 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
408 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
409 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
410 Query: HBA_PROLO [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
411 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
412 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
413 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
414 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
415 1.9e-33 102.5 0.2 2.2e-33 102.3 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
416 6.3e-10 26.3 0.3 7.5e-10 26.0 0.3 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
419 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
420 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
421 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
422 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
423 1 ! 102.3 0.2 2.2e-33 2.2e-33 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
425 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
426 == domain 1 score: 102.3 bits; conditional E-value: 2.2e-33
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
427 HBA_PROLO 2 lspadkanikatwdkigghageyggealertfasfpttktyfphf.dlsp.....gsaqvkahgkkvadaltlavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhasldkfftsvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
428 l+p +k+ + a w k++ e ggeal r + +p t+ +f f dls g+ +vkahgkkv a++ ++hld+l g ++ ls+lh kl+vdp nfkll + l+ la h eftp v+a+ k v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
430 789************95..78*********************99977774244448889***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
432 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
433 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
434 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
435 1 ! 26.0 0.3 7.5e-10 7.5e-10 8 140 .. 9 147 .. 2 148 .. 0.78
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
437 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
438 == domain 1 score: 26.0 bits; conditional E-value: 7.5e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
439 HBA_PROLO 8 anikatwdkigghageyggealertfasfpttktyfphfdlsp......gsaqvkahgkkvadaltlavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhasldkfftsvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
440 + w k+ + + +g + l r f s p t f +f +s +k hg v al + + l l+ ha k ++ ++++s++++ l +hp +f + +++k + + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
442 556678*******999****************9988887654401111145556778888888888777777778889************997777899*****************99999999887766666666665 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
446 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
447 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
448 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
449 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
450 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
451 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
452 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
453 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
454 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
455 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
456 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
457 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
458 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
459 Query: HBA_PAGLA [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
460 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
461 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
462 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
463 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
464 1e-30 93.5 0.2 1.2e-30 93.3 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
465 2.4e-10 27.7 0.5 3e-10 27.4 0.5 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
468 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
469 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
470 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
471 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
472 1 ! 93.3 0.2 1.2e-30 1.2e-30 4 140 .. 6 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
474 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
475 == domain 1 score: 93.3 bits; conditional E-value: 1.2e-30
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
476 HBA_PAGLA 4 sadknnikatwdkigshageygaealertfisfpttktyfphf.dls.....hgsaqvkahgkkvadaltlavghledlpnalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhsaldkffsavstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
477 +k+ + a w k++ e g eal r ++ +p t+ +f f dls g+ +vkahgkkv a++ ++hl++l ++ ls+lh kl+vdp nfkll + l+ la h eftp v++a k + v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
479 5689999******95..78*********************99977773333358899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
481 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
482 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
483 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
484 1 ! 27.4 0.5 3e-10 3e-10 2 140 .. 3 147 .. 2 148 .. 0.78
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
486 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
487 == domain 1 score: 27.4 bits; conditional E-value: 3e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
488 HBA_PAGLA 2 lssadknnikatwdkigshageygaealertfisfpttktyfphfdlsh......gsaqvkahgkkvadaltlavghledlpnalsalsdlhayklrvdpvnfkllshcllvtlachhpaeftpavhsaldkffsavstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
489 ls + + w k+ + + +g + l r f s p t f +f +s +k hg v al + l l+ ha k ++ ++++s++++ l +hp +f + a++k + + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
491 566666677789**************************99888886544001111455567788888888776655445555679999********997777899*******************999999999888777777777 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
495 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
496 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
497 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
498 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
499 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
500 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
501 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
502 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
503 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
504 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
505 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
506 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
507 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
508 Query: HBA_MACFA [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
509 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
510 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
511 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
512 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
513 4e-33 101.4 0.3 4.8e-33 101.1 0.3 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
514 1.4e-09 25.2 0.9 1.7e-09 24.9 0.9 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
517 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
518 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
519 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
520 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
521 1 ! 101.1 0.3 4.8e-33 4.8e-33 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
523 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
524 == domain 1 score: 101.1 bits; conditional E-value: 4.8e-33
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
525 HBA_MACFA 2 lspadktnvkaawgkvgghageygaealermflsfpttktyfphf.dls.....hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
526 l+p +k+ v a wgkv+ e g eal r+++ +p t+ +f f dls g+ +vk+hgkkv a++ ++h+d++ ++ ls+lh kl+vdp nfkll + l+ la h+ eftp v+a+ k +a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
528 789************95..78*********************99977773333358899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
530 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
531 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
532 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
533 1 ! 24.9 0.9 1.7e-09 1.7e-09 3 140 .. 4 147 .. 2 148 .. 0.81
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
535 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
536 == domain 1 score: 24.9 bits; conditional E-value: 1.7e-09
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
537 HBA_MACFA 3 spadktnvkaawgkvgghageygaealermflsfpttktyfphfdls......hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
538 s + v w+kv + + +g + l r+f s p t f +f +s +k hg v al + l l+ ha k ++ ++++s++++ l ++ p +f + +++k l + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
540 55555667789**************************988887754301111135667889999999999888877778888999*******999997677799******************9999999999988777777777 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
544 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
545 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
546 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
547 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
548 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
549 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
550 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
551 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
552 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
553 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
554 # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
555 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
556 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
557 Query: HBA_MACSI [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
558 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
559 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
560 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
561 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
562 2.9e-32 98.6 0.3 3.4e-32 98.4 0.3 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
563 1.1e-09 25.5 0.8 1.3e-09 25.3 0.8 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
566 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
567 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
568 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
569 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
570 1 ! 98.4 0.3 3.4e-32 3.4e-32 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
572 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
573 == domain 1 score: 98.4 bits; conditional E-value: 3.4e-32
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
574 HBA_MACSI 2 lspadktnvkdawgkvgghageygaealermflsfpttktyfphf.dls.....hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
575 l+p +k+ v wgkv+ e g eal r+++ +p t+ +f f dls g+ +vk+hgkkv a++ ++h+d++ ++ ls+lh kl+vdp nfkll + l+ la h+ eftp v+a+ k +a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
577 789************95..78*********************99977773333358899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
579 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
580 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
581 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
582 1 ! 25.3 0.8 1.3e-09 1.3e-09 2 140 .. 3 147 .. 2 148 .. 0.81
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
584 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
585 == domain 1 score: 25.3 bits; conditional E-value: 1.3e-09
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
586 HBA_MACSI 2 lspadktnvkdawgkvgghageygaealermflsfpttktyfphfdls......hgsaqvkghgkkvadaltlavghvddmpqalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
587 ls + v w+kv + + +g + l r+f s p t f +f +s +k hg v al + l l+ ha k ++ ++++s++++ l ++ p +f + +++k l + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
589 556666667889**************************988887754301111135667889999999999888877778888999*******999997677799******************9999999999988777777777 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
593 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
594 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
595 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
596 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
597 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
598 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
599 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
600 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
601 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
602 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
603 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
604 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
605 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
606 Query: HBA_PONPY [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
607 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
608 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
609 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
610 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
611 1.4e-33 103.0 0.2 1.6e-33 102.8 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
612 3e-10 27.5 0.6 3.5e-10 27.3 0.6 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
615 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
616 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
617 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
618 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
619 1 ! 102.8 0.2 1.6e-33 1.6e-33 2 140 .. 4 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
621 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
622 == domain 1 score: 102.8 bits; conditional E-value: 1.6e-33
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
623 HBA_PONPY 2 lspadktnvktawgkvgahagdygaealermflsfpttktyfphf.dls.....hgsaqvkdhgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
624 l+p +k+ v wgkv+ + g eal r+++ +p t+ +f f dls g+ +vk hgkkv a+++ +ah+d++ ++ ls+lh kl+vdp nfkll + l+ la h+ eftp v+a+ k +a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
626 789************97..5799*******************99977773333358899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
628 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
629 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
630 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
631 1 ! 27.3 0.6 3.5e-10 3.5e-10 3 140 .. 4 147 .. 2 148 .. 0.82
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
633 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
634 == domain 1 score: 27.3 bits; conditional E-value: 3.5e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
635 HBA_PONPY 3 spadktnvktawgkvgahagdygaealermflsfpttktyfphfdls......hgsaqvkdhgkkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
636 s + v w+kv a + +g + l r+f s p t f +f +s +k hg v al + l l+ ha k ++ ++++s++++ l ++ p +f + +++k l + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
638 55556667789**************************988877753301111145667899******9998888888888889*********999997777799******************9999999999988777777777 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
642 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
643 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
644 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
645 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
646 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
647 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
648 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
649 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
650 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
651 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
652 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
653 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
654 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
655 Query: HBA2_GALCR [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
656 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
657 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
658 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
659 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
660 1.4e-32 99.7 0.2 1.7e-32 99.4 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
661 9.9e-11 28.9 0.7 1.2e-10 28.7 0.7 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
664 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
665 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
666 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
667 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
668 1 ! 99.4 0.2 1.7e-32 1.7e-32 2 140 .. 4 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
670 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
671 == domain 1 score: 99.4 bits; conditional E-value: 1.7e-32
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
672 HBA2_GALCR 2 lsptdksnvkaawekvgahagdygaealermflsfpttktyfphf.dls.....hgstqvkghgkkvadaltnavlhvddmpsalsalsdlhahklrvdpvnfkllrhcllvtlachhpaeftpavhasldkfmasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
673 l+p +ks v a w kv+ + g eal r+++ +p t+ +f f dls g+ +vk+hgkkv a+++ + h+d++ ++ ls+lh kl+vdp nfkll + l+ la h eftp v+a+ k +a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
675 789************97..5799*******************9997676333336999************************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
677 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
678 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
679 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
680 1 ! 28.7 0.7 1.2e-10 1.2e-10 8 140 .. 9 147 .. 2 148 .. 0.80
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
682 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
683 == domain 1 score: 28.7 bits; conditional E-value: 1.2e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
684 HBA2_GALCR 8 snvkaawekvgahagdygaealermflsfpttktyfphfd...l...shgstqvkghgkkvadaltnavlhvddmpsalsalsdlhahklrvdpvnfkllrhcllvtlachhpaeftpavhasldkfmasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
685 v w kv a + +g + l r+f s p t f +f +s +k hg v al + + l l+ ha k ++ ++++ ++++ l +hp +f + +++k + + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
687 556779*************************9988777642112111346788999*******997655566777889*********9999976677899****************99999999998877766666666 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
691 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
692 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
693 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
694 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
695 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
696 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
697 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
698 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
699 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
700 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
701 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
702 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
703 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
704 Query: HBA_MESAU [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
705 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
706 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
707 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
708 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
709 6.9e-35 107.0 0.4 8.1e-35 106.7 0.4 1.1 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
710 1.2e-10 28.4 0.6 1.4e-10 28.2 0.6 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
713 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
714 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
715 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
716 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
717 1 ! 106.7 0.4 8.1e-35 8.1e-35 3 140 .. 5 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
719 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
720 == domain 1 score: 106.7 bits; conditional E-value: 8.1e-35
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
721 HBA_MESAU 3 sakdktniseawgkigghageygaealermffvypttktyfphf......dvshgsaqvkghgkkvadaltnavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpadftpavhasldkffasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
722 + ++k+ ++ wgk++ e g eal r++ vyp t+ +f f d g+ +vk+hgkkv a+++ ++hld+l g ++ ls+lh kl+vdp nfkll + l+ la+h +ftp v+a+ k a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
724 6789999*******95..78*********************9997444444557999************************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
726 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
727 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
728 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
729 1 ! 28.2 0.6 1.4e-10 1.4e-10 9 140 .. 10 147 .. 2 148 .. 0.78
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
731 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
732 == domain 1 score: 28.2 bits; conditional E-value: 1.4e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
733 HBA_MESAU 9 niseawgkigghageygaealermffvypttktyfphfdvs......hgsaqvkghgkkvadaltnavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpadftpavhasldkffasvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
734 + w+k+ + + +g + l r+f +p t f +f +s +k hg v al + + l l+ ha k ++ ++++s++++ l ++hp df + +++k + + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
736 56789*************************998877775430001114566778899999988877777777778899********999997777799*****************99999999887766666666665 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
740 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
741 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
742 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
743 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
744 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
745 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
746 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
747 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
748 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
749 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
750 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
751 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
752 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
753 Query: HBA2_BOSMU [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
754 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
755 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
756 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
757 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
758 6.5e-33 100.8 0.3 7.6e-33 100.6 0.3 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
759 2.1e-11 31.2 1.0 2.6e-11 30.9 1.0 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
762 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
763 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
764 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
765 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
766 1 ! 100.6 0.3 7.6e-33 7.6e-33 4 140 .. 6 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
768 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
769 == domain 1 score: 100.6 bits; conditional E-value: 7.6e-33
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
770 HBA2_BOSMU 4 aadkgnvkaawgkvgghaaeygaealermflsfpttktyfphf.dls.....hgsaqvkghgakvaaaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpavhasldkflanvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
771 +k+ v a wgkv+ e g eal r+++ +p t+ +f f dls g+ +vk+hg kv a++ ++hld+l g ++ ls+lh kl+vdp nfkll + l+ la h+ +ftp v+a+ k +a v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
773 678999********6..789********************99977773333358899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
775 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
776 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
777 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
778 1 ! 30.9 1.0 2.6e-11 2.6e-11 8 140 .. 9 147 .. 2 148 .. 0.79
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
780 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
781 == domain 1 score: 30.9 bits; conditional E-value: 2.6e-11
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
782 HBA2_BOSMU 8 gnvkaawgkvgghaaeygaealermflsfpttktyfphfdls......hgsaqvkghgakvaaaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpavhasldkflanvstvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
783 v w+kv + a +g + l r+f s p t f +f +s +k hg v al + + l l+ ha k ++ ++++s++++ l s+ p df + +++k l + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
785 556779**************************988877754301111145667899***9998877666666666789999******999997667799******************9999999999887777777766 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
789 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
790 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
791 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
792 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
793 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
794 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
795 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
796 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
797 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
798 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
799 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
800 # Mc/sec: 2.12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
801 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
802 Query: HBA_ERIEU [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
803 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
804 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
805 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
806 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
807 1.1e-31 97.0 0.4 1.3e-31 96.8 0.4 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
808 5.4e-12 33.2 0.3 6.4e-12 32.9 0.3 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
811 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
812 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
813 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
814 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
815 1 ! 96.8 0.4 1.3e-31 1.3e-31 4 140 .. 6 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
817 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
818 == domain 1 score: 96.8 bits; conditional E-value: 1.3e-31
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
819 HBA_ERIEU 4 atdkanvktfwgklgghggeyggealdrmfqahpttktyfphf.dln.p....gsaqvkghgkkvadalttavnnlddvpgalsalsdlhahklrvdpvnfkllshcllvtlalhhpadftpavhasldkflatvatvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
820 +k+ v +wgk++ e ggeal r++ +p t+ +f f dl+ p g+ +vk+hgkkv a++ + +ld++ g ++ ls+lh kl+vdp nfkll + l+ la h +ftp v+a+ k +a va l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
822 56899999*****96..57*********************99976653233448899***********************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
824 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
825 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
826 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
827 1 ! 32.9 0.3 6.4e-12 6.4e-12 10 140 .. 11 147 .. 2 148 .. 0.83
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
829 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
830 == domain 1 score: 32.9 bits; conditional E-value: 6.4e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
831 HBA_ERIEU 10 vktfwgklgghggeyggealdrmfqahpttktyfphfdln......pgsaqvkghgkkvadalttavnnlddvpgalsalsdlhahklrvdpvnfkllshcllvtlalhhpadftpavhasldkflatvatvltsky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
832 v w+k+ + + +g + l r+f++hp t f +f +s +k hg v al + + l l+ ha k ++ ++++s++++ l +hp df + +++k l + +ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
834 566899999999999**************9988877753301111235667899***********9***99**************999997777799*******************999999999998888888887 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
838 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
839 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
840 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
841 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
842 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
843 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
844 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
845 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
846 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
847 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
848 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
849 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
850 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
851 Query: HBA_FRAPO [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
852 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
853 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
854 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
855 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
856 3e-32 98.8 0.2 3.5e-32 98.6 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
857 6.8e-09 23.2 0.6 8.3e-09 22.9 0.6 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
860 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
861 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
862 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
863 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
864 1 ! 98.6 0.2 3.5e-32 3.5e-32 4 140 .. 6 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
866 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
867 == domain 1 score: 98.6 bits; conditional E-value: 3.5e-32
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
868 HBA_FRAPO 4 aadknnvkgifgkisshaedygaealermfitypstktyfphf.dls.....hgsaqvkghgkkvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgnvltaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
869 +k+ v +++gk++ ++ g eal r+++ yp t+ +f f dls g+ +vk+hgkkv+ a+ + h+d++ gt++ ls+lh kl+vdp nfkllg ++ v+a h +tp v+a+ k ++ v+n l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
871 66899999*****96..789********************99977773333358899**************************************************9999999999***********************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
873 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
874 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
875 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
876 1 ! 22.9 0.6 8.3e-09 8.3e-09 2 141 .] 3 148 .. 2 148 .. 0.83
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
878 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
879 == domain 1 score: 22.9 bits; conditional E-value: 8.3e-09
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
880 HBA_FRAPO 2 lsaadknnvkgifgkisshaedygaealermfitypstktyfphfdls......hgsaqvkghgkkvvaalieaanhiddiagtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgnvltakyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
881 ls + v +++k+ + +g + l r+f ++p t f +f +s +k hg v+ al + l l+ ha k ++ +++++++++ v+ +hp + + + +++k l + aky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
883 56666667788999************************998887754301111145667889***99999887777777788999********999997667799***************************99999888889885 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
887 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
888 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
889 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
890 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
891 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
892 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
893 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
894 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
895 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
896 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
897 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
898 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
899 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
900 Query: HBA_PHACO [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
901 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
902 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
903 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
904 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
905 8.6e-31 94.0 0.2 9.8e-31 93.8 0.2 1.1 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
906 9.6e-09 22.6 0.6 1.1e-08 22.4 0.6 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
909 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
910 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
911 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
912 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
913 1 ! 93.8 0.2 9.8e-31 9.8e-31 6 140 .. 8 146 .. 3 147 .] 0.90
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
915 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
916 == domain 1 score: 93.8 bits; conditional E-value: 9.8e-31
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
917 HBA_PHACO 6 dknnvkgiftkiaghaeeygaealermfitypstktyfphf.dls.....hgsaqikghgkkvvaalieavnhidditgtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgtvltaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
918 +k+ v +++ k+ + +e g eal r+++ yp t+ +f f dls g+ ++k+hgkkv+ a+ + + h+d++ gt++ ls+lh kl+vdp nfkllg ++ v+a h +tp v+a+ k ++ v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
920 666677777776..689*********************99977773333358899**************************************************9999999999**********************9999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
922 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
923 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
924 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
925 1 ! 22.4 0.6 1.1e-08 1.1e-08 3 141 .] 4 148 .. 2 148 .. 0.83
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
927 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
928 == domain 1 score: 22.4 bits; conditional E-value: 1.1e-08
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
929 HBA_PHACO 3 saadknnvkgiftkiaghaeeygaealermfitypstktyfphfdls......hgsaqikghgkkvvaalieavnhidditgtlsklsdlhahklrvdpvnfkllgqcflvvvaihhpsaltpevhasldkflcavgtvltakyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
930 s + v ++ k+ + +g + l r+f ++p t f +f +s +k hg v+ al + + l l+ ha k ++ +++++++++ v+ +hp + + + +++k l + aky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
932 5566666778899999999999***************998877753301111245677899******999999999999999**********999997677799***************************99888888888885 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
936 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
937 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
938 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
939 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
940 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
941 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
942 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
943 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
944 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
945 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
946 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
947 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
948 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
949 Query: HBA_TRIOC [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
950 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
951 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
952 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
953 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
954 4.4e-31 95.0 0.2 5.2e-31 94.7 0.2 1.1 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
955 4.8e-09 23.6 0.4 6e-09 23.3 0.4 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
958 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
959 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
960 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
961 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
962 1 ! 94.7 0.2 5.2e-31 5.2e-31 6 140 .. 8 146 .. 3 147 .] 0.89
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
964 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
965 == domain 1 score: 94.7 bits; conditional E-value: 5.2e-31
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
966 HBA_TRIOC 6 dktnvktvftkitghaedygaetlermfitypptktyfphf......dlhhgsaqikahgkkvvgalieavnhiddiagalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpsvltpevhasldkflcavgnvlsaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
967 +k+ v ++ k+ + ++ g e l r+++ yp t+ +f f d g+ ++kahgkkv+ga+ + + h+d++ g ++ ls+lh kl+vdp nfkllg ++ v+a h +tp v+a+ k ++ v+n l+ ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
969 566666666666..5789********************9997333334457999***************************************************9999999999***********************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
971 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
972 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
973 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
974 1 ! 23.3 0.4 6e-09 6e-09 4 141 .] 5 148 .. 2 148 .. 0.81
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
976 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
977 == domain 1 score: 23.3 bits; conditional E-value: 6e-09
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
978 HBA_TRIOC 4 andktnvktvftkitghaedygaetlermfitypptktyfphfdlh......hgsaqikahgkkvvgalieavnhiddiagalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpsvltpevhasldkflcavgnvlsakyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
979 + v v+ k+ + +g + l r+f ++p t f +f +s +k hg v+ al + + l l+ ha k ++ +++++++++ v+ +hp + + + +++k l ++aky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
981 5555667789999999999*****************99888775431111123566788899999877766666666677899************97777899***************************99999999999985 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
985 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
986 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
987 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
988 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
989 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
990 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
991 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
992 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
993 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
994 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
995 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
996 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
997 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
998 Query: HBA_ANSSE [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
999 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1000 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1001 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1002 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1003 1.5e-29 90.0 0.2 1.7e-29 89.8 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1004 2.2e-10 28.0 0.6 2.7e-10 27.7 0.6 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1007 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1008 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1009 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1010 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1011 1 ! 89.8 0.2 1.7e-29 1.7e-29 4 140 .. 6 146 .. 3 147 .] 0.91
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1013 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1014 == domain 1 score: 89.8 bits; conditional E-value: 1.7e-29
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1015 HBA_ANSSE 4 aadkgnvktvfgkigghaeeygaetlqrmfqtfpqtktyfphf.dlq.p....gsaqikahgkkvaaalveaanhiddiagalsklsdlhaqklrvdpvnfkflghcflvvlaihhpslltpevhasmdkflcavatvltaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1016 +k+ v ++gk+ + +e g e l r++ +p t+ +f f dl p g+ ++kahgkkv a+ + h+d++ g ++ ls+lh kl+vdp nfk+lg+ ++ vla h +tp v+a+ k ++ va l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1018 56788899999**9..589*********************99975542233338999**********************************************************************************9999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1020 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1021 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1022 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1023 1 ! 27.7 0.6 2.7e-10 2.7e-10 9 141 .] 10 148 .. 2 148 .. 0.82
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1025 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1026 == domain 1 score: 27.7 bits; conditional E-value: 2.7e-10
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1027 HBA_ANSSE 9 nvktvfgkigghaeeygaetlqrmfqtfpqtktyfphfdl...q...pgsaqikahgkkvaaalveaanhiddiagalsklsdlhaqklrvdpvnfkflghcflvvlaihhpslltpevhasmdkflcavatvltakyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1028 v v++k+ + +g + l r+f++ p+t f +f + +s +k hg v al + l l+ ha k ++ ++f++++++ vl +hp + + + +m+k l + aky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1030 566789999999999****************9888777531112111456678889999999988888888888899*************9777789*****************************9999999999985 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1034 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1035 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1036 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1037 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1038 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1039 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1040 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1041 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1042 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1043 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1044 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1045 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1046 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1047 Query: HBA_COLLI [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1048 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1049 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1050 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1051 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1052 2.7e-32 98.9 0.2 3.2e-32 98.7 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1053 5.1e-07 17.1 0.5 6.2e-07 16.8 0.5 1.2 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1056 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1057 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1058 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1059 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1060 1 ! 98.7 0.2 3.2e-32 3.2e-32 3 140 .. 5 146 .. 3 147 .] 0.92
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1062 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1063 == domain 1 score: 98.7 bits; conditional E-value: 3.2e-32
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1064 HBA_COLLI 3 sandksnvkavfakiggqagdlggealerlfitypqtktyfphf.dls.....hgsaqikghgkkvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpevhasldkfvlavgtvltaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1065 + +ks v a++ k++ ++ggeal rl++ yp t+ +f f dls g+ ++k+hgkkv a+ + h+d++ g ++ ls+lh kl+vdp nfkllg+ ++ v+a hf +tp v+a+ k v v+ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1067 56799999*****996..679********************99977773333358899**********************************************************************************9999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1069 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1070 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1071 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1072 1 ! 16.8 0.5 6.2e-07 6.2e-07 2 140 .. 3 147 .. 2 148 .. 0.77
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1074 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1075 == domain 1 score: 16.8 bits; conditional E-value: 6.2e-07
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1076 HBA_COLLI 2 lsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdls......hgsaqikghgkkvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpevhasldkfvlavgtvltaky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1077 ls + v v+ak+ + + g + l rlf ++p+t f +f +s +k hg v al + l l+ ha k ++ +++++++++ v+ + p + + + +++k + + aky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1079 566666778889*****999999***************9988877543011111456678999*9999999888888888889999*********99966667889999888888888888888888888777666666666666 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1083 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1084 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1085 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1086 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1087 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1088 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1089 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1090 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1091 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1092 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1093 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1094 # Mc/sec: 1.41
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1095 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1096 Query: HBAD_CHLME [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1097 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1098 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1099 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1100 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1101 6e-33 101.1 0.0 7.2e-33 100.8 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1102 2e-11 31.4 0.4 2.6e-11 31.1 0.4 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1105 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1106 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1107 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1108 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1109 1 ! 100.8 0.0 7.2e-33 7.2e-33 2 140 .. 4 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1111 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1112 == domain 1 score: 100.8 bits; conditional E-value: 7.2e-33
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1113 HBAD_CHLME 2 ltaddkklltqlwekvaghqeefgsealqrmfltypqtktyfphf......dlhpgseqvrghgkkvaaalgnavksldnlsqalselsnlhaynlrvdpanfkllaqcfqvvlathlgkdyspemhaafdkflsavaavlaeky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1114 lt ++k +t lw kv + +e g eal r+++ yp t+ +f f d g+ +v++hgkkv a+++ + ldnl ++ ls lh l+vdp nfkll + vla h+gk+++p ++aa+ k ++ va la ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1116 7999***********9..5799********************9997333333346999**************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1118 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1119 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1120 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1121 1 ! 31.1 0.4 2.6e-11 2.6e-11 5 141 .] 6 148 .. 2 148 .. 0.85
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1123 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1124 == domain 1 score: 31.1 bits; conditional E-value: 2.6e-11
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1125 HBAD_CHLME 5 ddkklltqlwekvaghqeefgsealqrmfltypqtktyfphfd...lh...pgseqvrghgkkvaaalgnavksldnlsqalselsnlhaynlrvdpanfkllaqcfqvvlathlgkdyspemhaafdkflsavaavlaekyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1126 + +l+ +w kv + g + l r+f ++p+t f +f + +se ++ hg v alg +k + l l+ ha ++ ++++++++ vl ++ d+ + + a++k l +a ky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1128 56678999***************************988776642113222257999**************************************99999999*9998877776666699**********99999998888885 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1132 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1133 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1134 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1135 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1136 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1137 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1138 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1139 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1140 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1141 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1142 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1143 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1144 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1145 Query: HBAD_PASMO [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1146 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1147 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1148 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1149 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1150 3.4e-32 98.5 0.0 4.1e-32 98.3 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1151 4.5e-12 33.4 0.1 5.1e-12 33.2 0.1 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1154 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1155 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1156 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1157 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1158 1 ! 98.3 0.0 4.1e-32 4.1e-32 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1160 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1161 == domain 1 score: 98.3 bits; conditional E-value: 4.1e-32
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1162 HBAD_PASMO 2 ltaedkkliqqiwgklggaeeeigadalwrmfhsypstktyfphf.dls.....qgsdqirghgkkvvaalsnaiknldnlsqalselsnlhaynlrvdpvnfkflsqclqvslatrlgkeyspevhsavdkfmsavasvlaeky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1163 lt e+k + +wgk++ +e+g +al r++ yp t+ +f f dls g+ ++++hgkkv+ a+s+ + +ldnl ++ ls lh l+vdp nfk+l l la ++gke++p v++a k ++ va+ la ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1165 899************97..579********************9997666333336999**************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1167 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1168 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1169 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1170 1 ! 33.2 0.1 5.1e-12 5.1e-12 6 141 .] 7 148 .. 1 148 [. 0.87
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1172 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1173 == domain 1 score: 33.2 bits; conditional E-value: 5.1e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1174 HBAD_PASMO 6 dkkliqqiwgklggaeeeigadalwrmfhsypstktyfphfd...l...sqgsdqirghgkkvvaalsnaiknldnlsqalselsnlhaynlrvdpvnfkflsqclqvslatrlgkeyspevhsavdkfmsavasvlaekyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1175 + +l+ +w+k+ + g d l r+f s+p t f +f ++s+ ++ hg v+ al +k + l l+ ha ++ ++f+s+++ l +r ++ + + a++k + +a ky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1177 568999******999999****************988776642112222368999************************************999777789******999********************9999999999985 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1181 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1182 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1183 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1184 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1185 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1186 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1187 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1188 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1189 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1190 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1191 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1192 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1193 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1194 Query: HBAZ_HORSE [L=141]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1195 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1196 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1197 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1198 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1199 3.3e-31 95.4 0.0 3.9e-31 95.2 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1200 1.5e-18 54.5 0.2 1.8e-18 54.3 0.2 1.1 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1203 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1204 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1205 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1206 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1207 1 ! 95.2 0.0 3.9e-31 3.9e-31 2 140 .. 4 146 .. 3 147 .] 0.94
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1209 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1210 == domain 1 score: 95.2 bits; conditional E-value: 3.9e-31
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1211 HBAZ_HORSE 2 ltkaertmvvsiwgkismqadavgtealqrlfssypqtktyfphf......dlhegspqlrahgskvaaavgdavksidnvagalaklselhayilrvdpvnfkflshcllvtlasrlpadftadahaawdkflsivssvlteky 140
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1212 lt e++ v ++wgk++ d vg eal rl+ yp t+ +f f d g+p+++ahg kv a +d + +dn+ g +a lselh l+vdp nfk+l + l+ la ++ +ft +aa+ k ++ v++ l ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1214 7899***********97..599********************99973333344579**************************************************************************************999 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1216 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1217 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1218 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1219 1 ! 54.3 0.2 1.8e-18 1.8e-18 2 141 .] 3 148 .. 2 148 .. 0.88
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1221 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1222 == domain 1 score: 54.3 bits; conditional E-value: 1.8e-18
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1223 HBAZ_HORSE 2 ltkaertmvvsiwgkismqadavgtealqrlfssypqtktyfphfd...lh...egspqlrahgskvaaavgdavksidnvagalaklselhayilrvdpvnfkflshcllvtlasrlpadftadahaawdkflsivssvltekyr 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1224 l++ e +v+ +w+k+ g + l rlf s+p+t f +f + ++s l+ hg v a+g +k + + l l++ ha ++ ++f+s++++ l sr p df ada+ a +k l + + ky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1226 56788899********9999999***************9888776421122222578999*********************************99999777789*******************************99988888885 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1230 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1231 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1232 Query model(s): 1 (141 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1233 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1234 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1235 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1236 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1237 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1238 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1239 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1240 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1241 # Mc/sec: 1.06
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1242 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1243 Query: HBA4_SALIR [L=142]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1244 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1245 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1246 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1247 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1248 2.7e-34 105.3 0.0 3e-34 105.1 0.0 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1249 8.3e-11 29.2 0.2 9.8e-11 29.0 0.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1252 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1253 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1254 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1255 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1256 1 ! 105.1 0.0 3e-34 3e-34 2 141 .. 4 146 .. 3 147 .] 0.93
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1258 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1259 == domain 1 score: 105.1 bits; conditional E-value: 3e-34
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1260 HBA4_SALIR 2 lsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasva.p....gsapvkkhgitimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftpeihlsvdkflqqlalalaeky 141
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1261 l+ ++k+ v a+wgk+ de+g +al r+lvvyp t+ +f + ++ p g+ vk hg ++ + d ++h+d+l g + lselh kl+vdp nfk+l + l+ v+a +f eftp ++ + k + +a ala ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1263 567899*********9..57**********************99987642233337889*************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1265 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1266 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1267 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1268 1 ! 29.0 0.2 9.8e-11 9.8e-11 10 142 .] 11 148 .. 3 148 .. 0.86
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1270 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1271 == domain 1 score: 29.0 bits; conditional E-value: 9.8e-11
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1272 HBA4_SALIR 10 vkaiwgkilpksdeigeqalsrmlvvypqtkay...fshwasva..pgsapvkkhgitimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftpeihlsvdkflqqlalalaekyr 142
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1273 v +w+k+ g+ l r++ +p+t f h + a +s +kkhg+t++ + + + l l++ hatk ++ ++++++ +i v+ + p +f + + +++k l+ + +a ky+
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1275 55689999988888999*************876122456666552246789***********99999888888899**************99999*******************************999999999986 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1279 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1280 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1281 Query model(s): 1 (142 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1282 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1283 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1284 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1285 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1286 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1287 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1288 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1289 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.04
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1290 # Mc/sec: 1.07
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1291 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1292 Query: HBB_ORNAN [L=146]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1293 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1294 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1295 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1296 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1297 1.6e-78 248.9 0.3 1.8e-78 248.8 0.3 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1298 5.8e-14 39.5 0.1 6.3e-14 39.4 0.1 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1301 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1302 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1303 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1304 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1305 1 ! 248.8 0.3 1.8e-78 1.8e-78 1 146 [] 2 147 .] 2 147 .] 1.00
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1307 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1308 == domain 1 score: 248.8 bits; conditional E-value: 1.8e-78
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1309 HBB_ORNAN 1 vhlsggeksavtnlwgkvninelggealgrllvvypwtqrffeafgdlssagavmgnpkvkahgakvltsfgdalknlddlkgtfaklselhcdklhvdpenfnrlgnvlivvlarhfskdfspevqaawqklvsgvahalghkyh 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1310 vhl+ eksavt lwgkvn++e+ggealgrllvvypwtqrffe+fgdls+ avmgnpkvkahg kvl +f+d l +ld+lkgtfa lselhcdklhvdpenf lgnvl+ vla+hf k+f+p vqaa+qk+v+gva+al+hkyh
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1312 79***********************************************************************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1314 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1315 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1316 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1317 1 ! 39.4 0.1 6.3e-14 6.3e-14 3 135 .. 3 137 .. 1 148 [. 0.89
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1319 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1320 == domain 1 score: 39.4 bits; conditional E-value: 6.3e-14
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1321 HBB_ORNAN 3 lsggeksavtnlwgkvninelg..gealgrllvvypwtqrffeafgdlssagavmgnpkvkahgakvltsfgdalknlddlkgtfaklselhcdklhvdpenfnrlgnvlivvlarhfskdfspevqaawqklvs 135
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1322 ls ge v ++w+kv + g + l rl+ +p t + f+ f l + + + ++ +k hg vlt++g lk ++ + l++ h+ k + + + ++ +i vl + df + q a k +
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1324 7899************8776643167899******************************************************************8888888899999999999888899*********999776 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1328 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1329 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1330 Query model(s): 1 (146 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1331 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1332 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1333 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1334 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1335 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1336 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1337 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1338 # CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.05
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1339 # Mc/sec: 0.88
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1340 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1341 Query: HBB_TACAC [L=146]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1342 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1343 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1344 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1345 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1346 2.2e-79 251.4 0.3 2.4e-79 251.3 0.3 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1347 2.3e-12 34.1 0.2 2.5e-12 34.0 0.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1350 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1351 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1352 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1353 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1354 1 ! 251.3 0.3 2.4e-79 2.4e-79 1 146 [] 2 147 .] 2 147 .] 1.00
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1356 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1357 == domain 1 score: 251.3 bits; conditional E-value: 2.4e-79
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1358 HBB_TACAC 1 vhlsgsektavtnlwghvnvnelggealgrllvvypwtqrffesfgdlssadavmgnakvkahgakvltsfgdalknldnlkgtfaklselhcdklhvdpenfnrlgnvlvvvlarhfskeftpeaqaawqklvsgvshalahkyh 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1359 vhl+ ek+avt lwg vnv+e+ggealgrllvvypwtqrffesfgdls+ davmgn kvkahg kvl +f+d l +ldnlkgtfa lselhcdklhvdpenf lgnvlv vla+hf keftp qaa+qk+v+gv++alahkyh
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1361 7************************************************************************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1363 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1364 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1365 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1366 1 ! 34.0 0.2 2.5e-12 2.5e-12 3 145 .. 3 147 .. 1 148 [. 0.87
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1368 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1369 == domain 1 score: 34.0 bits; conditional E-value: 2.5e-12
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1370 HBB_TACAC 3 lsgsektavtnlwghvnvnelg..gealgrllvvypwtqrffesfgdlssadavmgnakvkahgakvltsfgdalknldnlkgtfaklselhcdklhvdpenfnrlgnvlvvvlarhfskeftpeaqaawqklvsgvshalahky 145
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1371 ls e v ++w+ v + g + l rl+ +p t + f+ f l + + ++ +k hg vlt++g lk + ++ + l++ h+ k + + + ++ ++ vl + +f +aq a k + +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1373 566677789999*9998766542168899*******************9999999999*************************************8888888899999999999877889**********999887777777666 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1377 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1378 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1379 Query model(s): 1 (146 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1380 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1381 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1382 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1383 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1384 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1385 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1386 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1387 # CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1388 # Mc/sec: 1.46
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1389 //
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1390 Query: HBE_PONPY [L=146]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1391 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1392 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1393 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1394 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1395 1.9e-80 254.8 0.2 2.2e-80 254.6 0.2 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1396 1.8e-13 37.8 0.2 2.1e-13 37.6 0.2 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1399 Domain annotation for each sequence (and alignments):
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1400 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1401 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1402 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1403 1 ! 254.6 0.2 2.2e-80 2.2e-80 1 146 [] 2 147 .] 2 147 .] 1.00
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1405 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1406 == domain 1 score: 254.6 bits; conditional E-value: 2.2e-80
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1407 HBE_PONPY 1 vhftaeekaavtslwskmnveeaggealgrllvvypwtqrffdsfgnlsspsailgnpkvkahgkkvltsfgdaiknmdnlkttfaklselhcdklhvdpenfkllgnvmviilathfgkeftpevqaawqklvsavaialahkyh 146
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1408 vh+t eek+avt+lw k+nv+e ggealgrllvvypwtqrff+sfg+ls+p a++gnpkvkahgkkvl +f+d + ++dnlk tfa lselhcdklhvdpenfkllgnv+v +la hfgkeftp vqaa+qk+v+ va alahkyh
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1410 7************************************************************************************************************************************************9 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1412 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1413 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1414 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1415 1 ! 37.6 0.2 2.1e-13 2.1e-13 10 145 .. 10 147 .. 3 148 .. 0.90
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1417 Alignments for each domain:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1418 == domain 1 score: 37.6 bits; conditional E-value: 2.1e-13
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1419 HBE_PONPY 10 avtslwskmnveeag..gealgrllvvypwtqrffdsfgnlsspsailgnpkvkahgkkvltsfgdaiknmdnlkttfaklselhcdklhvdpenfkllgnvmviilathfgkeftpevqaawqklvsavaialahky 145
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1420 v +w+k+ + ag + l rl+ +p t + fd f +l + + + ++ +k hg vlt++g +k + + + l++ h+ k + + +++++ ++ +l ++ +f + q a k + +a ky
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1422 57789***99998864157899******************************************************************99999999********9999988899**********99888777777766 PP
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1426 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1427 -------------------------------------
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1428 Query model(s): 1 (146 nodes)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1429 Target sequences: 2 (301 residues searched)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1430 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1431 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1432 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1433 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1434 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1435 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1436 # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1437 # Mc/sec: 1.46
f239ab5f45f4 planemo upload for repository commit 4261b86af790a3535c0b9a8122f92225f8f67b47
diff changeset
1438 //