changeset 1:5c87e4907e08 draft

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hyphy/ commit 2c7a7ff8a55e7584e84335baa3159a63ce7a590c"
author iuc
date Wed, 21 Aug 2019 12:24:13 -0400
parents 419cd817299c
children de93e1fbdc31
files hyphy_absrel.xml macros.xml test-data/bgm-in1.fa test-data/bgm-in1.nhx test-data/bgm-out1.json test-data/fade-in1.fa test-data/fade-in1.nhx test-data/fade-out1.json test-data/fubar-out1.json test-data/gard-in1.fa test-data/gard-out1.json test-data/gard-out1.nex test-data/meme-in1.fa test-data/meme-in1.nhx test-data/meme-out1.json test-data/relax-in1.fa test-data/relax-in1.nhx test-data/relax-in2.nhx test-data/relax-out1.json test-data/sm19-in1.nhx test-data/sm19-in2.nhx test-data/sm19-out1.json test-data/sm19-out2.json
diffstat 23 files changed, 19283 insertions(+), 10260 deletions(-) [+]
line wrap: on
line diff
--- a/hyphy_absrel.xml	Thu Jan 17 04:22:13 2019 -0500
+++ b/hyphy_absrel.xml	Wed Aug 21 12:24:13 2019 -0400
@@ -4,47 +4,40 @@
     <macros>
         <import>macros.xml</import>
     </macros>
-    <expand macro="requirements" />
-    <expand macro="version_command" />
-    <command detect_errors="exit_code">
-    <![CDATA[
-    ln -s '$input_file' absrel_input.fa &&
-    ln -s '$input_nhx' absrel_input.nhx &&
-    echo $gencodeid > tool_params &&
-    echo `pwd`/absrel_input.fa >> tool_params &&
-    echo `pwd`/absrel_input.nhx >> tool_params &&
-    echo '$branches' >> tool_params &&
-    @HYPHY_INVOCATION@ \$HYPHY_LIB/TemplateBatchFiles/SelectionAnalyses/aBSREL.bf
-    #if $log:
-        > '$absrel_log'
-    #end if
-    ]]>
-    </command>
+    <expand macro="requirements"/>
+    <command detect_errors="exit_code"><![CDATA[
+        ln -s '$input_file' absrel_input.fa &&
+        ln -s '$input_nhx' absrel_input.nhx &&
+        @HYPHY_INVOCATION@ absrel
+            --alignment ./absrel_input.fa
+            --tree ./absrel_input.nhx
+            --code '$gencodeid'
+            --branches '$branches'
+            > '$absrel_log'
+        ]]></command>
     <inputs>
-        <expand macro="inputs" />
-        <param name="log" type="boolean" truevalue="" falsevalue="" label="Output aBSREL log to history" />
-        <expand macro="gencode" />
-        <expand macro="branches" />
+        <expand macro="inputs"/>
+        <param name="log" type="boolean" truevalue="" falsevalue="" label="Output aBSREL log to history"/>
+        <expand macro="gencode"/>
+        <expand macro="branches"/>
     </inputs>
     <outputs>
         <data name="absrel_log" format="txt">
             <filter>log</filter>
         </data>
-        <data name="absrel_output" format="json" from_work_dir="absrel_input.fa.ABSREL.json" />
+        <data name="absrel_output" format="hyphy_results.json" from_work_dir="absrel_input.fa.ABSREL.json"/>
     </outputs>
     <tests>
         <test>
-            <param name="input_file" ftype="fasta" value="absrel-in1.fa" />
-            <param name="input_nhx" ftype="nhx" value="absrel-in1.nhx" />
-            <param name="log" value="false" />
-            <output name="absrel_output" file="absrel-out1.json" compare="sim_size" />
+            <param name="input_file" ftype="fasta" value="absrel-in1.fa"/>
+            <param name="input_nhx" ftype="nhx" value="absrel-in1.nhx"/>
+            <param name="log" value="false"/>
+            <output name="absrel_output" file="absrel-out1.json" compare="sim_size"/>
         </test>
     </tests>
-    <help>
-        <![CDATA[
+    <help><![CDATA[
 aBSREL (Adaptive branch-site random effects likelihood) uses an adaptive random effects branch-site model framework to test whether each branch has evolved under positive selection, using a procedure which infers an optimal number of rate categories per branch.
-        ]]>
-    </help>
+    ]]></help>
     <expand macro="citations">
         <citation type="doi">10.1093/molbev/msv022</citation>
     </expand>
--- a/macros.xml	Thu Jan 17 04:22:13 2019 -0500
+++ b/macros.xml	Wed Aug 21 12:24:13 2019 -0400
@@ -1,57 +1,87 @@
 <?xml version="1.0"?>
 <macros>
     <xml name="inputs">
-        <param name="input_file" type="data" format="fasta" label="Input FASTA file" />
-        <param name="input_nhx" type="data" format="nhx" label="Input newick file" />
+        <param name="input_file" type="data" format="fasta" label="Input FASTA file"/>
+        <param name="input_nhx" type="data" format="nhx" label="Input newick file"/>
+    </xml>
+    <xml name="substitution">
+        <param name="model" type="select" label="Substitution model">
+            <option value="LG">LG - Generalist empirical model from
+            Le and Gascuel (2008)</option>
+            <option value="HIVBm">HIVBm - Specialist empirical model
+            for between-host HIV sequences</option>
+            <option value="HIVWm">HIVWm - Specialist empirical model
+            for within-host HIV sequences</option>
+            <option value="WAG">WAG - Generalist empirical model from
+            Whelan and Goldman (2001)</option>
+            <option value="JTT">JTT - Generalist empirical model from
+            Jones, Taylor, and Thornton (1996)</option>
+            <option value="JC69">JC69 - Generalist empirical model
+            from with equal exchangeability rates</option>
+            <option value="mtMet">mtMet - Specialist empirical model
+            for metazoan mitochondrial genomes</option>
+            <option value="mtVer">mtVer - Specialist empirical model
+            for vertebrate mitochondrial genomes</option>
+            <option value="mtInv">mtInv - Specialist empirical model
+            for invertebrate mitochondrial genomes</option>
+            <option value="gcpREV">gcpREV - Specialist empirical
+            model for green plant chloroplast genomes</option>
+            <option value="GTR">GTR - General time reversible
+            model</option>
+        </param>
     </xml>
     <xml name="gencode">
         <param name="gencodeid" type="select" label="Genetic code">
-            <option value="1">Universal code</option>
-            <option value="2">Vertebrate mitochondrial DNA code</option>
-            <option value="3">Yeast mitochondrial DNA code</option>
-            <option value="4">Mold, Protozoan and Coelenterate mt; Mycloplasma/Spiroplasma</option>
-            <option value="5">Invertebrate mitochondrial DNA code</option>
-            <option value="6">Ciliate, Dasycladacean and Hexamita Nuclear code</option>
-            <option value="7">Echinoderm mitochondrial DNA code</option>
-            <option value="8">Euplotid Nuclear code</option>
-            <option value="9">Alternative Yeast Nuclear code</option>
-            <option value="10">Ascidian mitochondrial DNA code</option>
-            <option value="11">Flatworm mitochondrial DNA code</option>
-            <option value="12">Blepharisma Nuclear code</option>
+            <option value="Universal">Universal code</option>
+            <option value="Vertebrate-mtDNA">Vertebrate mitochondrial DNA
+            code</option>
+            <option value="Yeast-mtDNA">Yeast mitochondrial DNA
+            code</option>
+            <option value="Mold-Protozoan-mtDNA">Mold, Protozoan and
+            Coelenterate mt; Mycloplasma/Spiroplasma</option>
+            <option value="Invertebrate-mtDNA">Invertebrate mitochondrial
+            DNA code</option>
+            <option value="Ciliate-Nuclear">Ciliate, Dasycladacean and
+            Hexamita Nuclear code</option>
+            <option value="Echinoderm-mtDNA">Echinoderm mitochondrial DNA
+            code</option>
+            <option value="Euplotid-Nuclear">Euplotid Nuclear
+            code</option>
+            <option value="Alt-Yeast-Nuclear">Alternative Yeast Nuclear
+            code</option>
+            <option value="Ascidian-mtDNA">Ascidian mitochondrial DNA
+            code</option>
+            <option value="Flatworm-mtDNA">Flatworm mitochondrial DNA
+            code</option>
+            <option value="Blepharisma-Nuclear">Blepharisma Nuclear
+            code</option>
         </param>
     </xml>
     <xml name="branches">
         <param name="branches" type="select" label="Set of branches to test">
-            <option value="1">All branches</option>
-            <option value="2">Internal branches</option>
-            <option value="3">Leaf branches</option>
-            <option value="4">Unlabeled branches</option>
+            <option value="All">All branches</option>
+            <option value="Internal">Internal branches</option>
+            <option value="Leaves">Leaf branches</option>
+            <option value="'Unlabeled-branches'">Unlabeled
+            branches</option>
         </param>
     </xml>
-    <xml name="version_command">
-        <version_command>HYPHYMP --version | tail -n 1 | awk '{print $1}'</version_command>
-    </xml>
     <xml name="citations">
         <citations>
             <citation type="doi">10.1093/bioinformatics/bti079</citation>
-            <yield />
+            <yield/>
         </citations>
     </xml>
-    <token name="@VERSION@">2.3.14</token>
+    <token name="@VERSION@">2.5.0</token>
     <xml name="requirements">
         <requirements>
-            <requirement type="package" version="@VERSION@">hyphy</requirement>
-            <yield />
+            <requirement type="package" version="@VERSION@">
+            hyphy</requirement>
+            <yield/>
         </requirements>
     </xml>
-    <token name="@HYPHY_INVOCATION@"><![CDATA[export HYPHY=`which HYPHYMP` &&
+    <token name="@HYPHY_ENVIRONMENT@"><![CDATA[export HYPHY=`which hyphy` &&
 export HYPHY_PATH=`dirname \$HYPHY` &&
-export HYPHY_LIB=`readlink -f \$HYPHY_PATH/../lib/hyphy` &&
-cat tool_params | HYPHYMP LIBPATH=\$HYPHY_LIB ]]>
-    </token>
-    <token name="@HYPHYMPI_INVOCATION@"><![CDATA[export HYPHY=`which HYPHYMP` &&
-export HYPHY_PATH=`dirname \$HYPHY` &&
-export HYPHY_LIB=`readlink -f \$HYPHY_PATH/../lib/hyphy` &&
-cat tool_params | mpirun -np \${GALAXY_SLOTS:-1} HYPHYMPI LIBPATH=\$HYPHY_LIB ]]>
-    </token>
-</macros>
\ No newline at end of file
+export HYPHY_LIB=`readlink -f \$HYPHY_PATH/../lib/hyphy` &&]]></token>
+    <token name="@HYPHY_INVOCATION@"><![CDATA[@HYPHY_ENVIRONMENT@ hyphy LIBPATH=\$HYPHY_LIB ]]></token>
+</macros>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/bgm-in1.fa	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,20 @@
+>Human
+GCACAATTCAGAAAAGAGAAAGAGACTTTC
+>Chimp
+GCACAATTCAGAAAAGAGAAAGAGACTTTC
+>Baboon
+GCACAATTCAGAAAAGAGAAGGAGACTTTC
+>RhMonkey
+GCACAATTCAGAAAAGAGAAGGAGACTTTC
+>Cow
+GCACGAATAAAGAAAGATATGCCACTTCAC
+>Pig
+GCAGAATTTAAAAAAAACAAAGAAACTCAC
+>Horse
+GCAAAATTCAAAAATGGCAGTATGACTTTC
+>Cat
+GCGAGGTTCCAAATTAGCAACAAGCCTAAG
+>Mouse
+GCAGAGTTTAAAAGGAAGAAGCCACCTTTT
+>Rat
+GCCGAGTTTAAAAGGAAGATGAAGCCTTTT
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/bgm-in1.nhx	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,1 @@
+((((Pig:0.147969,Cow:0.213430):0.085099,Horse:0.165787,Cat:0.264806):0.058611,((RhMonkey:0.002015,Baboon:0.003108):0.022733,(Human:0.004349,Chimp:0.000799):0.011873):0.101856):0.340802,Rat:0.050958,Mouse:0.097950);
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/bgm-out1.json	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,408 @@
+{
+ "MLE":{
+   "content":    [
+[3, 4, 0.01806536842133838, 0.0196151052739404, 0.03768047369527878, 2, 4, 1],
+    [3, 5, 0.0136689326165866, 0.08411879896894461, 0.09778773158553121, 2, 2, 1],
+    [3, 6, 0.01626880980001384, 0.05621779910581199, 0.07248660890582583, 2, 2, 1],
+    [3, 7, 0.01296085994820069, 0.02206081801264715, 0.03502167796084783, 2, 1, 0],
+    [3, 9, 0.01069476203525126, 0.01376808584576788, 0.02446284788101914, 2, 3, 0],
+    [3, 10, 0.05465425513197631, 0.1433115560788012, 0.1979658112107776, 2, 1, 1],
+    [3, 11, 0.02893963856420952, 0.01605584764833427, 0.04499548621254379, 2, 1, 0],
+    [3, 12, 0.01072516405613842, 0.0249434485528662, 0.03566861260900463, 2, 1, 0],
+    [3, 14, 0.02105948857071199, 0.05408645518169206, 0.07514594375240405, 2, 2, 1],
+    [3, 15, 0.0123000231875007, 0.02432900062064017, 0.03662902380814088, 2, 3, 1],
+    [3, 16, 0.005326227185235535, 0.02715178476956077, 0.0324780119547963, 2, 4, 1],
+    [3, 17, 0.03377277022598092, 0.04443847194728315, 0.07821124217326408, 2, 2, 1],
+    [3, 18, 0.01498654024671119, 0.01399705284721538, 0.02898359309392656, 2, 2, 0],
+    [3, 20, 0.03160117895292701, 0.03379356385898681, 0.06539474281191382, 2, 3, 1],
+    [3, 21, 0.005825814343840907, 0.01762290041418722, 0.02344871475802813, 2, 5, 1],
+    [3, 22, 0.004808842565391303, 0.01857986311191453, 0.02338870567730583, 2, 5, 1],
+    [3, 23, 0.01560225549428971, 0.01369335589628938, 0.02929561139057909, 2, 3, 0],
+    [3, 24, 0.02796792379060828, 0.0120172661798151, 0.03998518997042338, 2, 2, 0],
+    [3, 25, 0.004879890854338218, 0.05174659736268138, 0.05662648821701959, 2, 3, 1],
+    [3, 26, 0.008542556433088364, 0.02342067235707167, 0.03196322879016003, 2, 1, 0],
+    [3, 28, 0.02842598870361674, 0.04882702442678508, 0.07725301313040182, 2, 2, 1],
+    [3, 29, 0.02983611705240465, 0.04834281650968934, 0.07817893356209399, 2, 2, 1],
+    [3, 30, 0.02136530753356511, 0.056551049600131, 0.0779163571336961, 2, 2, 1],
+    [4, 5, 0.04128639081201998, 0.1643521228119713, 0.2056385136239913, 4, 2, 2],
+    [4, 6, 0.002891680521324363, 0.02014100082658794, 0.0230326813479123, 4, 2, 1],
+    [4, 7, 0.01937071123900217, 0.03955420345740617, 0.05892491469640834, 4, 1, 1],
+    [4, 9, 0.005876622911646858, 0.01316366694762399, 0.01904028985927084, 4, 3, 1],
+    [4, 10, 0.02063883956421052, 0.03235708509290364, 0.05299592465711416, 4, 1, 1],
+    [4, 11, 0.05646705485150577, 0.03046422064113512, 0.08693127549264089, 4, 1, 1],
+    [4, 12, 0.018550325874111, 0.04456585108483763, 0.06311617695894862, 4, 1, 1],
+    [4, 14, 0.002644483178150749, 0.02400887432195999, 0.02665335750011074, 4, 2, 1],
+    [4, 15, 0.01378625971212575, 0.03709407143284885, 0.05088033114497461, 4, 3, 2],
+    [4, 16, 0.005366210549264398, 0.0254419855729714, 0.03080819612223579, 4, 4, 2],
+    [4, 17, 0.08506807888824773, 0.08873474434715359, 0.1738028232354013, 4, 2, 2],
+    [4, 18, 0.01666065271395927, 0.01550783907099662, 0.03216849178495589, 4, 2, 1],
+    [4, 20, 0.0602710511807769, 0.03562465630098035, 0.09589570748175724, 4, 3, 2],
+    [4, 21, 0.03064565490801606, 0.06355132795273535, 0.09419698286075141, 4, 5, 3],
+    [4, 22, 0.02451199601165472, 0.07489768093572295, 0.09940967694737768, 4, 5, 3],
+    [4, 23, 0.03630394203907011, 0.03058821944652209, 0.06689216148559221, 4, 3, 2],
+    [4, 24, 0.02164778178638001, 0.008961778863845419, 0.03060956065022543, 4, 2, 0],
+    [4, 25, 0.01168690527839325, 0.07747501344981376, 0.08916191872820702, 4, 3, 2],
+    [4, 26, 0.01588288283660194, 0.04096522221306678, 0.05684810504966872, 4, 1, 1],
+    [4, 28, 0.01128665086452497, 0.01582662360389917, 0.02711327446842414, 4, 2, 1],
+    [4, 29, 0.01028593387764938, 0.01547886135935664, 0.02576479523700602, 4, 2, 1],
+    [4, 30, 0.004517730197507495, 0.02179721676324585, 0.02631494696075334, 4, 2, 1],
+    [5, 6, 0.01349845941886215, 0.0271001713778612, 0.04059863079672335, 2, 2, 1],
+    [5, 7, 0.08386293017699854, 0.05547962590044048, 0.139342556077439, 2, 1, 1],
+    [5, 9, 0.01976650604639912, 0.01082947702714442, 0.03059598307354354, 2, 3, 1],
+    [5, 10, 0.08663121746727073, 0.05454639965761584, 0.1411776171248866, 2, 1, 1],
+    [5, 11, 0.03770763685855846, 0.006284585998205416, 0.04399222285676388, 2, 1, 0],
+    [5, 12, 0.1076906900926125, 0.0473111213301104, 0.1550018114227228, 2, 1, 1],
+    [5, 14, 0.01972942054521223, 0.0320506800558711, 0.05178010060108334, 2, 2, 1],
+    [5, 15, 0.0115296223772864, 0.009425622068293078, 0.02095524444557947, 2, 3, 1],
+    [5, 16, 0.05795468769109502, 0.07437721131546923, 0.1323318990065643, 2, 4, 2],
+    [5, 17, 0.04893957970901563, 0.01779579930892645, 0.06673537901794209, 2, 2, 1],
+    [5, 18, 0.06914575237510151, 0.01277854849843139, 0.08192430087353289, 2, 2, 1],
+    [5, 20, 0.04606204168737617, 0.008407721695554574, 0.05446976338293075, 2, 3, 1],
+    [5, 21, 0.06137939961987368, 0.03626744029311923, 0.09764683991299292, 2, 5, 2],
+    [5, 22, 0.04000126166279955, 0.03754521666039747, 0.07754647832319703, 2, 5, 2],
+    [5, 23, 0.03357555220343731, 0.01381372812520867, 0.04738928032864598, 2, 3, 1],
+    [5, 24, 0.03380670133572664, 0.003731548300121901, 0.03753824963584854, 2, 2, 0],
+    [5, 25, 0.09004803803938788, 0.2417884826530335, 0.3318365206924214, 2, 3, 2],
+    [5, 26, 0.08754942747826591, 0.05315050503462983, 0.1406999325128958, 2, 1, 1],
+    [5, 28, 0.04567502066103889, 0.01808010305875397, 0.06375512371979286, 2, 2, 1],
+    [5, 29, 0.03260950473238529, 0.02317187888808829, 0.05578138362047358, 2, 2, 1],
+    [5, 30, 0.02112358475746083, 0.02897865767093947, 0.05010224242840029, 2, 2, 1],
+    [6, 7, 0.01668462680139263, 0.009946683404740683, 0.02663131020613331, 2, 1, 0],
+    [6, 9, 0.01988584439856818, 0.009045415077913333, 0.02893125947648151, 2, 3, 1],
+    [6, 10, 0.07997756465918539, 0.02777823877936857, 0.107755803438554, 2, 1, 1],
+    [6, 11, 0.0427529051299776, 0.004277233013937032, 0.04703013814391463, 2, 1, 0],
+    [6, 12, 0.01457894161504904, 0.0107389078090505, 0.02531784942409954, 2, 1, 0],
+    [6, 14, 0.2325712692000255, 0.2014841220660465, 0.4340553912660721, 2, 2, 2],
+    [6, 15, 0.1692106649881499, 0.05297107692530162, 0.2221817419134515, 2, 3, 2],
+    [6, 16, 0.05738158701493928, 0.04589333277643135, 0.1032749197913706, 2, 4, 2],
+    [6, 17, 0.04815193631537981, 0.009529021235036772, 0.05768095755041659, 2, 2, 1],
+    [6, 18, 0.01912767387535096, 0.002044170024231443, 0.0211718438995824, 2, 2, 0],
+    [6, 20, 0.02061887763751207, 0.004752091964805672, 0.02537096960231774, 2, 3, 0],
+    [6, 21, 0.04247087838195826, 0.02528613276636166, 0.06775701114831992, 2, 5, 2],
+    [6, 22, 0.04642062375115955, 0.02142488295951156, 0.06784550671067111, 2, 5, 2],
+    [6, 23, 0.01554561721459279, 0.006425146203498221, 0.02197076341809101, 2, 3, 0],
+    [6, 24, 0.03314786253017613, 0.001917115026076292, 0.03506497755625242, 2, 2, 0],
+    [6, 25, 0.0940662182949361, 0.1384869187847857, 0.2325531370797218, 2, 3, 2],
+    [6, 26, 0.01345296901600206, 0.004879799683521298, 0.01833276869952336, 2, 1, 0],
+    [6, 28, 0.03796224039722292, 0.007515605266225617, 0.04547784566344854, 2, 2, 1],
+    [6, 29, 0.05130583555953379, 0.01021357548333445, 0.06151941104286825, 2, 2, 1],
+    [6, 30, 0.2318428453473779, 0.2372832334677343, 0.4691260788151123, 2, 2, 2],
+    [7, 9, 0.04510729938504034, 0.033455377610294, 0.07856267699533434, 1, 3, 1],
+    [7, 10, 0.01448672927711553, 0.01471180827475936, 0.0291985375518749, 1, 1, 0],
+    [7, 11, 0.04558043072600854, 0.01092269815769229, 0.05650312888370083, 1, 1, 0],
+    [7, 12, 0.180236004387841, 0.1473331361936553, 0.3275691405814962, 1, 1, 1],
+    [7, 14, 0.004060491038913412, 0.009736071123258729, 0.01379656216217214, 1, 2, 0],
+    [7, 15, 0.007246951454732821, 0.008020333839217355, 0.01526728529395018, 1, 3, 0],
+    [7, 16, 0.02266593379543114, 0.02916472528901524, 0.05183065908444638, 1, 4, 1],
+    [7, 17, 0.01353159955561796, 0.006519983350346921, 0.02005158290596488, 1, 2, 0],
+    [7, 18, 0.1260783187676728, 0.05727101709727531, 0.1833493358649481, 1, 2, 1],
+    [7, 20, 0.09497180416371181, 0.03920153451995714, 0.134173338683669, 1, 3, 1],
+    [7, 21, 0.01391734233658772, 0.01774896716072902, 0.03166630949731674, 1, 5, 1],
+    [7, 22, 0.01403403421609152, 0.02021415605799259, 0.03424819027408411, 1, 5, 1],
+    [7, 23, 0.07875763940318095, 0.02839812636719212, 0.1071557657703731, 1, 3, 1],
+    [7, 24, 0.04219288785522956, 0.006992293554900667, 0.04918518141013023, 1, 2, 0],
+    [7, 25, 0.01888383639176133, 0.07660835994985157, 0.09549219634161291, 1, 3, 1],
+    [7, 26, 0.1593820711044853, 0.1731736129027814, 0.3325556840072666, 1, 1, 1],
+    [7, 28, 0.01379492231999666, 0.008854310031253648, 0.0226492323512503, 1, 2, 0],
+    [7, 29, 0.01318267142576915, 0.01115280933551254, 0.02433548076128169, 1, 2, 0],
+    [7, 30, 0.005464156565736539, 0.01604643247941549, 0.02151058904515203, 1, 2, 0],
+    [9, 10, 0.008743328720289559, 0.008998664007820409, 0.01774199272810997, 3, 1, 0],
+    [9, 11, 0.02301313307916227, 0.008353618087185346, 0.03136675116634761, 3, 1, 0],
+    [9, 12, 0.03485480851874616, 0.0385220468500885, 0.07337685536883466, 3, 1, 1],
+    [9, 14, 0.00925561597787489, 0.02345072843860894, 0.03270634441648383, 3, 2, 1],
+    [9, 15, 0.005885707639577632, 0.0093457630141815, 0.01523147065375913, 3, 3, 1],
+    [9, 16, 0.1352472349062049, 0.4258754197367833, 0.5611226546429883, 3, 4, 3],
+    [9, 17, 0.0114528061541329, 0.009382339097390304, 0.0208351452515232, 3, 2, 0],
+    [9, 18, 0.02851553908154206, 0.01525552104269379, 0.04377106012423586, 3, 2, 1],
+    [9, 20, 0.01822901326926599, 0.01058740382851504, 0.02881641709778102, 3, 3, 1],
+    [9, 21, 0.01637284646045184, 0.01528766975294247, 0.03166051621339431, 3, 5, 2],
+    [9, 22, 0.01125203456673749, 0.01471364636147226, 0.02596568092820975, 3, 5, 2],
+    [9, 23, 0.01581371454122383, 0.008723591174246868, 0.02453730571547069, 3, 3, 1],
+    [9, 24, 0.04988705657909906, 0.01387214589279543, 0.06375920247189448, 3, 2, 1],
+    [9, 25, 0.02481744876612966, 0.09561117569876813, 0.1204286244648978, 3, 3, 2],
+    [9, 26, 0.02474648571293647, 0.05329817226044276, 0.07804465797337923, 3, 1, 1],
+    [9, 28, 0.0133763748141426, 0.01726376204208423, 0.03064013685622684, 3, 2, 1],
+    [9, 29, 0.01447958284562607, 0.02105672282873693, 0.03553630567436301, 3, 2, 1],
+    [9, 30, 0.004787350233147937, 0.02258996514478861, 0.02737731537793655, 3, 2, 1],
+    [10, 11, 0.04076687919145038, 0.01600339189308192, 0.05677027108453229, 1, 1, 0],
+    [10, 12, 0.01487003942060377, 0.01285394941082142, 0.02772398883142518, 1, 1, 0],
+    [10, 14, 0.0278020913930161, 0.06116723064367017, 0.08896932203668627, 1, 2, 1],
+    [10, 15, 0.02590065104611214, 0.04413779140155937, 0.07003844244767152, 1, 3, 1],
+    [10, 16, 0.01473871457697519, 0.03900854939746186, 0.05374726397443705, 1, 4, 1],
+    [10, 17, 0.07737832850149316, 0.04512778545801077, 0.1225061139595039, 1, 2, 1],
+    [10, 18, 0.01848975784724837, 0.00977696218399207, 0.02826672003124044, 1, 2, 0],
+    [10, 20, 0.02248228077129723, 0.006391817662418776, 0.028874098433716, 1, 3, 0],
+    [10, 21, 0.01548391498233171, 0.01956514936920832, 0.03504906435154003, 1, 5, 1],
+    [10, 22, 0.01618209456972476, 0.02198162318745958, 0.03816371775718434, 1, 5, 1],
+    [10, 23, 0.01304324890636816, 0.007815357572873324, 0.02085860647924148, 1, 3, 0],
+    [10, 24, 0.03420490961110176, 0.008535296159903609, 0.04274020577100537, 1, 2, 0],
+    [10, 25, 0.0147192856248153, 0.06581358768988828, 0.08053287331470357, 1, 3, 1],
+    [10, 26, 0.01551389889619659, 0.02137375724421267, 0.03688765614040926, 1, 1, 0],
+    [10, 28, 0.08242337980044148, 0.06924953639794011, 0.1516729161983816, 1, 2, 1],
+    [10, 29, 0.0486391168101336, 0.06529494069867375, 0.1139340575088074, 1, 2, 1],
+    [10, 30, 0.03219208960454593, 0.08832014266169741, 0.1205122322662433, 1, 2, 1],
+    [11, 12, 0.0083422559528536, 0.04577125284234392, 0.05411350879519752, 1, 1, 0],
+    [11, 14, 0.003063442830455156, 0.03058506004416841, 0.03364850287462357, 1, 2, 0],
+    [11, 15, 0.008700688461801026, 0.02837240877883479, 0.03707309724063582, 1, 3, 0],
+    [11, 16, 0.002513035135905159, 0.033081097723843, 0.03559413285974816, 1, 4, 0],
+    [11, 17, 0.01015972517797896, 0.02585886367401776, 0.03601858885199673, 1, 2, 0],
+    [11, 18, 0.01760510226017101, 0.02599830916230194, 0.04360341142247295, 1, 2, 0],
+    [11, 20, 0.01570796171982357, 0.02432862307641051, 0.04003658479623408, 1, 3, 0],
+    [11, 21, 0.005149376434442727, 0.02438894100547246, 0.02953831743991518, 1, 5, 0],
+    [11, 22, 0.009744174308072966, 0.02717998704157922, 0.03692416134965219, 1, 5, 0],
+    [11, 23, 0.0112816847864048, 0.02443013410042389, 0.0357118188868287, 1, 3, 0],
+    [11, 24, 0.02611002944106307, 0.0243078721393825, 0.05041790158044557, 1, 2, 0],
+    [11, 25, 0.00220817709319456, 0.04746832197244566, 0.04967649906564022, 1, 3, 0],
+    [11, 26, 0.01079476529061294, 0.04998538352365951, 0.06078014881427245, 1, 1, 0],
+    [11, 28, 0.007641379119979673, 0.03338702752077345, 0.04102840664075313, 1, 2, 0],
+    [11, 29, 0.007824939016498385, 0.03557816199737629, 0.04340310101387468, 1, 2, 0],
+    [11, 30, 0.002863447023878826, 0.03959507498879136, 0.04245852201267018, 1, 2, 0],
+    [12, 14, 0.003531669272860574, 0.01503022692694298, 0.01856189619980356, 1, 2, 0],
+    [12, 15, 0.005687502712301731, 0.009779382902868514, 0.01546688561517024, 1, 3, 0],
+    [12, 16, 0.01897951429643458, 0.03338924626281588, 0.05236876055925047, 1, 4, 1],
+    [12, 17, 0.01327573410150146, 0.008423500238909153, 0.02169923434041061, 1, 2, 0],
+    [12, 18, 0.1492207326112999, 0.04435218220084611, 0.193572914812146, 1, 2, 1],
+    [12, 20, 0.08617756897569587, 0.03342886351154893, 0.1196064324872448, 1, 3, 1],
+    [12, 21, 0.01285874706488638, 0.01979657138334778, 0.03265531844823416, 1, 5, 1],
+    [12, 22, 0.01379762818626092, 0.01723547685811808, 0.03103310504437899, 1, 5, 1],
+    [12, 23, 0.06866921830001689, 0.0301984941528498, 0.09886771245286669, 1, 3, 1],
+    [12, 24, 0.03515608866627348, 0.008300090752201086, 0.04345617941847457, 1, 2, 0],
+    [12, 25, 0.02112831751687818, 0.07223272662848533, 0.09336104414536352, 1, 3, 1],
+    [12, 26, 0.1775091239215047, 0.1611450236151337, 0.3386541475366385, 1, 1, 1],
+    [12, 28, 0.01239927190285539, 0.010630447602192, 0.02302971950504739, 1, 2, 0],
+    [12, 29, 0.01305671059301914, 0.009969589662362952, 0.0230263002553821, 1, 2, 0],
+    [12, 30, 0.006106520807643618, 0.01501964804331584, 0.02112616885095946, 1, 2, 0],
+    [14, 15, 0.1240062700965975, 0.07055023087280403, 0.1945565009694015, 2, 3, 2],
+    [14, 16, 0.04968169518424277, 0.04322317133962539, 0.09290486652386816, 2, 4, 2],
+    [14, 17, 0.03301523267075585, 0.006938602753590835, 0.03995383542434668, 2, 2, 1],
+    [14, 18, 0.02006635669718209, 0.0042781821914317, 0.02434453888861379, 2, 2, 0],
+    [14, 20, 0.02233301521846701, 0.003089474062639977, 0.02542248928110699, 2, 3, 0],
+    [14, 21, 0.03948359355880873, 0.03409086082661509, 0.07357445438542382, 2, 5, 2],
+    [14, 22, 0.0268688773450427, 0.0214401774126719, 0.0483090547577146, 2, 5, 2],
+    [14, 23, 0.01484527139830796, 0.004437309946058014, 0.01928258134436597, 2, 3, 0],
+    [14, 24, 0.03462721449579641, 0.003757871643734362, 0.03838508613953077, 2, 2, 0],
+    [14, 25, 0.06357218444057811, 0.1549937645200927, 0.2185659489606708, 2, 3, 2],
+    [14, 26, 0.01465463614671243, 0.003872792297083958, 0.01852742844379638, 2, 1, 0],
+    [14, 28, 0.03514614576841267, 0.01055993418218698, 0.04570607995059965, 2, 2, 1],
+    [14, 29, 0.03706388753758103, 0.00812869954206062, 0.04519258707964165, 2, 2, 1],
+    [14, 30, 0.2282750950032041, 0.2310589775978077, 0.4593340726010118, 2, 2, 2],
+    [15, 16, 0.01428121180297797, 0.03049560777140135, 0.04477681957437932, 3, 4, 2],
+    [15, 17, 0.2365900473291059, 0.06430920229086168, 0.3008992496199676, 3, 2, 2],
+    [15, 18, 0.01866802394433401, 0.003914994869448416, 0.02258301881378243, 3, 2, 0],
+    [15, 20, 0.02356819283235103, 0.005400571337284119, 0.02896876416963515, 3, 3, 1],
+    [15, 21, 0.1063655984295545, 0.1098520926697359, 0.2162176910992904, 3, 5, 3],
+    [15, 22, 0.113078754604692, 0.1193807004556669, 0.2324594550603589, 3, 5, 3],
+    [15, 23, 0.01760198994331581, 0.004394350408904264, 0.02199634035222007, 3, 3, 1],
+    [15, 24, 0.0255055798649768, 0.003455505302173749, 0.02896108516715055, 3, 2, 0],
+    [15, 25, 0.02286215331427334, 0.05572789891617332, 0.07859005223044666, 3, 3, 2],
+    [15, 26, 0.01144159443320607, 0.005868313383528745, 0.01730990781673482, 3, 1, 0],
+    [15, 28, 0.01363916550740871, 0.01152910521301816, 0.02516827072042686, 3, 2, 1],
+    [15, 29, 0.01851254280568752, 0.01005463911380465, 0.02856718191949216, 3, 2, 1],
+    [15, 30, 0.07122084719427205, 0.1468009520008997, 0.2180217991951718, 3, 2, 2],
+    [16, 17, 0.01782636504763381, 0.004049733645987459, 0.02187609869362126, 4, 2, 1],
+    [16, 18, 0.02901428767197188, 0.007979068596454607, 0.03699335626842649, 4, 2, 1],
+    [16, 20, 0.02145658661219722, 0.004828023565954753, 0.02628461017815198, 4, 3, 1],
+    [16, 21, 0.04160074147630265, 0.0207606784884952, 0.06236141996479785, 4, 5, 3],
+    [16, 22, 0.05146197934676123, 0.01823400830047511, 0.06969598764723633, 4, 5, 3],
+    [16, 23, 0.01822949401965692, 0.003315249491921823, 0.02154474351157875, 4, 3, 1],
+    [16, 24, 0.03676885352758808, 0.006253436543370671, 0.04302229007095875, 4, 2, 1],
+    [16, 25, 0.1841429087738894, 0.3152593422346555, 0.4994022510085449, 4, 3, 3],
+    [16, 26, 0.03417832955442882, 0.01682864955963237, 0.05100697911406119, 4, 1, 1],
+    [16, 28, 0.09860322016656659, 0.04068814080185486, 0.1392913609684215, 4, 2, 2],
+    [16, 29, 0.1080970519952679, 0.03688377612775603, 0.144980828123024, 4, 2, 2],
+    [16, 30, 0.0377960989989632, 0.06418358230375337, 0.1019796813027166, 4, 2, 2],
+    [17, 18, 0.01185456228440142, 0.007796983061071273, 0.01965154534547269, 2, 2, 0],
+    [17, 20, 0.0332281399389085, 0.01516984390639092, 0.04839798384529942, 2, 3, 1],
+    [17, 21, 0.03131317673510807, 0.04980166629871462, 0.08111484303382269, 2, 5, 2],
+    [17, 22, 0.02658918454287775, 0.05018726477890903, 0.07677644932178679, 2, 5, 2],
+    [17, 23, 0.02475247746828598, 0.0169563833600419, 0.04170886082832788, 2, 3, 1],
+    [17, 24, 0.02250824430772414, 0.006885755628265392, 0.02939399993598953, 2, 2, 0],
+    [17, 25, 0.008406025942038792, 0.03106161612057492, 0.03946764206261372, 2, 3, 1],
+    [17, 26, 0.009282829245117721, 0.01432266485153354, 0.02360549409665125, 2, 1, 0],
+    [17, 28, 0.02505746434873073, 0.02439269819223868, 0.04945016254096941, 2, 2, 1],
+    [17, 29, 0.02334545268294474, 0.02603360928442499, 0.04937906196736973, 2, 2, 1],
+    [17, 30, 0.006120114170392863, 0.04613425130634214, 0.052254365476735, 2, 2, 1],
+    [18, 20, 0.02835867055729394, 0.03051095907045615, 0.05886962962775009, 2, 3, 1],
+    [18, 21, 0.006524067143595717, 0.02097381073320005, 0.02749787787679577, 2, 5, 1],
+    [18, 22, 0.005951114890757478, 0.01734555223255374, 0.02329666712331122, 2, 5, 1],
+    [18, 23, 0.02679758037211821, 0.02171809821499259, 0.0485156785871108, 2, 3, 1],
+    [18, 24, 0.02794861768861829, 0.01091010179620578, 0.03885871948482407, 2, 2, 0],
+    [18, 25, 0.00547466390308578, 0.05096953940013922, 0.056444203303225, 2, 3, 1],
+    [18, 26, 0.04713529782381884, 0.147517174759375, 0.1946524725831938, 2, 1, 1],
+    [18, 28, 0.005834608457505859, 0.0152237752272461, 0.02105838368475195, 2, 2, 0],
+    [18, 29, 0.009809673821294161, 0.01961999091486498, 0.02942966473615914, 2, 2, 0],
+    [18, 30, 0.004106924911106094, 0.0212640024303487, 0.02537092734145479, 2, 2, 0],
+    [20, 21, 0.0106282403425438, 0.04039821513711003, 0.05102645547965383, 3, 5, 2],
+    [20, 22, 0.01018346538718277, 0.03712847397201344, 0.0473119393591962, 3, 5, 2],
+    [20, 23, 0.08066982082609707, 0.09697970751966636, 0.1776495283457634, 3, 3, 2],
+    [20, 24, 0.0235382382132855, 0.01604967777748543, 0.03958791599077093, 3, 2, 0],
+    [20, 25, 0.003423699228229319, 0.03729116441894532, 0.04071486364717464, 3, 3, 1],
+    [20, 26, 0.03010903973132922, 0.0792493655437253, 0.1093584052750545, 3, 1, 1],
+    [20, 28, 0.006896520869508807, 0.01763535757626972, 0.02453187844577853, 3, 2, 0],
+    [20, 29, 0.008452797226508749, 0.01635647793775643, 0.02480927516426518, 3, 2, 0],
+    [20, 30, 0.003095558108305428, 0.02500421480139507, 0.0280997729097005, 3, 2, 0],
+    [21, 22, 0.1252684968513963, 0.136515693167626, 0.2617841900190223, 5, 5, 4],
+    [21, 23, 0.03150028194750475, 0.01038169657309909, 0.04188197852060385, 5, 3, 2],
+    [21, 24, 0.0291189462349777, 0.004949542712431419, 0.03406848894740912, 5, 2, 0],
+    [21, 25, 0.05817486040851345, 0.2337789498314103, 0.2919538102399237, 5, 3, 3],
+    [21, 26, 0.02161672916870432, 0.01542046740137113, 0.03703719657007545, 5, 1, 1],
+    [21, 28, 0.008853112135224245, 0.01473257967171467, 0.02358569180693892, 5, 2, 1],
+    [21, 29, 0.01104149126852355, 0.0112121954071869, 0.02225368667571045, 5, 2, 1],
+    [21, 30, 0.01981188214469076, 0.04607061916870642, 0.06588250131339718, 5, 2, 2],
+    [22, 23, 0.2417023075963993, 0.09748281763954433, 0.3391851252359436, 5, 3, 3],
+    [22, 24, 0.02866820036560731, 0.004389002955129634, 0.03305720332073694, 5, 2, 1],
+    [22, 25, 0.05951378230290671, 0.2182001187994253, 0.277713901102332, 5, 3, 3],
+    [22, 26, 0.0216180875663217, 0.01912704074549006, 0.04074512831181176, 5, 1, 1],
+    [22, 28, 0.01017154387527456, 0.006751614251023627, 0.01692315812629819, 5, 2, 1],
+    [22, 29, 0.008484165669395357, 0.006352798226140098, 0.01483696389553545, 5, 2, 1],
+    [22, 30, 0.01671073245892866, 0.04349804879476411, 0.06020878125369277, 5, 2, 2],
+    [23, 24, 0.04562441011343223, 0.02002989348257047, 0.0656543035960027, 3, 2, 1],
+    [23, 25, 0.002681149687355626, 0.02379196502622149, 0.02647311471357712, 3, 3, 1],
+    [23, 26, 0.02520734946693424, 0.08017222321450257, 0.1053795726814368, 3, 1, 1],
+    [23, 28, 0.006108324165705776, 0.01315945866988892, 0.0192677828355947, 3, 2, 0],
+    [23, 29, 0.007832385982193907, 0.01244156292841715, 0.02027394891061106, 3, 2, 0],
+    [23, 30, 0.002148132526385406, 0.0162182445937851, 0.0183663771201705, 3, 2, 0],
+    [24, 25, 0.003280169877064053, 0.04232444793320719, 0.04560461781027124, 2, 3, 0],
+    [24, 26, 0.005616845573718578, 0.03457432648711956, 0.04019117206083814, 2, 1, 0],
+    [24, 28, 0.01662564599904145, 0.08682615622766726, 0.1034518022267087, 2, 2, 1],
+    [24, 29, 0.02380609019454122, 0.08066548140193953, 0.1044715715964808, 2, 2, 1],
+    [24, 30, 0.001779848103066491, 0.03558210318886525, 0.03736195129193174, 2, 2, 0],
+    [25, 26, 0.06593316758122636, 0.02166592663716863, 0.08759909421839499, 3, 1, 1],
+    [25, 28, 0.02889704020936961, 0.005342768040509653, 0.03423980824987927, 3, 2, 1],
+    [25, 29, 0.02814406496232846, 0.01687874749838335, 0.04502281246071182, 3, 2, 1],
+    [25, 30, 0.1123773177282409, 0.107330048901509, 0.2197073666297499, 3, 2, 2],
+    [26, 28, 0.01202310187965289, 0.0100752849569055, 0.0220983868365584, 1, 2, 0],
+    [26, 29, 0.01098659894875614, 0.0106778458846393, 0.02166444483339544, 1, 2, 0],
+    [26, 30, 0.008888531742284057, 0.0220072024775357, 0.03089573421981976, 1, 2, 0],
+    [28, 29, 0.3253931306175987, 0.3786081317863912, 0.70400126240399, 2, 2, 2],
+    [28, 30, 0.007946759742122602, 0.03360599467213372, 0.04155275441425633, 2, 2, 1],
+    [29, 30, 0.01669873349292508, 0.03504162520377113, 0.05174035869669621, 2, 2, 1] 
+    ],
+   "headers":    [
+["Site 1", "Index of site 1"],
+    ["Site 2", "Index of site 2"],
+    ["P [Site 1 –> Site 2]", "Probability that site 2 is conditionally dependent on site 1"],
+    ["P [Site 2 –> Site 1]", "Probability that site 1 is conditionally dependent on site 2"],
+    ["P [Site 1 <–> Site 2]", "Probability that sites 1 and 2 are not conditionally independent"],
+    ["Site 1 subs", "Substitution counts inferred for Site 1"],
+    ["Site 2 subs", "Substitution counts inferred for Site 2"],
+    ["Shared subs", "Substitutions shared by both sites"] 
+    ]
+  },
+ "analysis":{
+   "authors":"Art FY Poon, Fraser I Lewis, Simon DW Frost and Sergei L Kosakovsky Pond",
+   "citation":"Spidermonkey: rapid detection of co-evolving sites using Bayesian graphical models (2008). _Bioinformatics_ 24(17): 1949-1950",
+   "contact":"apoon42@uwo.ca",
+   "info":"BGM (Bayesian Graphical Model) uses a maximum likelihood ancestral state reconstruction to\nmap substitution (non-synonymous only for coding data) events to branches in the\nphylogeny and then analyzes the joint distribution of the\nsubstitution map using a Bayesian graphical model (network).\nNext, a Markov chain Monte Carlo analysis is used to generate\na random sample of network structures from the posterior\ndistribution given the data.  Each node in the network\nrepresents a codon site in the alignment, and links (edges)\nbetween nodes indicate high posterior support for correlated\nsubstitutions at the two sites over time, which implies coevolution.",
+   "requirements":"in-frame codon alignment and a phylogenetic tree",
+   "version":"1.1"
+  },
+ "branch attributes":{
+   "0":{
+     "Baboon":{
+       "models.DNA.GTR.ModelDescription":0
+      },
+     "Cat":{
+       "models.DNA.GTR.ModelDescription":0.7933191636859576
+      },
+     "Chimp":{
+       "models.DNA.GTR.ModelDescription":0
+      },
+     "Cow":{
+       "models.DNA.GTR.ModelDescription":0.8094119333244753
+      },
+     "Horse":{
+       "models.DNA.GTR.ModelDescription":0.2769077630163064
+      },
+     "Human":{
+       "models.DNA.GTR.ModelDescription":0
+      },
+     "Mouse":{
+       "models.DNA.GTR.ModelDescription":0.1094921058577506
+      },
+     "Node1":{
+       "models.DNA.GTR.ModelDescription":0.4820782253393885
+      },
+     "Node12":{
+       "models.DNA.GTR.ModelDescription":0
+      },
+     "Node2":{
+       "models.DNA.GTR.ModelDescription":0.08259105925424247
+      },
+     "Node3":{
+       "models.DNA.GTR.ModelDescription":0.2526911684326281
+      },
+     "Node8":{
+       "models.DNA.GTR.ModelDescription":0.06531857233184223
+      },
+     "Node9":{
+       "models.DNA.GTR.ModelDescription":0.03361817454867485
+      },
+     "Pig":{
+       "models.DNA.GTR.ModelDescription":0
+      },
+     "Rat":{
+       "models.DNA.GTR.ModelDescription":0.0888784436278628
+      },
+     "RhMonkey":{
+       "models.DNA.GTR.ModelDescription":0
+      }
+    },
+   "attributes":{
+     "models.DNA.GTR.ModelDescription":{
+       "attribute type":"branch length",
+       "display order":0
+      }
+    }
+  },
+ "data partitions":{
+   "0":{
+     "coverage":      [
+[0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29] 
+      ],
+     "name":"bgm.filter.default"
+    }
+  },
+ "fits":{
+   "models.DNA.GTR.ModelDescription":{
+     "AIC-c":472.7691802214979,
+     "Log Likelihood":-210.2027719289308,
+     "Rate Distributions":null,
+     "display order":0,
+     "estimated parameters":24
+    }
+  },
+ "input":{
+   "datatype":"nucleotide",
+   "file name":"/tmp/tmpSz4m4X/job_working_directory/000/3/working/bgm_input.fa",
+   "number of sequences":10,
+   "number of sites":30,
+   "trees":{
+     "0":"((((Pig:0.147969,Cow:0.21343)Node3:0.08509899999999999,Horse:0.165787,Cat:0.264806)Node2:0.058611,((RhMonkey:0.002015,Baboon:0.003108)Node9:0.022733,(Human:0.004349,Chimp:0.000799)Node12:0.011873)Node8:0.101856)Node1:0.340802,Rat:0.050958,Mouse:0.09795)"
+    }
+  },
+ "settings":{
+   "burn-in":10000,
+   "data-type":"nucleotide",
+   "max-parents":1,
+   "min-subs":1,
+   "samples":100,
+   "steps":100000,
+   "threshold":0.5
+  },
+ "tested":0,
+ "timers":{
+   "Baseline fit":{
+     "order":1,
+     "timer":0
+    },
+   "Network inference":{
+     "order":2,
+     "timer":1
+    },
+   "Overall":{
+     "order":0,
+     "timer":1
+    }
+  }
+}
\ No newline at end of file
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/fade-in1.fa	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,50 @@
+>Human
+KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY
+KLFKNGTLKIKH-LKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTT
+LTCEVMNGTDPELNLYQDGKHLK-LSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVS
+CPEKGLD
+>Chimp
+EEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY
+KLFKNGTLKIKH-LKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTT
+LTCEVMNGTDPELNLYQDGKHLK-LSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVS
+CPEKGLD
+>Baboon
+KEIRNALETWGALGQDIDLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFEEKDAY
+KLFKNGTLKIKH-LKIHDQDSYKVSIYDTKGKNVLEKTFDLKIQERVSEPKISWTCINTT
+LTCEVMNGTDPELNLYQDGKHLK-LSQRVITHKWTTSLSAKFKCTAGNKVSKESRMETVS
+CPEKGLD
+>RhMonkey
+KEIRNALETWGALGQDIDLDIPSFQMSDDIDDIRWEKTSDKKKIAQFRKEKETFEEKDAY
+KLFKNGTLKXKH-LKIHDQDSYKVSIYDTKGKNVLEKTFDLKIQERVSEPKISWTCINTT
+LTCEVMNGTXPELNLYQDGKHVK-LSQRVITHKWTTSLSAKFKCTAGNKVSKESRMETVS
+CPEKGLD
+>Cow
+----ESIVVWGALDHDLNLDIPGFPRSDIVADIKWNR--NKNKIARIKKDMPLHNEMDKY
+DMFTNGTLKIKT-LMRNDSGLYEVEVYDSNGVNLLSKKFDLKIQEMLSGPEINWICTNRT
+VSCKVENGSNPKLQLFLNTTRVKQDHGKLITYTWNTRWNKTFKCVASNHVDSKVSIEIAV
+CPDEGLD
+>Pig
+-----TEVVWGIVDQDINLDIPELSKHDNVDHIRWQK--NENKIAEFKKNKETHPVKDTY
+MMLPNGTLRIKD-LKRDDEGIYKVTVYATDGKHMLERKFDLPILDGVSKPVISWSCADKT
+VTCEVAEGSDPKLKLYVNKSTAREGRQKVILWKWNTKWSTLFKCVASNNASEQISMVTIS
+CTGQGLD
+>Horse
+----KNITILGALERDINLDIPAFQMSEHVEDIQWSK--GKTKIAKFKNGSMTFQKDKTY
+EVLKNGTLKIKH-LERIHEGTYKVDAYDSDGKNVLEETFHLSLLEMVSKPNISWSCTNTT
+LTCEVTKGTDFELKLYLNGRMIQKSPRKVIVYKRASNQIASFKCTANNTVSEESSSVVIR
+CTEKGLD
+>Cat
+---ANDDIVWGTLGQDINLDIPDSQ-GINIDDIHWEK--GKKKVARFQISNKPKNPDEKY
+NVSMNGTLKIKH-LMLEDCDTYKVVIYDKDGKNVLDKTFQLKIQEKVSTPNIDWNCINKT
+LVCKVSNGTDPELKLYVNGTSIKPVSSKFSTYRFINKQKILVNCTAENKVSKESDVKMIT
+CSEKGLD
+>Mouse
+---RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVR--RGTLVAEFKRKKPPFLISETY
+EVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTT
+LTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQW-TNLNAPFKCEAINPVSKESKMEVVN
+CPEKGLS
+>Rat
+---RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWER--GSTLVAEFKRKMKPFLKSGAF
+EILANGDLKIKN-LTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNAT
+LTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQW-TNLRAPFKCKAVNRVSQESEMEVVN
+CPEKGLP
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/fade-in1.nhx	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,1 @@
+(((((Pig:0.147969,Cow:0.213430):0.085099,Horse:0.165787,Cat:0.264806):0.058611,((RhMonkey:0.002015,Baboon:0.003108):0.022733,(Human:0.004349,Chimp:0.000799):0.011873):0.101856):0.340802,Rat:0.050958):0.1,Mouse:0.097950);
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/fade-out1.json	Wed Aug 21 12:24:13 2019 -0400
@@ -0,0 +1,4281 @@
+{
+ "MLE":{
+   "content":{
+     "A":{
+       "0":        [
+[11.51603702583788, 5.631258087856319, 0.9499945736517019, 1.039547845181838],
+        [1.097681549705998, 5.630570600846716, 0.947706309872091, 0.9916649771782264],
+        [1.539775545261955, 5.630630056322405, 0.9478739114757647, 0.9950294283968122],
+        [1.667724788704626, 5.630719725601435, 0.9499994157127767, 1.039653814109997],
+        [1.25847739711632, 5.630686152901463, 0.949999717667571, 1.039660423096818],
+        [4.185910849001634, 5.630654866793391, 0.9499999990566257, 1.039666582026189],
+        [17.36207569658563, 5.630654762177219, 0.9499999999975496, 1.039666602620866],
+        [1.24218514731028, 5.630683377853925, 0.9499997426265079, 1.039660969385093],
+        [1.024191826188649, 5.630715314989586, 0.9499994553820734, 1.039654682360772],
+        [1.014004796667106, 5.632607163746273, 0.9499824399855789, 1.039282388967598],
+        [0.4740621651395832, 5.627503581943447, 0.9444437370511891, 0.9302154716674949],
+        [0.9140592541745473, 5.630730160151203, 0.9499993218638363, 1.039651760022723],
+        [0.7567550781917379, 5.633990183409649, 0.949970001027206, 1.039010387334885],
+        [0.9228460004688066, 5.631089594644688, 0.9499960890893352, 1.039581008459963],
+        [0.7121146981259312, 5.630928767310179, 0.9499975355796291, 1.03961266479502],
+        [0.6095796503565455, 5.637045393913153, 0.9499425222882696, 1.038409991274629],
+        [0.6605558065143393, 5.63554887505476, 0.9499559820649285, 1.0387039979643],
+        [0.7334618546894945, 5.631584447719907, 0.9499916383523238, 1.039483615889978],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5854212568599715, 5.637914315759457, 0.949934707155223, 1.038239355084906],
+        [0.4134221795168672, 5.624771969338814, 0.9425950877828698, 0.8984969502868022],
+        [0.3904522005816345, 5.623504918093849, 0.9417960395092443, 0.8854107996422699],
+        [2.212335991763995, 5.630654963724663, 0.9499999981848204, 1.039666562944362],
+        [0.9394451709609548, 5.631043490270708, 0.9499965037547257, 1.039590083194665],
+        [0.662131332286878, 5.63206552947176, 0.9499873114753865, 1.039388950286528],
+        [0.6265288978761459, 5.632604714967718, 0.9499824620100337, 1.039282870694441],
+        [0.8073383340999795, 5.630800914362855, 0.9499986854963882, 1.039637831946584],
+        [0.7792544736123335, 5.63140929379169, 0.9499932136968249, 1.039518086142237],
+        [1.454921870901184, 5.630658037203366, 0.9499999705417759, 1.039665957901579],
+        [0.8187160463016893, 5.631238578773209, 0.949994749117517, 1.039551684908112],
+        [0.7579513217946872, 5.631482189124849, 0.9499925580720074, 1.039503740093819],
+        [0.7197156570640451, 5.631648897767064, 0.9499910586848941, 1.039470932682291],
+        [0.6214790654256428, 5.636571110701319, 0.9499467880187472, 1.038503152027503],
+        [1.057135219780293, 5.630660196325318, 0.9499999511225089, 1.039665532858806],
+        [0.6108370616594117, 5.629852062445075, 0.9466008848231501, 0.9700035810798537],
+        [1.302972523179607, 5.630665076132612, 0.9499999072332416, 1.039664572225623],
+        [0.6199990540154902, 5.632759480958808, 0.9499810700358113, 1.039252425764596],
+        [1.201664187292616, 5.630591693857761, 0.9477598036683865, 0.992736471372866],
+        [1.125320876061587, 5.630581829699935, 0.947731859108226, 0.9921764611988656],
+        [1.663131794636887, 5.630679928739902, 0.9499997736480377, 1.039661648369019],
+        [1.373376890533494, 5.630675820666751, 0.949999810596284, 1.039662457075089],
+        [1.009621807867757, 5.630729047751628, 0.9499993318688219, 1.03965197900313],
+        [0.7922677004712597, 5.631579600918412, 0.9499916819447352, 1.039484569710167],
+        [0.8020493394401262, 5.631282254381984, 0.9499943562965806, 1.039543088827367],
+        [0.3617783815235022, 5.621173762575039, 0.9405120133343615, 0.8651184395067099],
+        [1.112742523566105, 5.630656075245939, 0.949999988187734, 1.039666344131015],
+        [0.7246574027998087, 5.634212388100799, 0.9499680025054373, 1.03896669844201],
+        [0.717158782683919, 5.631738918674986, 0.9499902490316721, 1.039453217844163],
+        [0.9719488146818128, 5.630726470097826, 0.9499993550523885, 1.039652486425171],
+        [1.999571618917424, 5.630655137364729, 0.9499999966230915, 1.039666528761685],
+        [2.202651456309849, 5.630655669049544, 0.9499999918410873, 1.039666424094549],
+        [2.978945664439119, 5.630654929731086, 0.9499999984905606, 1.039666569636317],
+        [0.9921478243743674, 5.630729378401886, 0.9499993288949347, 1.039651913913268],
+        [0.7731848349831045, 5.631502293154242, 0.9499923772552109, 1.039499783618925],
+        [8.361260393910884, 5.630654762392927, 0.9499999999956096, 1.039666602578403],
+        [7.635240475102413, 5.630654841358711, 0.9499999992853861, 1.039666587033233],
+        [2.877678310152864, 5.630654783873868, 0.9499999998024088, 1.039666598349679],
+        [1.930761570814076, 5.630658460178902, 0.9499999667375093, 1.039665874634969],
+        [1.77767428139077, 5.630660242447239, 0.9499999507076858, 1.039665523779294],
+        [1.046421696018844, 5.632548779466226, 0.9499829650971504, 1.039293874513365],
+        [1.64600882044475, 5.630658918057254, 0.9499999626193253, 1.039665784497447],
+        [0.937444152541586, 5.630746083545803, 0.9499991786479097, 1.039648625446922],
+        [2.006054900298821, 5.630665485630906, 0.9499999035501904, 1.039664491612342],
+        [1.884943788929804, 5.63065573353175, 0.949999991261131, 1.039666411400633],
+        [0.3527959926644127, 5.620215576755587, 0.9400298543877602, 0.8577229598304965],
+        [0.4740621651395832, 5.627503581943447, 0.9444437370511891, 0.9302154716674949],
+        [0.6696318175357709, 5.632158013904291, 0.9499864796650825, 1.039370753396849],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5287812489052434, 5.640946977563228, 0.949907431220589, 1.037644227515678],
+        [0.414084178788965, 5.624808466089997, 0.9426180396686965, 0.8988782218624131],
+        [0.3341618283895719, 5.616436087469283, 0.9384616712574966, 0.8344711656980914],
+        [1.027611087121654, 5.630660447407349, 0.9499999488642628, 1.03966548343105],
+        [3.613551378934925, 5.630674374729288, 0.9481195658945873, 1.000000000000007],
+        [0.7543439264348554, 5.634046106214466, 0.949969498054284, 1.038999391714359],
+        [1.13666437403459, 5.630666484409418, 0.949999894567119, 1.039664294994203],
+        [0.7124449646153788, 5.631334519392784, 0.9499938862220683, 1.039532802388019],
+        [4.04195630694145, 5.630654910300573, 0.9499999986653195, 1.03966657346139],
+        [0.575167182340297, 5.638363985095824, 0.9499306628033567, 1.038151071324759],
+        [1.050087263080135, 5.630669046584481, 0.9499998715227692, 1.039663790608335],
+        [0.9342176765540523, 5.631038956813692, 0.9499965445288987, 1.039590975524195],
+        [2.660678516017372, 5.630659091529503, 0.9499999610591056, 1.039665750347849],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298305, 0.9713119348893255],
+        [0.7237945268664635, 5.63179057564847, 0.9499897844258823, 1.039443052743322],
+        [0.3765053823425964, 5.622267937383554, 0.9411316516562069, 0.874800496607673],
+        [5.297462216583993, 5.630654766928543, 0.9499999999548158, 1.03966660168552],
+        [1.042802033216247, 5.630705556902234, 0.9499995431468721, 1.039656603293456],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298305, 0.9713119348893255],
+        [1.05096231945376, 5.630711979041804, 0.9499994853857799, 1.039655339059526],
+        [0.8262586453255309, 5.630784080366187, 0.9499988369023223, 1.03964114571276],
+        [1.128208648503804, 5.630689775777943, 0.9499996850832115, 1.039659709908069],
+        [0.4740621651395832, 5.627503581943447, 0.9444437370511891, 0.9302154716674949],
+        [1.471436485690723, 5.63066125370253, 0.9499999416123975, 1.039665324704617],
+        [0.8928906452040181, 5.630744592035278, 0.9499991920626412, 1.039648919055213],
+        [1.492256225013965, 5.63065856162924, 0.9499999658250596, 1.039665854663555],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7967464463980738, 5.630854490311206, 0.9499982036312287, 1.039627285674053],
+        [0.6902590045140931, 5.631994622097586, 0.9499879492203869, 1.039402902165172],
+        [4.956652875362113, 5.630659581395971, 0.9499999566532187, 1.039665653913199],
+        [0.6941378186395819, 5.634766947838561, 0.9499630147632702, 1.038857678609565],
+        [0.8877044254804726, 5.630738605456434, 0.9499992459062753, 1.039650097532673],
+        [0.7597355524698993, 5.63396481599739, 0.9499702291831701, 1.039015375184041],
+        [1.004811813907347, 5.630682424961197, 0.9499997511968798, 1.039661156969079],
+        [0.6480673156558282, 5.635848450806728, 0.9499532876633904, 1.038645130532964],
+        [0.9406530440728296, 5.630752535688302, 0.9499991206169693, 1.039647355325269],
+        [0.4478046697694049, 5.646814470418396, 0.949854658652482, 1.036494632621437],
+        [0.8634112629956294, 5.630678024536482, 0.9499997907745529, 1.039662023226088],
+        [0.5985982038904628, 5.637361149501868, 0.9499396823643496, 1.038347978004357],
+        [0.2779593162922389, 5.608915904677525, 0.9350200828413322, 0.7873761904704571],
+        [1.872349795156185, 5.630670248679055, 0.9499998607110617, 1.039663553965997],
+        [0.3904522005816345, 5.623504918093849, 0.9417960395092443, 0.8854107996422699],
+        [1.867330040332177, 5.63065642954963, 0.9499999850011063, 1.039666274383043],
+        [0.4134221795168672, 5.624771969338814, 0.9425950877828698, 0.8984969502868022],
+        [1.12840736100057, 5.630665173395572, 0.949999906358453, 1.039664553078569],
+        [0.6108370616594117, 5.629852062445075, 0.9466008848231501, 0.9700035810798537],
+        [1.20217820458946, 5.630665150667276, 0.9499999065628725, 1.039664557552828],
+        [0.9977244576812978, 5.630572477240063, 0.9477003261229985, 0.9915452574845032],
+        [2.728171711740036, 5.63065492746702, 0.9499999985109232, 1.039666570082008],
+        [0.5631573495724499, 5.638792873200017, 0.9499268053590874, 1.038066880839981],
+        [1.114573795329159, 5.630665579778869, 0.9499999027034182, 1.039664473078503],
+        [0.3007173128767589, 5.613039174730816, 0.9367463277974535, 0.8103576717590023],
+        [0.7165694661928341, 5.634678106586308, 0.9499638138066011, 1.038875142278442],
+        [0.6705962102276071, 5.632081327763952, 0.9499871693846382, 1.039385841831011],
+        [0.9977244576812978, 5.630572477240063, 0.9477003261229985, 0.9915452574845032],
+        [0.7684828455847844, 5.630877763155895, 0.9499979943139253, 1.039622704544315],
+        [0.3765053823425964, 5.622267937383554, 0.9411316516562069, 0.874800496607673],
+        [2.879196376416357, 5.63065489489325, 0.9499999988038937, 1.039666576494464],
+        [1.799786045362035, 5.630657358733962, 0.9499999766439688, 1.039666091464516],
+        [0.4740621651395832, 5.627503581943447, 0.9444437370511891, 0.9302154716674949],
+        [0.4969952964967306, 5.64277454372283, 0.9498909939854684, 1.037285899991689],
+        [0.5922173564861875, 5.637649860560312, 0.9499370856804896, 1.038291282340833],
+        [1.026554419665909, 5.630704417317292, 0.9499995533963647, 1.039656827627405],
+        [0.4832131043832616, 5.643704847798622, 0.9498826267771201, 1.037103587264678],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7697367203113609, 5.63162006503886, 0.9499913180081092, 1.039476606675615],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.9863677916657331, 5.632706048727343, 0.9499815506083733, 1.039262936542098],
+        [1.070999825523222, 5.63070502718656, 0.9499995479111653, 1.039656707571065],
+        [0.7856538444156261, 5.631367901425539, 0.9499935859821463, 1.039526232467526],
+        [2.750404521740828, 5.63065499475086, 0.9499999979057687, 1.039666556836558],
+        [3.057074928068484, 5.630657324158459, 0.949999976954943, 1.039666098271024],
+        [1.582884181147004, 5.630656190410662, 0.9499999871519358, 1.039666321459766],
+        [3.197216508658471, 5.630655857911417, 0.9499999901424532, 1.039666386915338],
+        [1.071004561808777, 5.63066393452097, 0.9499999175009624, 1.039664796961812],
+        [2.426157163698773, 5.63065718044109, 0.9499999782475453, 1.039666126563114],
+        [5.507829757158239, 5.630655005817363, 0.949999997806236, 1.039666554658014],
+        [1.433711441977473, 5.630656146917968, 0.9499999875431118, 1.039666330021711],
+        [0.8399507282736052, 5.630752010831654, 0.94999912533756, 1.039647458644603],
+        [0.5282518185750202, 5.641367250487638, 0.9499036512617423, 1.037561804559429],
+        [1.986218899689761, 5.630657284838807, 0.9499999773085862, 1.03966610601146],
+        [0.7867329012344769, 5.631341842897491, 0.9499938203540457, 1.039531361041722],
+        [0.9207712351812531, 5.630773756035862, 0.949998929759943, 1.039643178063392],
+        [1.427166925280543, 5.630832548414758, 0.9499984009779068, 1.039631604849172],
+        [0.8598570929862881, 5.63076660123229, 0.9499989941106577, 1.039644586495202],
+        [1.36209349656165, 5.630869021573095, 0.9499980729362236, 1.03962442527166],
+        [1.727572274331233, 5.630686611445118, 0.9499997135434028, 1.039660332829217],
+        [0.6902666653056418, 5.631907792143138, 0.9499887301739897, 1.039419987487633],
+        [1.178390800881983, 5.630662741733005, 0.9499999282289663, 1.039665031772611],
+        [0.9603112425936825, 5.631064460359348, 0.9499963151485425, 1.039585955628555],
+        [3.914563634984427, 5.630654843358017, 0.9499999992674047, 1.039666586639662],
+        [0.9474248244525548, 5.630720631924245, 0.9499994075612574, 1.039653635696042],
+        [4.354552724693413, 5.630654817188549, 0.9499999995027743, 1.039666591791363],
+        [0.678475378193064, 5.635072956091076, 0.949960262507452, 1.038797530340636],
+        [0.5502592384639773, 5.640173629548885, 0.9499143867570956, 1.03779592725272],
+        [0.9977244576812978, 5.630572477240063, 0.9477003261229985, 0.9915452574845032],
+        [0.9213083509500934, 5.63074620108972, 0.9499991775907127, 1.039648602308053],
+        [0.3617783815235022, 5.621173762575039, 0.9405120133343615, 0.8651184395067099],
+        [6.879821078755826, 5.630654919214196, 0.9499999985851503, 1.039666571706669],
+        [0.3527959926644127, 5.620215576755587, 0.9400298543877602, 0.8577229598304965],
+        [2.517849262796093, 5.630655000373397, 0.9499999978551993, 1.039666555729709],
+        [0.6053058049099489, 5.637157668681731, 0.9499415124825454, 1.038387940104785],
+        [0.485237466987175, 5.643479678562052, 0.949884651962181, 1.037147708346874],
+        [1.383147657407806, 5.630660171809253, 0.949999951343008, 1.039665537685018],
+        [0.6093293832964398, 5.632909667576543, 0.9499797192487359, 1.039222883290246],
+        [0.670798770068635, 5.632043643131023, 0.9499875083223933, 1.039393256649318],
+        [1.140152074149965, 5.630667306450849, 0.9499998871736313, 1.039664133168336],
+        [1.044196769598946, 5.630666477011237, 0.9499998946336587, 1.039664296450601],
+        [0.788023783133815, 5.630872089638505, 0.9499980453418668, 1.039623821341048],
+        [3.207224150499168, 5.630654957519261, 0.9499999982406317, 1.039666564165945],
+        [0.8788479754733033, 5.631136628473988, 0.9499956660643699, 1.039571750935437],
+        [1.326312247129467, 5.630660427597133, 0.9499999490424371, 1.039665487330873],
+        [0.9977244576812978, 5.630572477240063, 0.9477003261229985, 0.9915452574845032],
+        [0.9438185124401692, 5.630719647611206, 0.9499994164142256, 1.039653829462754],
+        [0.6354304776683813, 5.632524785036317, 0.9499831809044328, 1.03929859484571],
+        [0.6990192060709154, 5.631982522249139, 0.9499880580471194, 1.039405282991411],
+        [0.4740621651395832, 5.627503581943447, 0.9444437370511891, 0.9302154716674949],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7836165475521936, 5.631399814561965, 0.9499932989535624, 1.039519951714396] 
+        ]
+      },
+     "C":{
+       "0":        [
+[11.51603702583787, 5.631258087856318, 0.9499945736517019, 1.039547845181838],
+        [1.097681549705997, 5.630570600846714, 0.9477063098720908, 0.9916649771782219],
+        [1.539775545261954, 5.630630056322407, 0.9478739114757646, 0.99502942839681],
+        [1.667724788704626, 5.630719725601436, 0.9499994157127768, 1.03965381411],
+        [1.258477397116319, 5.63068615290146, 0.9499997176675707, 1.039660423096814],
+        [4.185910849001628, 5.630654866793391, 0.9499999990566257, 1.039666582026189],
+        [17.36207569658561, 5.63065476217722, 0.9499999999975492, 1.039666602620858],
+        [1.242185147310281, 5.630683377853924, 0.9499997426265078, 1.039660969385091],
+        [1.024191826188649, 5.630715314989588, 0.9499994553820735, 1.039654682360774],
+        [1.014004796667105, 5.632607163746274, 0.9499824399855789, 1.039282388967598],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.9140592541745477, 5.630730160151205, 0.9499993218638363, 1.039651760022723],
+        [0.7567550781917377, 5.633990183409647, 0.9499700010272059, 1.039010387334883],
+        [0.9228460004688064, 5.631089594644689, 0.9499960890893352, 1.039581008459963],
+        [0.7121146981259315, 5.630928767310181, 0.9499975355796291, 1.03961266479502],
+        [0.6095796503565453, 5.637045393913154, 0.9499425222882697, 1.038409991274631],
+        [0.6605558065143398, 5.635548875054762, 0.9499559820649285, 1.0387039979643],
+        [0.7334618546894948, 5.631584447719908, 0.9499916383523237, 1.039483615889975],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5854212568599713, 5.637914315759457, 0.9499347071552232, 1.038239355084911],
+        [0.413422179516867, 5.624771969338811, 0.9425950877828696, 0.8984969502867984],
+        [0.3904522005816347, 5.623504918093852, 0.9417960395092446, 0.8854107996422753],
+        [2.212335991763994, 5.630654963724663, 0.9499999981848202, 1.039666562944357],
+        [0.9394451709609545, 5.631043490270708, 0.9499965037547259, 1.03959008319467],
+        [0.6621313322868775, 5.632065529471758, 0.9499873114753864, 1.039388950286525],
+        [0.626528897876146, 5.63260471496772, 0.949982462010034, 1.039282870694448],
+        [0.8073383340999789, 5.630800914362855, 0.9499986854963883, 1.039637831946586],
+        [0.7792544736123338, 5.631409293791692, 0.9499932136968252, 1.039518086142244],
+        [1.454921870901184, 5.630658037203367, 0.949999970541776, 1.039665957901581],
+        [0.8187160463016893, 5.63123857877321, 0.949994749117517, 1.039551684908112],
+        [0.757951321794687, 5.631482189124848, 0.9499925580720073, 1.039503740093816],
+        [0.7197156570640448, 5.631648897767064, 0.9499910586848941, 1.039470932682291],
+        [0.6214790654256428, 5.636571110701321, 0.9499467880187471, 1.038503152027501],
+        [1.057135219780293, 5.630660196325321, 0.9499999511225091, 1.039665532858811],
+        [0.6108370616594112, 5.629852062445075, 0.9466008848231497, 0.9700035810798474],
+        [1.302972523179607, 5.630665076132612, 0.9499999072332417, 1.039664572225625],
+        [0.6199990540154902, 5.632759480958808, 0.9499810700358114, 1.039252425764599],
+        [1.201664187292614, 5.63059169385776, 0.9477598036683864, 0.9927364713728638],
+        [1.125320876061586, 5.630581829699935, 0.947731859108226, 0.9921764611988656],
+        [1.663131794636887, 5.630679928739902, 0.9499997736480378, 1.039661648369021],
+        [1.373376890533493, 5.630675820666752, 0.9499998105962839, 1.039662457075087],
+        [1.009621807867756, 5.630729047751629, 0.9499993318688219, 1.03965197900313],
+        [0.7922677004712591, 5.631579600918412, 0.9499916819447349, 1.039484569710162],
+        [0.8020493394401261, 5.631282254381983, 0.9499943562965806, 1.039543088827367],
+        [0.3617783815235025, 5.621173762575041, 0.940512013334362, 0.8651184395067167],
+        [1.112742523566105, 5.63065607524594, 0.949999988187734, 1.039666344131015],
+        [0.7246574027998087, 5.634212388100799, 0.9499680025054373, 1.03896669844201],
+        [0.7171587826839192, 5.631738918674986, 0.949990249031672, 1.03945321784416],
+        [0.9719488146818118, 5.630726470097823, 0.9499993550523886, 1.039652486425174],
+        [1.999571618917424, 5.630655137364725, 0.9499999966230912, 1.039666528761677],
+        [2.202651456309852, 5.630655669049549, 0.9499999918410875, 1.039666424094554],
+        [2.978945664439118, 5.630654929731084, 0.9499999984905604, 1.039666569636312],
+        [0.9921478243743672, 5.630729378401886, 0.9499993288949345, 1.039651913913266],
+        [0.7731848349831044, 5.63150229315424, 0.9499923772552111, 1.03949978361893],
+        [8.36126039391088, 5.630654762392925, 0.9499999999956092, 1.039666602578396],
+        [7.635240475102401, 5.630654841358709, 0.9499999992853867, 1.039666587033246],
+        [2.877678310152866, 5.630654783873869, 0.9499999998024085, 1.039666598349672],
+        [1.930761570814078, 5.630658460178909, 0.9499999667375095, 1.039665874634974],
+        [1.777674281390769, 5.630660242447238, 0.9499999507076858, 1.039665523779294],
+        [1.046421696018844, 5.632548779466227, 0.9499829650971505, 1.039293874513367],
+        [1.64600882044475, 5.630658918057254, 0.9499999626193256, 1.039665784497454],
+        [0.9374441525415851, 5.630746083545801, 0.9499991786479095, 1.039648625446917],
+        [2.006054900298822, 5.630665485630906, 0.9499999035501904, 1.039664491612342],
+        [1.884943788929805, 5.63065573353175, 0.949999991261131, 1.039666411400633],
+        [0.3527959926644126, 5.620215576755586, 0.9400298543877602, 0.8577229598304965],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.6696318175357709, 5.632158013904291, 0.9499864796650828, 1.039370753396854],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5287812489052429, 5.640946977563228, 0.9499074312205886, 1.037644227515671],
+        [0.4140841787889652, 5.624808466089998, 0.9426180396686966, 0.8988782218624148],
+        [0.3341618283895716, 5.616436087469279, 0.9384616712574966, 0.8344711656980914],
+        [1.027611087121654, 5.630660447407351, 0.9499999488642626, 1.039665483431048],
+        [3.613551378934922, 5.630674374729288, 0.9481195658945871, 1.000000000000002],
+        [0.7543439264348553, 5.634046106214465, 0.9499694980542842, 1.038999391714364],
+        [1.13666437403459, 5.63066648440942, 0.9499998945671191, 1.039664294994206],
+        [0.7124449646153787, 5.631334519392785, 0.9499938862220684, 1.039532802388022],
+        [4.041956306941437, 5.630654910300573, 0.9499999986653195, 1.03966657346139],
+        [0.575167182340297, 5.638363985095822, 0.9499306628033567, 1.038151071324759],
+        [1.050087263080134, 5.630669046584481, 0.9499998715227693, 1.039663790608337],
+        [0.9342176765540525, 5.631038956813692, 0.9499965445288987, 1.039590975524195],
+        [2.660678516017374, 5.630659091529506, 0.9499999610591063, 1.039665750347866],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298303, 0.9713119348893234],
+        [0.7237945268664634, 5.631790575648473, 0.9499897844258822, 1.03944305274332],
+        [0.3765053823425964, 5.622267937383556, 0.941131651656207, 0.8748004966076748],
+        [5.297462216583992, 5.630654766928546, 0.9499999999548158, 1.03966660168552],
+        [1.042802033216247, 5.630705556902234, 0.9499995431468721, 1.039656603293456],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298303, 0.9713119348893234],
+        [1.050962319453759, 5.630711979041799, 0.9499994853857797, 1.039655339059521],
+        [0.8262586453255309, 5.630784080366187, 0.9499988369023223, 1.03964114571276],
+        [1.128208648503803, 5.630689775777943, 0.9499996850832114, 1.039659709908066],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [1.471436485690721, 5.63066125370253, 0.9499999416123975, 1.039665324704617],
+        [0.8928906452040177, 5.630744592035276, 0.9499991920626409, 1.039648919055208],
+        [1.492256225013967, 5.630658561629242, 0.9499999658250595, 1.039665854663553],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7967464463980738, 5.630854490311203, 0.9499982036312287, 1.039627285674053],
+        [0.6902590045140926, 5.631994622097587, 0.9499879492203865, 1.039402902165165],
+        [4.956652875362104, 5.630659581395978, 0.9499999566532191, 1.039665653913208],
+        [0.6941378186395822, 5.634766947838562, 0.9499630147632699, 1.03885767860956],
+        [0.8877044254804719, 5.630738605456433, 0.9499992459062756, 1.03965009753268],
+        [0.7597355524698994, 5.633964815997391, 0.9499702291831702, 1.039015375184043],
+        [1.004811813907346, 5.630682424961197, 0.9499997511968798, 1.039661156969079],
+        [0.6480673156558283, 5.63584845080673, 0.9499532876633905, 1.038645130532967],
+        [0.9406530440728301, 5.630752535688303, 0.9499991206169692, 1.039647355325267],
+        [0.4478046697694048, 5.646814470418394, 0.9498546586524822, 1.036494632621441],
+        [0.8634112629956288, 5.630678024536482, 0.9499997907745527, 1.039662023226083],
+        [0.5985982038904627, 5.637361149501868, 0.9499396823643498, 1.038347978004362],
+        [0.2779593162922388, 5.608915904677525, 0.9350200828413322, 0.7873761904704571],
+        [1.872349795156183, 5.630670248679056, 0.9499998607110612, 1.039663553965988],
+        [0.3904522005816347, 5.623504918093852, 0.9417960395092446, 0.8854107996422753],
+        [1.867330040332176, 5.630656429549629, 0.9499999850011059, 1.039666274383035],
+        [0.413422179516867, 5.624771969338811, 0.9425950877828696, 0.8984969502867984],
+        [1.128407361000569, 5.63066517339557, 0.949999906358453, 1.039664553078569],
+        [0.6108370616594112, 5.629852062445075, 0.9466008848231497, 0.9700035810798474],
+        [1.20217820458946, 5.630665150667276, 0.9499999065628725, 1.039664557552828],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [2.728171711740034, 5.63065492746702, 0.9499999985109233, 1.03966657008201],
+        [0.5631573495724497, 5.638792873200017, 0.9499268053590874, 1.038066880839981],
+        [1.114573795329159, 5.630665579778867, 0.9499999027034184, 1.039664473078508],
+        [0.3007173128767589, 5.613039174730816, 0.9367463277974535, 0.8103576717590023],
+        [0.7165694661928339, 5.634678106586306, 0.9499638138066009, 1.038875142278437],
+        [0.6705962102276068, 5.632081327763951, 0.9499871693846382, 1.039385841831011],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.7684828455847844, 5.630877763155892, 0.9499979943139254, 1.039622704544318],
+        [0.3765053823425964, 5.622267937383556, 0.941131651656207, 0.8748004966076748],
+        [2.879196376416358, 5.63065489489325, 0.949999998803894, 1.039666576494469],
+        [1.799786045362033, 5.630657358733963, 0.9499999766439688, 1.039666091464516],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.4969952964967309, 5.64277454372283, 0.9498909939854682, 1.037285899991685],
+        [0.5922173564861877, 5.637649860560314, 0.9499370856804895, 1.038291282340831],
+        [1.026554419665909, 5.63070441731729, 0.9499995533963647, 1.039656827627405],
+        [0.4832131043832617, 5.643704847798623, 0.9498826267771202, 1.037103587264681],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7697367203113609, 5.63162006503886, 0.9499913180081092, 1.039476606675615],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.9863677916657333, 5.632706048727345, 0.9499815506083735, 1.039262936542102],
+        [1.070999825523222, 5.630705027186561, 0.9499995479111653, 1.039656707571065],
+        [0.7856538444156257, 5.631367901425538, 0.9499935859821464, 1.039526232467529],
+        [2.75040452174083, 5.630654994750861, 0.9499999979057689, 1.039666556836563],
+        [3.057074928068481, 5.630657324158459, 0.9499999769549428, 1.039666098271019],
+        [1.582884181147004, 5.630656190410661, 0.9499999871519358, 1.039666321459766],
+        [3.197216508658467, 5.630655857911416, 0.9499999901424532, 1.039666386915338],
+        [1.071004561808776, 5.630663934520971, 0.9499999175009625, 1.039664796961814],
+        [2.426157163698774, 5.630657180441096, 0.9499999782475456, 1.039666126563119],
+        [5.507829757158232, 5.630655005817359, 0.9499999978062359, 1.039666554658012],
+        [1.433711441977474, 5.630656146917967, 0.9499999875431117, 1.039666330021709],
+        [0.8399507282736051, 5.630752010831651, 0.9499991253375599, 1.0396474586446],
+        [0.5282518185750199, 5.641367250487635, 0.9499036512617419, 1.037561804559422],
+        [1.986218899689759, 5.630657284838809, 0.9499999773085862, 1.03966610601146],
+        [0.7867329012344769, 5.63134184289749, 0.9499938203540457, 1.039531361041722],
+        [0.9207712351812527, 5.630773756035859, 0.9499989297599427, 1.039643178063385],
+        [1.427166925280543, 5.630832548414757, 0.9499984009779069, 1.039631604849174],
+        [0.8598570929862878, 5.63076660123229, 0.9499989941106578, 1.039644586495205],
+        [1.36209349656165, 5.630869021573094, 0.9499980729362235, 1.039624425271657],
+        [1.727572274331233, 5.630686611445119, 0.9499997135434028, 1.039660332829217],
+        [0.6902666653056421, 5.63190779214314, 0.9499887301739898, 1.039419987487635],
+        [1.178390800881981, 5.630662741733002, 0.9499999282289661, 1.039665031772607],
+        [0.9603112425936832, 5.631064460359349, 0.9499963151485427, 1.039585955628558],
+        [3.914563634984424, 5.630654843358017, 0.9499999992674049, 1.039666586639664],
+        [0.9474248244525546, 5.630720631924242, 0.9499994075612573, 1.03965363569604],
+        [4.354552724693409, 5.630654817188547, 0.9499999995027744, 1.039666591791365],
+        [0.6784753781930638, 5.635072956091077, 0.9499602625074521, 1.038797530340638],
+        [0.5502592384639773, 5.640173629548884, 0.9499143867570955, 1.037795927252718],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.9213083509500934, 5.630746201089721, 0.949999177590713, 1.039648602308058],
+        [0.3617783815235025, 5.621173762575041, 0.940512013334362, 0.8651184395067167],
+        [6.879821078755825, 5.630654919214192, 0.9499999985851496, 1.039666571706654],
+        [0.3527959926644126, 5.620215576755586, 0.9400298543877602, 0.8577229598304965],
+        [2.517849262796094, 5.6306550003734, 0.9499999978551992, 1.039666555729706],
+        [0.6053058049099489, 5.637157668681729, 0.9499415124825455, 1.038387940104787],
+        [0.485237466987175, 5.643479678562052, 0.949884651962181, 1.037147708346874],
+        [1.383147657407806, 5.630660171809253, 0.9499999513430081, 1.039665537685021],
+        [0.6093293832964402, 5.632909667576546, 0.949979719248736, 1.039222883290248],
+        [0.670798770068635, 5.632043643131023, 0.9499875083223935, 1.039393256649322],
+        [1.140152074149964, 5.630667306450846, 0.9499998871736313, 1.039664133168336],
+        [1.044196769598946, 5.63066647701124, 0.9499998946336591, 1.039664296450608],
+        [0.7880237831338148, 5.630872089638504, 0.9499980453418668, 1.039623821341048],
+        [3.20722415049917, 5.630654957519265, 0.9499999982406319, 1.039666564165947],
+        [0.8788479754733037, 5.63113662847399, 0.9499956660643701, 1.039571750935442],
+        [1.326312247129467, 5.630660427597134, 0.9499999490424371, 1.039665487330873],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.9438185124401696, 5.630719647611203, 0.9499994164142255, 1.039653829462752],
+        [0.6354304776683812, 5.632524785036314, 0.9499831809044326, 1.039298594845705],
+        [0.6990192060709154, 5.631982522249139, 0.9499880580471195, 1.039405282991414],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7836165475521936, 5.631399814561965, 0.9499932989535623, 1.039519951714393] 
+        ]
+      },
+     "D":{
+       "0":        [
+[11.52171791898994, 5.390986026928229, 0.9493502757543854, 1.040149542475296],
+        [1.092247320615, 5.349373703226856, 0.9469804490380668, 0.9911773162022578],
+        [1.531483300153293, 5.348722645879515, 0.9471433418125846, 0.9944029306845263],
+        [1.687149884340526, 4.258029544467041, 0.9465413143013404, 0.9825794663505339],
+        [1.243298790535392, 3.845123423523584, 0.9454785850386509, 0.9623453785381927],
+        [3.502600102528818, 6.604530178864924, 0.9564475565397018, 1.218694982580087],
+        [17.09381606335286, 5.872091374708655, 0.9508516137305059, 1.073618216666603],
+        [1.230711933903877, 5.097304420557229, 0.9485813790292189, 1.023765657592318],
+        [1.018214456051092, 5.217252889641236, 0.9489388527055926, 1.031321440302027],
+        [1.009259567447395, 5.288983256416135, 0.9490973126420875, 1.034704694150061],
+        [0.4734908776471151, 5.417425377074134, 0.9439149914783614, 0.9339690403516786],
+        [0.8905082427256742, 0.7661672711917398, 0.9314192701330135, 0.7536843593977268],
+        [0.7549026861293188, 5.336110888065085, 0.9492246831294826, 1.037439470679267],
+        [0.9146645966055982, 3.679018731692772, 0.9448899780047114, 0.9514742624910149],
+        [0.7115964592643026, 5.338449687116203, 0.9492773110410746, 1.0385734564685],
+        [0.5979993093538301, 2.322852060103088, 0.9410255677175262, 0.8854907754427924],
+        [0.6594790891351596, 5.361573086452996, 0.9492823744682299, 1.038682683409661],
+        [0.7316859917314564, 5.206842352132123, 0.9490216663161291, 1.033086957294662],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.5744356980763367, 2.411763134435525, 0.94133646750401, 0.8904777233387301],
+        [0.4130418865416083, 5.434890433945496, 0.9421137140323106, 0.9031794066648036],
+        [0.3901709042449691, 5.443093530738913, 0.9413366738715988, 0.8904810511062795],
+        [1.898631047278052, 11.04573518067648, 0.9676809826026869, 1.661576895184472],
+        [0.9362398336652453, 5.278217273430893, 0.9490933208912189, 1.034619208279786],
+        [0.6616509529094314, 5.361725302976286, 0.9493248766550312, 1.03960039017899],
+        [0.6261236869288226, 5.376507590522309, 0.9493588346397429, 1.040334717674098],
+        [0.8058091501747563, 5.277284238726582, 0.9491219912480083, 1.035233499929489],
+        [0.7701085735113453, 3.004805051794749, 0.9429869951294977, 0.9178636248733756],
+        [1.423642150534706, 2.900045758283901, 0.9425294457902108, 0.9101142797497356],
+        [0.8165697374848708, 5.294128936407392, 0.9491491924412964, 1.035816953609286],
+        [0.6832899835268432, 10.91533197323467, 0.9718213613821858, 1.913871698442159],
+        [0.7107700198065799, 2.257445697055008, 0.9407687831483769, 0.8814113322928252],
+        [0.6206785817028767, 5.37345783915903, 0.949305484562497, 1.039181485442467],
+        [1.053937958758112, 5.266728375331024, 0.9490686031736969, 1.034090161107402],
+        [0.6093075079566025, 5.381394823001899, 0.9459716463882287, 0.9716341546450707],
+        [1.298290781476666, 5.208792666344368, 0.9489117070916054, 1.030743964094146],
+        [0.619573697451517, 5.37954672804409, 0.9493651186649334, 1.040470715140102],
+        [1.193887884133817, 5.347421722956788, 0.9470276689575213, 0.9921103266329377],
+        [1.120000059984784, 5.349024402843922, 0.9470046756343354, 0.9916557977440176],
+        [1.612761670498135, 3.89170684124331, 0.9457049256840021, 0.9665884601625832],
+        [1.366216010412286, 5.213226838508514, 0.9489094031883034, 1.030694980768574],
+        [1.006187230939087, 5.281812223010351, 0.9490968100465418, 1.0346939300107],
+        [0.7905288062199073, 5.325627898673647, 0.9492257870913536, 1.037463233862592],
+        [0.8001174360760643, 5.295766636149737, 0.9491560979494252, 1.035965173094264],
+        [0.3427074493420517, 1.425446445204149, 0.9256512438743718, 0.6909077571891883],
+        [1.108613334116387, 5.220307769775969, 0.94893185481549, 1.031172513504221],
+        [0.7232573738201307, 5.344537235996975, 0.949246704808084, 1.037913690738032],
+        [0.716317289736623, 5.341723603274408, 0.9492720264808892, 1.038459482557054],
+        [0.9696301964343583, 5.283353927684463, 0.9491124932833753, 1.035029919673348],
+        [1.99422102037773, 4.198571685031186, 0.9458624558510488, 0.9695625298290332],
+        [2.195402580696694, 5.160307712413089, 0.9487145410641089, 1.026567941538584],
+        [2.975208934311159, 5.165268428024032, 0.9487069320396825, 1.02640742401802],
+        [0.9872855542431176, 5.235885961568398, 0.9489882011329308, 1.032372817360425],
+        [0.7715817958913662, 5.320233687226269, 0.949215225944499, 1.03723594364522],
+        [8.395700983400815, 5.328803955593833, 0.9491369621395328, 1.035554541779404],
+        [7.642195322587987, 5.390530335976159, 0.9493505591831422, 1.040155673577536],
+        [2.893028967825463, 4.589689902496061, 0.9468352794509399, 0.9883193147328198],
+        [1.898734450375039, 2.759390117181493, 0.9411570428802382, 0.8875932553063608],
+        [1.684353863883048, 3.183951507525685, 0.9435049427906893, 0.9267873848239294],
+        [1.041375267847714, 5.286180458720565, 0.9490888485651191, 1.034523446510121],
+        [1.642210233590709, 4.955690900851493, 0.9482433305763475, 1.016716477709298],
+        [0.9342681069116684, 5.274796183742278, 0.9490937258158247, 1.034627879385396],
+        [1.997876044294486, 5.164136543792103, 0.9487190528819908, 1.02666314388755],
+        [1.857979703768714, 2.697204613022686, 0.941873264041015, 0.8992137096503191],
+        [0.3525344742748335, 5.449898995896236, 0.9395909875346655, 0.863144471115658],
+        [0.4734908776471151, 5.417425377074134, 0.9439149914783614, 0.9339690403516786],
+        [0.6709137074869337, 6.28139077161015, 0.9513651566485463, 1.085540689651115],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.5283879401972387, 5.418398949760017, 0.9493724752543576, 1.04062996769706],
+        [0.4137019537727368, 5.434703140820804, 0.9421361525766211, 0.9035511627386907],
+        [0.3339324694423407, 5.453260024779848, 0.9380349701035083, 0.8400763382132457],
+        [1.014334782191446, 6.792967973018847, 0.9528122219645535, 1.120531779685329],
+        [3.602084386164886, 5.363203916462073, 0.9474236298737917, 0.9999999999999956],
+        [0.7525175545471307, 5.337261724063819, 0.949227159962872, 1.037492786866101],
+        [1.132563035238893, 5.247771771959308, 0.9490084434717411, 1.032804672575679],
+        [0.7104068179004333, 5.378005849028617, 0.9493788627267418, 1.040768278731575],
+        [4.097923368289165, 3.458492696048399, 0.9430072536761751, 0.9182096129696367],
+        [0.5631155468797905, 2.14025650776708, 0.9404553754815773, 0.8764800168151541],
+        [1.045839440248842, 5.228024481558351, 0.9489708359282485, 1.032002616690157],
+        [0.9217041100164138, 3.85991524818663, 0.94592690061012, 0.9707842005818427],
+        [2.645591802981422, 4.985356240734754, 0.9481875156002199, 1.015561439392645],
+        [0.6192049714754557, 5.379308589876776, 0.9460336748401602, 0.9728147273820166],
+        [0.7227305016192797, 5.341411356749202, 0.9492696622675438, 1.038408500449581],
+        [0.3762294883977403, 5.445753754553557, 0.9406801689130787, 0.8800117471610377],
+        [5.13921613164611, 6.327228802649699, 0.9519902170244731, 1.100396320240616],
+        [1.030180713795757, 3.969834813963743, 0.9461494381065491, 0.9750252963757654],
+        [0.6192049714754557, 5.379308589876776, 0.9460336748401602, 0.9728147273820166],
+        [0.9276437024887501, 11.4938363471317, 0.9725100872805188, 1.963211731095517],
+        [0.8246916191889394, 5.311705219856134, 0.9491924064836754, 1.036745160526894],
+        [1.118137899530719, 3.097239934829737, 0.9427422193107856, 0.9137025411250388],
+        [0.4734908776471151, 5.417425377074134, 0.9439149914783614, 0.9339690403516786],
+        [1.465352165647812, 5.21631263076012, 0.9489066322340451, 1.030636073316598],
+        [0.8898153622824133, 5.250959811671447, 0.9490384821981734, 1.03344615871821],
+        [1.482351986505218, 5.162952433409226, 0.9487523889071403, 1.027367075612668],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.7911953264008603, 4.548283172287638, 0.9474777292494476, 1.001087187740738],
+        [0.6894822174716573, 5.353200807020114, 0.9493007025851514, 1.039078235222896],
+        [2.855590928193013, 15.47003964485996, 0.9769323169561989, 2.3502111785586],
+        [0.6929901555462256, 5.354175757397543, 0.9492679904271837, 1.038372451603064],
+        [0.8754797403491142, 1.965859452052981, 0.9394716496285062, 0.8613332802203124],
+        [0.757855959209614, 5.335502910360265, 0.9492230788400147, 1.037404939603154],
+        [1.001805915416983, 5.262646643999983, 0.949055399546619, 1.033807766831906],
+        [0.6470843550290096, 5.366206113918841, 0.9492917547019837, 1.038885089022905],
+        [0.9377611022927271, 5.276186514371442, 0.9490927493514135, 1.034606969490439],
+        [0.445985269917542, 5.129859307132919, 0.9487330524679333, 1.026958651096521],
+        [0.8621127057503895, 5.291820066668952, 0.9491437893707886, 1.035701010439283],
+        [0.5980101113642344, 5.388352644771291, 0.9493336973749015, 1.03979103999453],
+        [0.2778082750178813, 5.46233214442436, 0.9346251964535877, 0.793365799431516],
+        [1.865239879350904, 5.218243176322375, 0.9489033177213727, 1.03056561880013],
+        [0.3901709042449691, 5.443093530738913, 0.9413366738715988, 0.8904810511062795],
+        [1.860210464178613, 5.283329046449775, 0.9490405396619607, 1.033490124157051],
+        [0.4130418865416083, 5.434890433945496, 0.9421137140323106, 0.9031794066648036],
+        [1.123273112191848, 4.667446903734294, 0.9476005907548335, 1.003564566069266],
+        [0.6093075079566025, 5.381394823001899, 0.9459716463882287, 0.9716341546450707],
+        [1.199731939083798, 5.292642245962958, 0.9491219252320131, 1.0352320846742],
+        [0.9930075086754236, 5.348613412622078, 0.9469726194804489, 0.9910227738949814],
+        [2.769668890191082, 2.945830119540604, 0.9413703781426535, 0.8910248615567063],
+        [0.5608659798355382, 5.00819549101041, 0.9485313986946061, 1.022717605775639],
+        [1.093769133939891, 3.963149577141647, 0.9460451407543564, 0.9730332526515318],
+        [0.3004371944747732, 5.45398648918724, 0.9363249281483841, 0.8160251218491764],
+        [0.7150244590107468, 5.348380223984896, 0.9492520497575651, 1.038028852219136],
+        [0.669590001520095, 5.331500843283408, 0.9492577944801187, 1.038152654201918],
+        [0.9930075086754236, 5.348613412622078, 0.9469726194804489, 0.9910227738949814],
+        [0.7750381227779995, 7.559616956367918, 0.9537236752249806, 1.143694651370173],
+        [0.3762294883977403, 5.445753754553557, 0.9406801689130787, 0.8800117471610377],
+        [2.873557334964822, 4.870533547048529, 0.9480838380690005, 1.013422521869594],
+        [1.78609767626162, 5.04930042256343, 0.9484301833373402, 1.020601414860768],
+        [0.4734908776471151, 5.417425377074134, 0.9439149914783614, 0.9339690403516786],
+        [0.496612668807352, 5.427166834148041, 0.9493770158227073, 1.040728283236592],
+        [0.5803473165830273, 2.184145200518875, 0.9406185608099408, 0.8790411621069676],
+        [1.022895388793469, 5.247544661487623, 0.9490092907513273, 1.032822756130531],
+        [0.4829120935897665, 5.435592542209943, 0.9493875277966853, 1.040955963491939],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.7682119605512437, 5.329676789688345, 0.9492374052628174, 1.037713381932076],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.9819012232553461, 5.293124245412863, 0.9491090609378739, 1.034956369153445],
+        [1.066695844351166, 5.243312385110068, 0.9489940831712674, 1.032498270935048],
+        [0.7785196547952749, 4.125869306021953, 0.9466209076521874, 0.984127333607324],
+        [2.7371214013167, 5.280544190775402, 0.9490309197405551, 1.033284588917416],
+        [3.058233452182573, 5.266120544581921, 0.9489941221474568, 1.032499102325397],
+        [1.578359560473788, 5.290592508594951, 0.9490888307473402, 1.0345230650282],
+        [3.234841984868659, 3.616822891159279, 0.9443889369886642, 0.942401743519127],
+        [1.067410580587165, 5.252787149893932, 0.9490255956656565, 1.033170870295808],
+        [2.420176838022836, 5.187005041262737, 0.9488066147519687, 1.02851408042287],
+        [5.531244865055974, 5.288722138729226, 0.9488962533588847, 1.030415486575837],
+        [1.427719573176199, 5.204419697076197, 0.9488717763102935, 1.029895619886428],
+        [0.8383999882050616, 5.284032421512745, 0.9491282645985399, 1.035368005194026],
+        [0.5278466901112119, 5.418658738168276, 0.9493680724847608, 1.040534652710708],
+        [1.978956349212724, 5.208899430587613, 0.9488348253626256, 1.029111762956139],
+        [0.785350603075852, 5.332121099995984, 0.9492392679294739, 1.03775349721294],
+        [0.915900527007506, 5.247647376536523, 0.94903069708361, 1.033279832640387],
+        [1.419437222129406, 5.218794699473746, 0.9489027099889448, 1.030552701604784],
+        [0.8581929416619094, 5.292231223378784, 0.9491432110387826, 1.035688601613666],
+        [1.355039190815528, 5.232293325876884, 0.9489445840187699, 1.031443442636078],
+        [1.733001201330299, 3.845679868901339, 0.9457431714401232, 0.9673089283375373],
+        [0.6897738139392179, 5.424226577899957, 0.9494514077355214, 1.042341583869883],
+        [1.172185479193367, 5.209297930895119, 0.9489000593121124, 1.030496365747776],
+        [0.9569093896539755, 5.282363754165033, 0.9491039427136773, 1.034846710959948],
+        [3.917850258541971, 5.242237039755411, 0.9489346945643482, 1.031232943185276],
+        [0.9226919516679445, 0.8896413409520658, 0.933569768193376, 0.7798793092440146],
+        [4.361768229324347, 5.165317911947204, 0.9486731859315854, 1.025696100617045],
+        [0.6774575137948072, 5.359582675508984, 0.9492796801673518, 1.038624559933081],
+        [0.5497598510225532, 5.410408275991032, 0.9493594124751795, 1.040347221650115],
+        [0.9930075086754236, 5.348613412622078, 0.9469726194804489, 0.9910227738949814],
+        [0.9167284806332791, 5.249906036292531, 0.9490273258926822, 1.03320782416359],
+        [0.3427074493420517, 1.425446445204149, 0.9256512438743718, 0.6909077571891883],
+        [6.85888683547558, 5.341075729970306, 0.9492182446444856, 1.037300900517639],
+        [0.3525344742748335, 5.449898995896236, 0.9395909875346655, 0.863144471115658],
+        [2.512148913462275, 5.146067060234507, 0.9486754274025214, 1.025743318862933],
+        [0.5998433567917377, 4.226247954198963, 0.9469212292386938, 0.9900095486152021],
+        [0.4835587238658143, 4.995969237902071, 0.9484651295441833, 1.021331123778474],
+        [1.376527614644598, 5.197883538541403, 0.9488601594081277, 1.029649063279879],
+        [0.6088997226383698, 5.380964079836502, 0.9493689912072453, 1.040554540645646],
+        [0.6702654177578804, 5.36532021575775, 0.9493305034360868, 1.039721998978036],
+        [1.140504659210547, 4.747969628192495, 0.9478498360133278, 1.008626205712348],
+        [1.04048964899271, 5.248800008146017, 0.9490161060896234, 1.032968238293784],
+        [0.7872194278232321, 5.347924962740133, 0.9492843527969383, 1.038725365330418],
+        [3.195498365318586, 4.917835148067425, 0.9479825340530348, 1.011340806833183],
+        [0.8695503546188954, 3.961587498342452, 0.9460622134679441, 0.9733588083168504],
+        [1.321132533795496, 5.260687408129657, 0.9490204228851049, 1.03306040596827],
+        [0.9930075086754236, 5.348613412622078, 0.9469726194804489, 0.9910227738949814],
+        [0.9411602560322492, 5.264989877327988, 0.9490635278012121, 1.033981593602351],
+        [0.6328799556157619, 4.662584763993958, 0.9477290484478683, 1.006167239676786],
+        [0.6981492247689903, 5.349371351704593, 0.9492903477164765, 1.03885472447666],
+        [0.4734908776471151, 5.417425377074134, 0.9439149914783614, 0.9339690403516786],
+        [0.5035523170396261, 5.410625787556732, 0.9445378525275776, 0.9450810878285254],
+        [0.773465175846405, 2.210488997944011, 0.9402197184628384, 0.8728061259694557] 
+        ]
+      },
+     "E":{
+       "0":        [
+[11.06472374400501, 4.335839931017191, 0.946322497790845, 1.003111503025698],
+        [1.023497966679047, 3.690654121057555, 0.9428562849200405, 0.938813600731033],
+        [1.523485518732014, 4.92870591902911, 0.9458701608438169, 0.9942535092363799],
+        [1.642702866507713, 4.61773469701062, 0.9471157585865779, 1.019011599437709],
+        [1.215050285422364, 2.93760834758151, 0.9433299075213744, 0.9471353067567919],
+        [3.897919719506842, 4.130833726929693, 0.9443541545862534, 0.9656160913837278],
+        [17.15937567446357, 5.324443095611484, 0.9488147610827001, 1.054724518299492],
+        [1.201931778087756, 3.107420991518866, 0.9434858486774915, 0.9499057672544383],
+        [1.013374389318761, 4.636154806676942, 0.9470303154201307, 1.017276093864519],
+        [1.001613182928571, 4.752914328825974, 0.9473758005780041, 1.024328200163966],
+        [0.4719277822179881, 5.155125506639818, 0.9433623273822792, 0.947710023925398],
+        [0.8969368469450225, 1.097828862460958, 0.9361688612718153, 0.8344953930425233],
+        [0.7514873218269571, 4.867669514719761, 0.9478735399186888, 1.034652499254801],
+        [0.9104884357107074, 2.723046050483912, 0.9408701504076038, 0.9053682498870378],
+        [0.7109699137568016, 4.935005004359378, 0.9481633810882729, 1.040755838610251],
+        [0.5916592448481666, 1.006056643129763, 0.9320648012945132, 0.7806450343031242],
+        [0.6574839948476786, 4.944437611220607, 0.9481585852242747, 1.040654294277268],
+        [0.7282479052484532, 4.417299720021341, 0.9470383582023892, 1.017439218603133],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.5679696812306195, 0.9759753915487367, 0.9318973312148164, 0.7785854451792634],
+        [0.4118128032551986, 5.223601225172319, 0.941754377379173, 0.9199764273374267],
+        [0.3890528332253625, 5.251204932637108, 0.9410513142909791, 0.9083255340977249],
+        [1.773673817819515, 11.63111424420699, 0.9647556222041779, 1.557506307929198],
+        [0.9309630469785606, 4.713522188162639, 0.9473102594122466, 1.022983253867104],
+        [0.6598801406708531, 4.858442264461714, 0.9479943176117472, 1.037187511385183],
+        [0.6247012461808915, 4.948836073408064, 0.9482644151512981, 1.04289944050747],
+        [0.8038737442694548, 4.770758985537488, 0.9476341802934496, 1.029663113287945],
+        [0.7254073630056845, 2.583817512089133, 0.9506305202975666, 1.095608888851515],
+        [1.39796453472792, 0.8877304448295602, 0.9283746249694974, 0.7374943484151748],
+        [0.8138303954004624, 4.779186527812335, 0.9476113669522199, 1.029189955200552],
+        [0.6553038922523242, 8.35694718684597, 0.9613424718107297, 1.414967264535824],
+        [0.674862700132301, 2.090152069684382, 0.9494407582128843, 1.068488034521537],
+        [0.619050936977713, 4.984016651179741, 0.948291787924322, 1.043481640581001],
+        [1.043432089747269, 4.698697810162916, 0.9472787932250679, 1.022338735849207],
+        [0.6061087857910248, 5.030567347316389, 0.9450580728739298, 0.9787165940187009],
+        [1.30115802743809, 1.020072176104316, 0.929888180625061, 0.7546434981863809],
+        [0.6176298017277045, 4.929406837065567, 0.9482196200013985, 1.041948006343306],
+        [1.186883484519069, 4.930304309377217, 0.9457800201526838, 0.9925059691802073],
+        [1.112267163751849, 4.932052729555502, 0.9457612297679207, 0.9921424152607126],
+        [1.577969147168962, 2.788635538598619, 0.9416932402109834, 0.91895213136939],
+        [1.361847996759973, 2.843920991094679, 0.9410558063769584, 0.9083990930011967],
+        [0.9992249328414411, 4.700091753286347, 0.947220233907216, 1.021141318491703],
+        [0.7831577466505626, 4.711763836406859, 0.9474485259821109, 1.02582449812166],
+        [0.7976568320632628, 4.79101211841842, 0.9476619915168299, 1.030240487440729],
+        [0.347303045176416, 2.181271436516087, 0.9306397164381036, 0.76343675845614],
+        [1.094442412477736, 1.384209776191613, 0.9341953415699774, 0.8077619695019603],
+        [0.7205113890378583, 4.887444945828973, 0.9479544045089562, 1.03634847063628],
+        [0.7125349018720136, 4.724347803881607, 0.9475693464734727, 1.028319510867238],
+        [0.9609243556013204, 4.854789420862874, 0.9476521714529939, 1.030036548203594],
+        [1.829249803120202, 2.364169197450392, 0.9450977651400748, 0.9794653052137823],
+        [2.161345026289562, 4.138594427543708, 0.9448698929780036, 0.975181647529785],
+        [2.942569328162252, 1.266985652748868, 0.9316902090237142, 0.7760521727989695],
+        [0.9822595523551684, 4.66059106696052, 0.947130240096886, 1.019306301099312],
+        [0.7687574444625129, 4.820009061885169, 0.9477719830358891, 1.032529988317991],
+        [8.163577767791971, 2.388026250656962, 0.9394570440859324, 0.8829084031631237],
+        [7.713462635392817, 1.518543192020564, 0.9324708417571879, 0.7856810314078148],
+        [2.179542538165584, 9.685141226505531, 0.9675692057889711, 1.697566505037056],
+        [1.280699558891045, 8.510024981623976, 0.9724992566383757, 2.012089009417428],
+        [1.69471114011779, 3.387527571601558, 0.9438220327673567, 0.9559307564125473],
+        [1.033354413294423, 4.746315220430166, 0.9473419562455568, 1.023633274943591],
+        [1.542129517838774, 2.691618250923227, 0.9465290957163416, 1.007207111878538],
+        [0.9298952197086447, 4.701298949316458, 0.9473099569036409, 1.022977053955984],
+        [1.984171606192395, 4.442722368462584, 0.9458641742522782, 0.9941372679334183],
+        [1.751806998486146, 4.820244447803476, 0.9485889333974044, 1.049841614385951],
+        [0.3515421033798903, 5.290932686148681, 0.939429530463776, 0.8824815037559569],
+        [0.4719277822179881, 5.155125506639818, 0.9433623273822792, 0.947710023925398],
+        [0.6699566072922618, 6.032050557311565, 0.9506122987648711, 1.095183672569179],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.5261778366629992, 5.049965900496244, 0.9485016095021245, 1.047964956215037],
+        [0.4124694440598462, 5.222841505345624, 0.9417746558043073, 0.9203166484114148],
+        [0.332474093970005, 5.288795781275786, 0.9378702748410781, 0.8589060918120763],
+        [1.015702627179366, 4.26808472490532, 0.9458614533002968, 0.9940844438630685],
+        [3.594134250856259, 4.956367794244005, 0.9461644715670143, 1.000000000000013],
+        [0.7491158331749898, 4.870510445328773, 0.9478832348658779, 1.034855553515821],
+        [1.12024355605483, 3.243452330220917, 0.9430299266154536, 0.9418484778476248],
+        [0.7069489538657932, 4.966367169819752, 0.9483349708139952, 1.044401365268961],
+        [3.81015790529825, 1.662790537824313, 0.9387416388488671, 0.8719328740955662],
+        [0.556323502318113, 0.8650782520727094, 0.9304881122721754, 0.7616476217051735],
+        [1.072625099756139, 7.678930875954841, 0.9606324641835233, 1.38842163399576],
+        [0.9141554805522644, 3.083462983897845, 0.9434917046605269, 0.9500101029071926],
+        [2.620231310262814, 4.389112017912373, 0.9460088379146968, 0.9969534086976596],
+        [0.6158328475955869, 5.024483865632924, 0.9451016780070277, 0.9795391718515958],
+        [0.71735114365282, 3.319716468655382, 0.9436193788996328, 0.9522902536531962],
+        [0.3751539277227807, 5.266358793515361, 0.9404413005281532, 0.8984394876889977],
+        [5.152314443422817, 5.239539348885237, 0.9483182033292539, 1.044044062829227],
+        [1.026821901122982, 3.992566376862972, 0.9456682370632014, 0.9903469062361893],
+        [0.6158328475955869, 5.024483865632924, 0.9451016780070277, 0.9795391718515958],
+        [1.005477768482727, 2.291973053275231, 0.9334688805943948, 0.7983206398033558],
+        [0.8222646936291393, 4.763098172138911, 0.947552383852079, 1.02796852931664],
+        [1.101962176799555, 2.63780279301126, 0.9408797567672303, 0.905524607200067],
+        [0.4719277822179881, 5.155125506639818, 0.9433623273822792, 0.947710023925398],
+        [1.445454758115637, 4.003769482233102, 0.9447672504893996, 0.9732636677759247],
+        [0.8856668924873099, 4.635437746911286, 0.9471424713854484, 1.019555336085737],
+        [1.471154411810799, 4.486646078137113, 0.9462746312686322, 1.002167088810816],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.6399109620634017, 13.89577395413711, 0.9832532609958171, 3.340700080335578],
+        [0.6833902815276114, 3.466176268620061, 0.9444362992556647, 0.9671277642633692],
+        [4.338571232901221, 9.160312512230808, 0.9540782527835213, 1.182137344219612],
+        [0.6906127173408877, 4.91397992603271, 0.948050197804871, 1.038364373398198],
+        [0.8560628641064133, 1.145715088557253, 0.9355051516743379, 0.8253221516122947],
+        [0.7543920034441044, 4.866124373509623, 0.9478668027146646, 1.034511437445526],
+        [0.9909357738869687, 4.462611761571013, 0.946542930336555, 1.007482501080886],
+        [0.6451993535194571, 4.956405948053342, 0.948199761256787, 1.041526739634151],
+        [0.9325968282180634, 4.691489595248855, 0.9472549431895787, 1.021850730854934],
+        [0.38859235943051, 4.311900785302411, 0.95745158607452, 1.280370889283967],
+        [0.8582947464422058, 4.682041235331918, 0.9473077750003098, 1.022932337975499],
+        [0.5964388218040132, 5.009860338955107, 0.9483718992156168, 1.045189100058714],
+        [0.2771704151780213, 5.375284579893899, 0.9347380880876259, 0.8149528646746045],
+        [1.765556174844027, 3.303144886083248, 0.9430580806223193, 0.9423422921624565],
+        [0.3890528332253625, 5.251204932637108, 0.9410513142909791, 0.9083255340977249],
+        [1.864892368549507, 3.962443478126946, 0.9433960601208273, 0.9483087137604201],
+        [0.4118128032551986, 5.223601225172319, 0.941754377379173, 0.9199764273374267],
+        [1.105041482046706, 4.809672116944574, 0.9478442076888524, 1.034038614789884],
+        [0.6061087857910248, 5.030567347316389, 0.9450580728739298, 0.9787165940187009],
+        [1.200801250935378, 2.592562743386667, 0.940160238397494, 0.8939523477114024],
+        [0.8703070223934526, 1.747625593143709, 0.9361284316829327, 0.8339311561267202],
+        [2.725915564148362, 2.778560361357322, 0.9410609504860783, 0.9084833427001895],
+        [0.5581991860611539, 4.201245694101499, 0.9464676287312577, 1.005985283393881],
+        [1.092271822423697, 3.942550104527734, 0.9454431327181412, 0.9860259188324493],
+        [0.2997653464723117, 5.349189879178436, 0.9363644832817801, 0.8372356285768225],
+        [0.7121083197201288, 4.901208304110756, 0.9479962147927706, 1.037227425395095],
+        [0.6683859922610035, 4.907297283535465, 0.9481155612635521, 1.039744174054956],
+        [0.8703070223934526, 1.747625593143709, 0.9361284316829327, 0.8339311561267202],
+        [0.7382867978958502, 2.580048449014428, 0.9494681104308255, 1.069097190907605],
+        [0.3751539277227807, 5.266358793515361, 0.9404413005281532, 0.8984394876889977],
+        [2.610010189621176, 6.291412212737851, 0.9533996649601517, 1.164094667667716],
+        [1.718619348320155, 4.763525904201108, 0.9482863236557251, 1.043365370105474],
+        [0.4719277822179881, 5.155125506639818, 0.9433623273822792, 0.947710023925398],
+        [0.495442384366403, 5.133531534408836, 0.9487252790007624, 1.052784568983988],
+        [0.5736678302225933, 0.8843121576044279, 0.9308117292234442, 0.7654762397951242],
+        [1.017004134369149, 4.630712136847743, 0.9469875836780544, 1.016410233309168],
+        [0.4664052668091511, 0.9947863219314774, 0.9325373331939664, 0.7865114808933629],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.7622713861296981, 4.682917366907936, 0.9473798833005899, 1.024412091074185],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.974674722312158, 4.762889238560489, 0.9474216108287921, 1.025270246435005],
+        [1.059018163814607, 4.60676912120927, 0.946884280901241, 1.014322794880916],
+        [0.7736471515152903, 2.863732466078537, 0.9429155635316946, 0.9398475855865714],
+        [2.761454407855356, 3.049199598497114, 0.9406799908157054, 0.9022835522781369],
+        [3.013969777682278, 4.267898555028804, 0.9447218827804037, 0.9724181956637904],
+        [1.563542569030078, 4.649075905248818, 0.9469058367030915, 1.014757702163527],
+        [3.194582201747385, 3.471725245456474, 0.9434336461387588, 0.9489766327847168],
+        [1.053683794214408, 4.48744747376193, 0.9465532731680221, 1.007688476563992],
+        [2.525032221795223, 2.833450388517389, 0.9397619151367208, 0.8876648621331379],
+        [5.480915895122583, 4.521089061863457, 0.9463476699537484, 1.003608829972864],
+        [1.41503753188237, 4.554415116958523, 0.9465887951994724, 1.008396498397786],
+        [0.8350321753192297, 4.60233245300023, 0.9471374130442874, 1.019452331823701],
+        [0.5255389349503422, 5.047635996786861, 0.9484876466086777, 1.047665472838923],
+        [1.961820121103635, 4.477799204089567, 0.9460754363538677, 0.9982549473808062],
+        [0.7829946362699799, 4.835833254383573, 0.9477861583471481, 1.032825752626128],
+        [0.9122196805209751, 4.713231425230176, 0.9473840328102039, 1.024497367650156],
+        [1.407940311653553, 4.583996095270528, 0.9466225560224367, 1.009070289421079],
+        [0.8521375344482987, 4.601811282489303, 0.9470696087351302, 1.018073516432761],
+        [1.344118630334475, 4.611131114171022, 0.9467604152057183, 1.011830521583952],
+        [1.714948917368434, 3.233624364031815, 0.943304076173262, 0.9466778567287285],
+        [0.6880471128668604, 4.92539395779405, 0.9481237066261419, 1.039916363570818],
+        [1.163549094093157, 4.640721350937112, 0.94695830071287, 1.015817686906074],
+        [0.950746543972822, 4.714326070138258, 0.9473141488304235, 1.023062973799632],
+        [3.900989987928547, 4.411813565477184, 0.9457969438002314, 0.9928336214566912],
+        [0.9271418790527234, 1.456537346642691, 0.9389524729645483, 0.8751406925454567],
+        [4.341964858015879, 4.259362444025627, 0.9448943625423336, 0.9756399410478915],
+        [0.6752582575014265, 4.928095802091397, 0.9481003727731679, 1.039423240155471],
+        [0.5477347371403162, 5.078870497058998, 0.9485637532987847, 1.049299820766662],
+        [0.8703070223934526, 1.747625593143709, 0.9361284316829327, 0.8339311561267202],
+        [0.9101646533300266, 3.51232976934133, 0.9443194086833769, 0.9649780198620076],
+        [0.347303045176416, 2.181271436516087, 0.9306397164381036, 0.76343675845614],
+        [6.848617993835317, 4.50646292079465, 0.9464673908710742, 1.005980560706469],
+        [0.3515421033798903, 5.290932686148681, 0.939429530463776, 0.8824815037559569],
+        [2.466520958613329, 4.458803503308357, 0.9460601983363783, 0.9979568660153376],
+        [0.6014231338089497, 4.74931598422116, 0.9479298549397027, 1.035833036175785],
+        [0.4837465507159024, 5.637296778857185, 0.9501420604972795, 1.084317735781368],
+        [1.399223150557724, 1.678635383922558, 0.9342049427550608, 0.8078881456536351],
+        [0.5952411808200276, 0.7826730426149905, 0.9293162226830856, 0.7480766730515469],
+        [0.6688444719853105, 4.917138000759946, 0.9481364239423369, 1.040185310393065],
+        [1.135993680107843, 2.927486983218391, 0.9427534519863797, 0.9370249860368596],
+        [1.03428455318814, 4.61935022666384, 0.9469858594230814, 1.016375324542458],
+        [0.7766704788330407, 0.723523170820996, 0.9270998440081017, 0.7236030594292228],
+        [3.175620914308863, 4.256588627782559, 0.9452920657258663, 0.983146053463209],
+        [0.8678469093359349, 3.856064674408212, 0.94556507291728, 0.9883621842143395],
+        [1.308678216366961, 4.534000966036523, 0.9465412728297568, 1.007449499564199],
+        [0.8703070223934526, 1.747625593143709, 0.9361284316829327, 0.8339311561267202],
+        [0.9369573941213014, 4.671078130895071, 0.9471785700463051, 1.020290994874436],
+        [0.5988287864330313, 1.983315080746937, 0.9454415124619223, 0.9859949464727717],
+        [0.6930412258817314, 3.041659799188311, 0.9425758959240612, 0.9339517613208558],
+        [0.4719277822179881, 5.155125506639818, 0.9433623273822792, 0.947710023925398],
+        [0.5017047874247217, 5.125081048925006, 0.9438946806707765, 0.9572422173829346],
+        [0.7641989118248548, 0.9518235843160757, 0.9309700868056946, 0.7673628031869268] 
+        ]
+      },
+     "F":{
+       "0":        [
+[11.51603702583787, 5.631258087856318, 0.9499945736517019, 1.039547845181838],
+        [1.097681549705997, 5.630570600846714, 0.9477063098720908, 0.9916649771782219],
+        [1.539775545261954, 5.630630056322407, 0.9478739114757646, 0.99502942839681],
+        [1.667724788704626, 5.630719725601436, 0.9499994157127768, 1.03965381411],
+        [1.258477397116319, 5.63068615290146, 0.9499997176675707, 1.039660423096814],
+        [4.185910849001628, 5.630654866793391, 0.9499999990566257, 1.039666582026189],
+        [17.36207569658561, 5.63065476217722, 0.9499999999975492, 1.039666602620858],
+        [1.242185147310281, 5.630683377853924, 0.9499997426265078, 1.039660969385091],
+        [1.024191826188649, 5.630715314989588, 0.9499994553820735, 1.039654682360774],
+        [1.014004796667105, 5.632607163746274, 0.9499824399855789, 1.039282388967598],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.9140592541745477, 5.630730160151205, 0.9499993218638363, 1.039651760022723],
+        [0.7567550781917377, 5.633990183409647, 0.9499700010272059, 1.039010387334883],
+        [0.9228460004688064, 5.631089594644689, 0.9499960890893352, 1.039581008459963],
+        [0.7121146981259315, 5.630928767310181, 0.9499975355796291, 1.03961266479502],
+        [0.6095796503565453, 5.637045393913154, 0.9499425222882697, 1.038409991274631],
+        [0.6605558065143398, 5.635548875054762, 0.9499559820649285, 1.0387039979643],
+        [0.7334618546894948, 5.631584447719908, 0.9499916383523237, 1.039483615889975],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5854212568599713, 5.637914315759457, 0.9499347071552232, 1.038239355084911],
+        [0.413422179516867, 5.624771969338811, 0.9425950877828696, 0.8984969502867984],
+        [0.3904522005816347, 5.623504918093852, 0.9417960395092446, 0.8854107996422753],
+        [2.212335991763994, 5.630654963724663, 0.9499999981848202, 1.039666562944357],
+        [0.9394451709609545, 5.631043490270708, 0.9499965037547259, 1.03959008319467],
+        [0.6621313322868775, 5.632065529471758, 0.9499873114753864, 1.039388950286525],
+        [0.626528897876146, 5.63260471496772, 0.949982462010034, 1.039282870694448],
+        [0.8073383340999789, 5.630800914362855, 0.9499986854963883, 1.039637831946586],
+        [0.7792544736123338, 5.631409293791692, 0.9499932136968252, 1.039518086142244],
+        [1.454921870901184, 5.630658037203367, 0.949999970541776, 1.039665957901581],
+        [0.8187160463016893, 5.63123857877321, 0.949994749117517, 1.039551684908112],
+        [0.757951321794687, 5.631482189124848, 0.9499925580720073, 1.039503740093816],
+        [0.7197156570640448, 5.631648897767064, 0.9499910586848941, 1.039470932682291],
+        [0.6214790654256428, 5.636571110701321, 0.9499467880187471, 1.038503152027501],
+        [1.057135219780293, 5.630660196325321, 0.9499999511225091, 1.039665532858811],
+        [0.6108370616594112, 5.629852062445075, 0.9466008848231497, 0.9700035810798474],
+        [1.302972523179607, 5.630665076132612, 0.9499999072332417, 1.039664572225625],
+        [0.6199990540154902, 5.632759480958808, 0.9499810700358114, 1.039252425764599],
+        [1.201664187292614, 5.63059169385776, 0.9477598036683864, 0.9927364713728638],
+        [1.125320876061586, 5.630581829699935, 0.947731859108226, 0.9921764611988656],
+        [1.663131794636887, 5.630679928739902, 0.9499997736480378, 1.039661648369021],
+        [1.373376890533493, 5.630675820666752, 0.9499998105962839, 1.039662457075087],
+        [1.009621807867756, 5.630729047751629, 0.9499993318688219, 1.03965197900313],
+        [0.7922677004712591, 5.631579600918412, 0.9499916819447349, 1.039484569710162],
+        [0.8020493394401261, 5.631282254381983, 0.9499943562965806, 1.039543088827367],
+        [0.3617783815235025, 5.621173762575041, 0.940512013334362, 0.8651184395067167],
+        [1.112742523566105, 5.63065607524594, 0.949999988187734, 1.039666344131015],
+        [0.7246574027998087, 5.634212388100799, 0.9499680025054373, 1.03896669844201],
+        [0.7171587826839192, 5.631738918674986, 0.949990249031672, 1.03945321784416],
+        [0.9719488146818118, 5.630726470097823, 0.9499993550523886, 1.039652486425174],
+        [1.999571618917424, 5.630655137364725, 0.9499999966230912, 1.039666528761677],
+        [2.202651456309852, 5.630655669049549, 0.9499999918410875, 1.039666424094554],
+        [2.978945664439118, 5.630654929731084, 0.9499999984905604, 1.039666569636312],
+        [0.9921478243743672, 5.630729378401886, 0.9499993288949345, 1.039651913913266],
+        [0.7731848349831044, 5.63150229315424, 0.9499923772552111, 1.03949978361893],
+        [8.36126039391088, 5.630654762392925, 0.9499999999956092, 1.039666602578396],
+        [7.635240475102401, 5.630654841358709, 0.9499999992853867, 1.039666587033246],
+        [2.877678310152866, 5.630654783873869, 0.9499999998024085, 1.039666598349672],
+        [1.930761570814078, 5.630658460178909, 0.9499999667375095, 1.039665874634974],
+        [1.777674281390769, 5.630660242447238, 0.9499999507076858, 1.039665523779294],
+        [1.046421696018844, 5.632548779466227, 0.9499829650971505, 1.039293874513367],
+        [1.64600882044475, 5.630658918057254, 0.9499999626193256, 1.039665784497454],
+        [0.9374441525415851, 5.630746083545801, 0.9499991786479095, 1.039648625446917],
+        [2.006054900298822, 5.630665485630906, 0.9499999035501904, 1.039664491612342],
+        [1.884943788929805, 5.63065573353175, 0.949999991261131, 1.039666411400633],
+        [0.3527959926644126, 5.620215576755586, 0.9400298543877602, 0.8577229598304965],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.6696318175357709, 5.632158013904291, 0.9499864796650828, 1.039370753396854],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.5287812489052429, 5.640946977563228, 0.9499074312205886, 1.037644227515671],
+        [0.4140841787889652, 5.624808466089998, 0.9426180396686966, 0.8988782218624148],
+        [0.3341618283895716, 5.616436087469279, 0.9384616712574966, 0.8344711656980914],
+        [1.027611087121654, 5.630660447407351, 0.9499999488642626, 1.039665483431048],
+        [3.613551378934922, 5.630674374729288, 0.9481195658945871, 1.000000000000002],
+        [0.7543439264348553, 5.634046106214465, 0.9499694980542842, 1.038999391714364],
+        [1.13666437403459, 5.63066648440942, 0.9499998945671191, 1.039664294994206],
+        [0.7124449646153787, 5.631334519392785, 0.9499938862220684, 1.039532802388022],
+        [4.041956306941437, 5.630654910300573, 0.9499999986653195, 1.03966657346139],
+        [0.575167182340297, 5.638363985095822, 0.9499306628033567, 1.038151071324759],
+        [1.050087263080134, 5.630669046584481, 0.9499998715227693, 1.039663790608337],
+        [0.9342176765540525, 5.631038956813692, 0.9499965445288987, 1.039590975524195],
+        [2.660678516017374, 5.630659091529506, 0.9499999610591063, 1.039665750347866],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298303, 0.9713119348893234],
+        [0.7237945268664634, 5.631790575648473, 0.9499897844258822, 1.03944305274332],
+        [0.3765053823425964, 5.622267937383556, 0.941131651656207, 0.8748004966076748],
+        [5.297462216583992, 5.630654766928546, 0.9499999999548158, 1.03966660168552],
+        [1.042802033216247, 5.630705556902234, 0.9499995431468721, 1.039656603293456],
+        [0.6208481334867005, 5.629902064004313, 0.9466689772298303, 0.9713119348893234],
+        [1.050962319453759, 5.630711979041799, 0.9499994853857797, 1.039655339059521],
+        [0.8262586453255309, 5.630784080366187, 0.9499988369023223, 1.03964114571276],
+        [1.128208648503803, 5.630689775777943, 0.9499996850832114, 1.039659709908066],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [1.471436485690721, 5.63066125370253, 0.9499999416123975, 1.039665324704617],
+        [0.8928906452040177, 5.630744592035276, 0.9499991920626409, 1.039648919055208],
+        [1.492256225013967, 5.630658561629242, 0.9499999658250595, 1.039665854663553],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7967464463980738, 5.630854490311203, 0.9499982036312287, 1.039627285674053],
+        [0.6902590045140926, 5.631994622097587, 0.9499879492203865, 1.039402902165165],
+        [4.956652875362104, 5.630659581395978, 0.9499999566532191, 1.039665653913208],
+        [0.6941378186395822, 5.634766947838562, 0.9499630147632699, 1.03885767860956],
+        [0.8877044254804719, 5.630738605456433, 0.9499992459062756, 1.03965009753268],
+        [0.7597355524698994, 5.633964815997391, 0.9499702291831702, 1.039015375184043],
+        [1.004811813907346, 5.630682424961197, 0.9499997511968798, 1.039661156969079],
+        [0.6480673156558283, 5.63584845080673, 0.9499532876633905, 1.038645130532967],
+        [0.9406530440728301, 5.630752535688303, 0.9499991206169692, 1.039647355325267],
+        [0.4478046697694048, 5.646814470418394, 0.9498546586524822, 1.036494632621441],
+        [0.8634112629956288, 5.630678024536482, 0.9499997907745527, 1.039662023226083],
+        [0.5985982038904627, 5.637361149501868, 0.9499396823643498, 1.038347978004362],
+        [0.2779593162922388, 5.608915904677525, 0.9350200828413322, 0.7873761904704571],
+        [1.872349795156183, 5.630670248679056, 0.9499998607110612, 1.039663553965988],
+        [0.3904522005816347, 5.623504918093852, 0.9417960395092446, 0.8854107996422753],
+        [1.867330040332176, 5.630656429549629, 0.9499999850011059, 1.039666274383035],
+        [0.413422179516867, 5.624771969338811, 0.9425950877828696, 0.8984969502867984],
+        [1.128407361000569, 5.63066517339557, 0.949999906358453, 1.039664553078569],
+        [0.6108370616594112, 5.629852062445075, 0.9466008848231497, 0.9700035810798474],
+        [1.20217820458946, 5.630665150667276, 0.9499999065628725, 1.039664557552828],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [2.728171711740034, 5.63065492746702, 0.9499999985109233, 1.03966657008201],
+        [0.5631573495724497, 5.638792873200017, 0.9499268053590874, 1.038066880839981],
+        [1.114573795329159, 5.630665579778867, 0.9499999027034184, 1.039664473078508],
+        [0.3007173128767589, 5.613039174730816, 0.9367463277974535, 0.8103576717590023],
+        [0.7165694661928339, 5.634678106586306, 0.9499638138066009, 1.038875142278437],
+        [0.6705962102276068, 5.632081327763951, 0.9499871693846382, 1.039385841831011],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.7684828455847844, 5.630877763155892, 0.9499979943139254, 1.039622704544318],
+        [0.3765053823425964, 5.622267937383556, 0.941131651656207, 0.8748004966076748],
+        [2.879196376416358, 5.63065489489325, 0.949999998803894, 1.039666576494469],
+        [1.799786045362033, 5.630657358733963, 0.9499999766439688, 1.039666091464516],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.4969952964967309, 5.64277454372283, 0.9498909939854682, 1.037285899991685],
+        [0.5922173564861877, 5.637649860560314, 0.9499370856804895, 1.038291282340831],
+        [1.026554419665909, 5.63070441731729, 0.9499995533963647, 1.039656827627405],
+        [0.4832131043832617, 5.643704847798623, 0.9498826267771202, 1.037103587264681],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7697367203113609, 5.63162006503886, 0.9499913180081092, 1.039476606675615],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.9863677916657333, 5.632706048727345, 0.9499815506083735, 1.039262936542102],
+        [1.070999825523222, 5.630705027186561, 0.9499995479111653, 1.039656707571065],
+        [0.7856538444156257, 5.631367901425538, 0.9499935859821464, 1.039526232467529],
+        [2.75040452174083, 5.630654994750861, 0.9499999979057689, 1.039666556836563],
+        [3.057074928068481, 5.630657324158459, 0.9499999769549428, 1.039666098271019],
+        [1.582884181147004, 5.630656190410661, 0.9499999871519358, 1.039666321459766],
+        [3.197216508658467, 5.630655857911416, 0.9499999901424532, 1.039666386915338],
+        [1.071004561808776, 5.630663934520971, 0.9499999175009625, 1.039664796961814],
+        [2.426157163698774, 5.630657180441096, 0.9499999782475456, 1.039666126563119],
+        [5.507829757158232, 5.630655005817359, 0.9499999978062359, 1.039666554658012],
+        [1.433711441977474, 5.630656146917967, 0.9499999875431117, 1.039666330021709],
+        [0.8399507282736051, 5.630752010831651, 0.9499991253375599, 1.0396474586446],
+        [0.5282518185750199, 5.641367250487635, 0.9499036512617419, 1.037561804559422],
+        [1.986218899689759, 5.630657284838809, 0.9499999773085862, 1.03966610601146],
+        [0.7867329012344769, 5.63134184289749, 0.9499938203540457, 1.039531361041722],
+        [0.9207712351812527, 5.630773756035859, 0.9499989297599427, 1.039643178063385],
+        [1.427166925280543, 5.630832548414757, 0.9499984009779069, 1.039631604849174],
+        [0.8598570929862878, 5.63076660123229, 0.9499989941106578, 1.039644586495205],
+        [1.36209349656165, 5.630869021573094, 0.9499980729362235, 1.039624425271657],
+        [1.727572274331233, 5.630686611445119, 0.9499997135434028, 1.039660332829217],
+        [0.6902666653056421, 5.63190779214314, 0.9499887301739898, 1.039419987487635],
+        [1.178390800881981, 5.630662741733002, 0.9499999282289661, 1.039665031772607],
+        [0.9603112425936832, 5.631064460359349, 0.9499963151485427, 1.039585955628558],
+        [3.914563634984424, 5.630654843358017, 0.9499999992674049, 1.039666586639664],
+        [0.9474248244525546, 5.630720631924242, 0.9499994075612573, 1.03965363569604],
+        [4.354552724693409, 5.630654817188547, 0.9499999995027744, 1.039666591791365],
+        [0.6784753781930638, 5.635072956091077, 0.9499602625074521, 1.038797530340638],
+        [0.5502592384639773, 5.640173629548884, 0.9499143867570955, 1.037795927252718],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.9213083509500934, 5.630746201089721, 0.949999177590713, 1.039648602308058],
+        [0.3617783815235025, 5.621173762575041, 0.940512013334362, 0.8651184395067167],
+        [6.879821078755825, 5.630654919214192, 0.9499999985851496, 1.039666571706654],
+        [0.3527959926644126, 5.620215576755586, 0.9400298543877602, 0.8577229598304965],
+        [2.517849262796094, 5.6306550003734, 0.9499999978551992, 1.039666555729706],
+        [0.6053058049099489, 5.637157668681729, 0.9499415124825455, 1.038387940104787],
+        [0.485237466987175, 5.643479678562052, 0.949884651962181, 1.037147708346874],
+        [1.383147657407806, 5.630660171809253, 0.9499999513430081, 1.039665537685021],
+        [0.6093293832964402, 5.632909667576546, 0.949979719248736, 1.039222883290248],
+        [0.670798770068635, 5.632043643131023, 0.9499875083223935, 1.039393256649322],
+        [1.140152074149964, 5.630667306450846, 0.9499998871736313, 1.039664133168336],
+        [1.044196769598946, 5.63066647701124, 0.9499998946336591, 1.039664296450608],
+        [0.7880237831338148, 5.630872089638504, 0.9499980453418668, 1.039623821341048],
+        [3.20722415049917, 5.630654957519265, 0.9499999982406319, 1.039666564165947],
+        [0.8788479754733037, 5.63113662847399, 0.9499956660643701, 1.039571750935442],
+        [1.326312247129467, 5.630660427597134, 0.9499999490424371, 1.039665487330873],
+        [0.9977244576812978, 5.630572477240064, 0.9477003261229984, 0.991545257484501],
+        [0.9438185124401696, 5.630719647611203, 0.9499994164142255, 1.039653829462752],
+        [0.6354304776683812, 5.632524785036314, 0.9499831809044326, 1.039298594845705],
+        [0.6990192060709154, 5.631982522249139, 0.9499880580471195, 1.039405282991414],
+        [0.4740621651395829, 5.627503581943448, 0.9444437370511891, 0.9302154716674949],
+        [0.504224974984698, 5.628287880610704, 0.945085891537364, 0.9417330997713343],
+        [0.7836165475521936, 5.631399814561965, 0.9499932989535623, 1.039519951714393] 
+        ]
+      },
+     "G":{
+       "0":        [
+[11.28761199713275, 4.867953584183836, 0.9479987891206517, 1.021532078580907],
+        [1.043703409947051, 4.566681011324768, 0.9450675357153462, 0.9640319906224555],
+        [1.523565421198237, 5.24357411718698, 0.9466587297082335, 0.9944610394867487],
+        [1.653689069408439, 5.085908026153574, 0.948339607359044, 1.028641092280533],
+        [1.236872608483373, 3.182384126894061, 0.9425985398774112, 0.920156092527189],
+        [4.303248979096796, 4.138209539902958, 0.9448047762759828, 0.9591759151311418],
+        [15.97711978359736, 6.604450556544125, 0.9553812731285226, 1.19982313863488],
+        [1.211373532408574, 3.537022179688337, 0.9448644632785919, 0.9602749319740626],
+        [1.014191577955549, 5.069342335675691, 0.9483174822343151, 1.028176745920566],
+        [1.001247012838452, 5.13252883969382, 0.9484716538554027, 1.03142068175968],
+        [0.4376505021945672, 0.7724481462289566, 0.9197745520363563, 0.642431639681399],
+        [0.9075030329581381, 5.100439598234449, 0.9484208982234625, 1.030350587722659],
+        [0.7506471932700312, 5.219098144223207, 0.9487318936665927, 1.036940667276669],
+        [0.7095533632785984, 6.424891178605752, 0.9706332140342636, 1.852065805118616],
+        [0.7100435929114114, 5.252891453151559, 0.9488410567414437, 1.03927286088992],
+        [0.5332704965979638, 4.577601007674454, 0.9589743421463958, 1.309812457999217],
+        [0.656654468942268, 5.272303857820677, 0.9488749331228257, 1.039998631274032],
+        [0.7278577507453821, 4.889007817593795, 0.9481316764398909, 1.02429281888467],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.5691457249744326, 1.352097124504714, 0.9363580918796003, 0.8244350721272107],
+        [0.4107882512145518, 5.442566154587911, 0.9419689239795942, 0.9095647794625544],
+        [0.3880527817110922, 5.458640861577257, 0.9412179654842813, 0.8972289493169804],
+        [1.820228374660342, 9.661680598437865, 0.9657125201401985, 1.578228855177371],
+        [0.9304674057589152, 5.114083211204625, 0.9484485521439673, 1.030933361163333],
+        [0.6593635560047767, 5.216964489174316, 0.948792175056434, 1.038227308120896],
+        [0.6241297911274063, 5.278312916662391, 0.9489426452688261, 1.041452188256367],
+        [0.8037650840946772, 6.649771503669984, 0.9526848514723667, 1.128253618124813],
+        [0.7595769799350465, 2.040339252225821, 0.9369419149139483, 0.8325868988265489],
+        [1.415612317926301, 1.153300280561238, 0.9336396779932614, 0.7883671115703098],
+        [0.8133035369097117, 5.165815050650873, 0.9486106714073743, 1.034362448085973],
+        [0.7389844128709406, 2.073011025458618, 0.9370673214863076, 0.8343576640583721],
+        [0.7018998648170306, 2.09634796339586, 0.9377012582522086, 0.8434180799111293],
+        [0.6182039758124116, 5.297407271980523, 0.9489374537643502, 1.041340607284875],
+        [1.046838410614912, 5.106074558670912, 0.9483910117227397, 1.029721467520785],
+        [0.6048854319504539, 5.32031141977299, 0.9456186882986413, 0.9743703296403208],
+        [1.312407823692447, 1.500087479339991, 0.9364845458650422, 0.8261880143610754],
+        [0.6172443977044566, 5.265244593977919, 0.9489172226166737, 1.040905995764418],
+        [1.187253639200355, 5.24719679442143, 0.9465554071069258, 0.992430151888682],
+        [1.111546718929146, 5.248241641317255, 0.9465305698383376, 0.9919431258426249],
+        [1.375524594212654, 5.547637007671284, 0.9589022859258598, 1.307417731379329],
+        [1.288568311892133, 7.085291590912978, 0.9563195337006449, 1.226799086249589],
+        [0.9984067448539539, 5.040956702030702, 0.948238617655442, 1.026524821616217],
+        [0.7840414373107438, 5.116053490597587, 0.9485105939247792, 1.032243095425172],
+        [0.79710536050767, 5.174719480337222, 0.9486368705758572, 1.034918635005506],
+        [0.3595925542710264, 5.477757609536387, 0.9399924836936149, 0.8777612656706506],
+        [1.096679909895829, 2.254616875589972, 0.9406852101588431, 0.8886668970781479],
+        [0.7196037241771034, 5.232462675869413, 0.9487714808103306, 1.037785270573392],
+        [0.7125566526020761, 5.129797747441298, 0.9485767314377359, 1.033642772929149],
+        [0.961688421668499, 5.060701126377283, 0.9482716098580949, 1.027215274686819],
+        [1.597123120301114, 10.16624761657781, 0.9681172130795491, 1.701489793376753],
+        [2.181971299237016, 4.652444053683729, 0.9469795341846319, 1.000817146635887],
+        [2.978216956554773, 2.083138221217127, 0.9391720239302753, 0.8651660400294953],
+        [0.9826444607197752, 5.084097885792674, 0.9483647491053218, 1.029169232361978],
+        [0.7679683616833111, 5.182741118118163, 0.9486649318421029, 1.035514982402744],
+        [8.317537804678658, 3.381238212814301, 0.9438855158577639, 0.9425448612444711],
+        [7.83631045476034, 2.209252448725423, 0.9391421031804551, 0.8647131321776551],
+        [2.60719240140903, 10.19257442869112, 0.9565536801875183, 1.233712699293893],
+        [0.96134469678351, 28.43770882846011, 0.9929415775668177, 7.882677028316166],
+        [1.762208817248442, 4.929189057125485, 0.9478764080001517, 1.019002056479699],
+        [1.033062309967226, 5.126835954505711, 0.9484534776264895, 1.031037225446363],
+        [1.639005147815415, 3.679463087042552, 0.943125776071841, 0.929205590277255],
+        [0.9302932084645613, 5.113520459059024, 0.9484610855548206, 1.031197693822712],
+        [1.987248258408418, 4.874996591372817, 0.947644372589504, 1.014237590337157],
+        [1.858738287010016, 4.710231034605649, 0.9471243353000957, 1.003711357780974],
+        [0.350611763495429, 5.480653223769495, 0.9395209451936637, 0.870480715589851],
+        [0.4376505021945672, 0.7724481462289566, 0.9197745520363563, 0.642431639681399],
+        [0.6669149029015647, 5.288371075972573, 0.9488268040397526, 1.038967797022119],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.5256701134378137, 5.337284234036313, 0.949024889210338, 1.043222888756177],
+        [0.4114438529379149, 5.442107969710367, 0.9419905193775262, 0.9099242466830644],
+        [0.3317780648178221, 5.479263122357609, 0.9379577809355583, 0.8471370001084149],
+        [1.015978651523092, 4.093854847434345, 0.9456641745576813, 0.9752329147473151],
+        [3.592356281025842, 5.254144708102851, 0.9469385076047966, 1.000000000000018],
+        [0.7482750082987291, 5.220906731097422, 0.9487365535821876, 1.037040020201503],
+        [1.119346105665351, 4.321978321096646, 0.9466688902425205, 0.994661177808572],
+        [0.7089872542401128, 5.284849756164819, 0.948970721813147, 1.042056030651237],
+        [4.228455873035021, 2.037092708303619, 0.9359373876985715, 0.8186529577956851],
+        [0.5580788255271136, 1.210653151168957, 0.9354039625050881, 0.8114299067436187],
+        [1.059711844118135, 1.787606455791686, 0.9381232758217559, 0.8495526145935721],
+        [0.7469460577435587, 4.986788998022456, 0.9645134641679936, 1.523008656084764],
+        [2.65077798756361, 4.96618054791647, 0.9479536374489171, 1.020597259262996],
+        [0.6146111130645308, 5.316132137225007, 0.9456740579914509, 0.9754205316684039],
+        [0.7165871494315142, 4.082156328517531, 0.9461858613893562, 0.9852302647183286],
+        [0.3741826068901161, 5.467593507327948, 0.9405809394204165, 0.8870091000571186],
+        [5.401318334525727, 4.864876819638649, 0.9469205314247027, 0.9996423575456425],
+        [1.032349196736572, 5.055589704700788, 0.9482726116383032, 1.027236253485505],
+        [0.6146111130645308, 5.316132137225007, 0.9456740579914509, 0.9754205316684039],
+        [0.9904003161443361, 2.584154317767053, 0.9486607408938423, 1.035425876547613],
+        [0.8216409684120457, 5.124331574444555, 0.948516625213342, 1.032370587415347],
+        [1.119510778015902, 2.562147964476514, 0.9391408462734127, 0.8646941162290889],
+        [0.4376505021945672, 0.7724481462289566, 0.9197745520363563, 0.642431639681399],
+        [1.452029355408245, 4.486644315574367, 0.9468085068254176, 0.997419035705605],
+        [0.8849967817738293, 5.035321966297504, 0.9482644328133458, 1.027065000232499],
+        [1.474817480606593, 4.944205946236906, 0.9479077775750683, 1.019649436204698],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.7819370303051185, 12.7340041731799, 0.9578911231600731, 1.274677071512947],
+        [0.6835230716462428, 4.309704223568786, 0.9468495629149984, 0.9982327767896244],
+        [5.054785798733318, 4.381902197633233, 0.9464783055436731, 0.9909197683665737],
+        [0.6897136376879749, 5.250999335639404, 0.9488206298169765, 1.038835697118657],
+        [0.8682631123315018, 1.337691385184422, 0.9354161160264942, 0.811593147942651],
+        [0.7535497773792958, 5.217953614848454, 0.9487284260097127, 1.03686674592923],
+        [0.9931875374488472, 4.942634752710128, 0.9480246858256135, 1.022068976365868],
+        [0.6443767751005283, 5.280231817076935, 0.9488950958161655, 1.040431055244793],
+        [0.9323531918623428, 5.10343261444303, 0.9484273797639359, 1.030487122393734],
+        [0.4294152628613171, 3.48936167248541, 0.9422589963439387, 0.9144156433189453],
+        [0.8655790303220556, 4.772090054689451, 0.9476149767922072, 1.013637008190407],
+        [0.5955627906793993, 5.312621515567023, 0.9489739509812404, 1.04212552299647],
+        [0.2764393094174751, 5.531919235479245, 0.9346850252917837, 0.801881519893392],
+        [1.534667523798217, 9.907758204326711, 0.9638787757739226, 1.495263180535128],
+        [0.3880527817110922, 5.458640861577257, 0.9412179654842813, 0.8972289493169804],
+        [1.880308051102843, 3.889181790202557, 0.9443264764239588, 0.9504540830142548],
+        [0.4107882512145518, 5.442566154587911, 0.9419689239795942, 0.9095647794625544],
+        [1.115017782059895, 5.038237132377726, 0.9478668109123434, 1.018804155236516],
+        [0.6048854319504539, 5.32031141977299, 0.9456186882986413, 0.9743703296403208],
+        [1.197887536701537, 3.202531546866244, 0.9435635633671545, 0.9368482719088554],
+        [0.9846529808242726, 5.248415595361211, 0.9464996441586523, 0.991337346150677],
+        [2.720719323970341, 4.80531093451645, 0.947376692268159, 1.008793408571015],
+        [0.5572236564067508, 4.566337166629086, 0.9473364261806795, 1.007979250663685],
+        [1.101682690471042, 4.994638952584209, 0.9481165167716727, 1.023977161435128],
+        [0.2990111390147493, 5.518499473067465, 0.9363612160857308, 0.8244782968581892],
+        [0.7112509188943771, 5.241481719696419, 0.9487919995977921, 1.038223558750904],
+        [0.6678028440984495, 5.248536089553637, 0.9488573927665139, 1.039622725202166],
+        [0.9846529808242726, 5.248415595361211, 0.9464996441586523, 0.991337346150677],
+        [0.7597246536264854, 1.157676459426618, 0.9354061252923411, 0.8114589519368165],
+        [0.3741826068901161, 5.467593507327948, 0.9405809394204165, 0.8870091000571186],
+        [2.894650908223429, 4.51007897560495, 0.9462807402605102, 0.9870693453877045],
+        [1.782748709044879, 4.604847224617362, 0.9460204613554852, 0.9820396988438733],
+        [0.4376505021945672, 0.7724481462289566, 0.9197745520363563, 0.642431639681399],
+        [0.4946460024731746, 5.38986949791552, 0.9491335536585075, 1.045571199611937],
+        [0.5751226147720251, 1.222099578614779, 0.9355110303608419, 0.8128701155829792],
+        [1.016798543161405, 5.057855649413705, 0.9482862037274855, 1.027520972797909],
+        [0.468704523290309, 1.729221782151386, 0.9389048137483972, 0.8611370116529997],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.7625333632304271, 5.076020570103787, 0.9484212541776654, 1.030358085063511],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.9742312151690906, 5.140358954354372, 0.9484958504125793, 1.031931566387527],
+        [1.059280989234507, 5.037629431020028, 0.9482268556706341, 1.026278882340734],
+        [0.7226133600949112, 5.812810706779292, 0.9599887071550613, 1.3444393732636],
+        [2.31856121800186, 2.013593719867857, 0.9413073915774292, 0.8986813749882914],
+        [3.073814830277031, 4.066129536401624, 0.9455694385811099, 0.9734380011956909],
+        [1.569322650044219, 5.043764609737739, 0.9481632456274066, 1.024950750983403],
+        [3.19884779797559, 4.862350311579208, 0.9475705768062098, 1.012731154004108],
+        [1.057395996304776, 4.961958046600503, 0.9480488790698848, 1.02257104113555],
+        [2.50134772937295, 3.540495854895955, 0.9439495893553184, 0.9436863781319169],
+        [4.936723446923984, 7.052010145025238, 0.9571913516559786, 1.252924592260709],
+        [1.417974445922604, 4.999190312769731, 0.9480379540400459, 1.022344264060489],
+        [0.8352187472859172, 7.95594232826952, 0.9562216699361464, 1.223931390032217],
+        [0.5250286574990557, 5.33451541755886, 0.9490132466364438, 1.042971878683742],
+        [1.967860523213947, 4.887498538299265, 0.9476889366769637, 1.015149361357584],
+        [0.7821010522498109, 5.184823451507651, 0.9486640482324987, 1.035496194324962],
+        [0.9135439714092763, 5.127078058916999, 0.9485013946067358, 1.032048693766462],
+        [1.408828016685345, 5.001815111213768, 0.9480726563828678, 1.023064930220651],
+        [0.8524753329529902, 5.026160366346645, 0.9482817217949993, 1.027427071301097],
+        [1.344999800911317, 5.025315676500195, 0.9481510502703829, 1.024696493094378],
+        [1.708916554843763, 4.912873641261671, 0.9477803878202402, 1.017025304330684],
+        [0.6872320762841377, 5.241873542298259, 0.9488304273700414, 1.039045334429709],
+        [1.163692282070358, 5.013036383406701, 0.948057205733686, 1.022743946505511],
+        [0.9506541187582312, 5.114800235656578, 0.9484532388242404, 1.031032189334796],
+        [3.943816761849349, 4.842120860045082, 0.9474122250844209, 1.009512897929332],
+        [0.9395032029837505, 5.060842307536456, 0.9482933506774217, 1.027670743065964],
+        [4.374703918514496, 4.686092947197673, 0.9470304881066687, 1.001833783354394],
+        [0.6743502142943922, 5.260078463776556, 0.9488445127425658, 1.039346858512544],
+        [0.5467986256183419, 5.330608087054204, 0.9489942630015791, 1.04256284349713],
+        [0.9846529808242726, 5.248415595361211, 0.9464996441586523, 0.991337346150677],
+        [0.9108771277674893, 4.203875522048802, 0.9464918801523773, 0.9911853728839144],
+        [0.3595925542710264, 5.477757609536387, 0.9399924836936149, 0.8777612656706506],
+        [5.502149529476827, 3.707817690202026, 0.9485990504592549, 1.034115926382616],
+        [0.350611763495429, 5.480653223769495, 0.9395209451936637, 0.870480715589851],
+        [2.498515809239318, 4.810301125576556, 0.9472921505302859, 1.007085457542221],
+        [0.6021473156389415, 5.306029369344092, 0.9489568983409148, 1.04175864613977],
+        [0.4831114169376623, 5.406520232190513, 0.9489958704056199, 1.042597465992912],
+        [1.396178653315538, 2.37375749961472, 0.9402441980348166, 0.8816947725286901],
+        [0.5977261350529692, 1.317132237844989, 0.9368760930573539, 0.8316602969787861],
+        [0.6680564046214944, 5.243850279524999, 0.9488448192058671, 1.039353420785775],
+        [1.140808079996209, 3.725871639709058, 0.9449738354698465, 0.9622949895468249],
+        [1.035345672392198, 5.060471282115741, 0.94830408910015, 1.027895853482503],
+        [0.7788631527021028, 1.111534535588267, 0.9353210461443352, 0.8103178446160569],
+        [3.207186340429209, 4.8299989621781, 0.947511069815115, 1.011519488138864],
+        [0.8715373291098505, 5.134407989211934, 0.9485149972144843, 1.032336171127078],
+        [1.310651926702042, 4.940471526975239, 0.9479136357697489, 1.0197704192615],
+        [0.9846529808242726, 5.248415595361211, 0.9464996441586523, 0.991337346150677],
+        [0.9365186084846687, 5.088200206124706, 0.9483847121765808, 1.029588953068255],
+        [0.4861476097232533, 13.91075873257455, 0.9786172502692648, 2.56452535385128],
+        [0.6924616278567757, 3.876883041435708, 0.9456609033937126, 0.9751708333742185],
+        [0.4376505021945672, 0.7724481462289566, 0.9197745520363563, 0.642431639681399],
+        [0.5005292133759757, 5.381342751287354, 0.9442818954205043, 0.9496487741494654],
+        [0.7675468680084628, 1.232407318197467, 0.9350090396274821, 0.8061586867316252] 
+        ]
+      },
+     "H":{
+       "0":        [
+[11.53317301435078, 5.227001925637495, 0.9488928423369362, 1.038648478212052],
+        [1.09228641882871, 5.174620875878805, 0.9465740472924219, 0.9911410515454779],
+        [1.534197808368457, 5.173637003045994, 0.9467300720513212, 0.9942078997586932],
+        [1.66099321417741, 4.9743249401449, 0.9482523877909631, 1.025101282151164],
+        [1.242164168973587, 3.747828304239352, 0.9448244014055081, 0.9579375429338124],
+        [4.195228556319804, 4.357467722041632, 0.9465149412505033, 0.9899839265592172],
+        [17.20755616715991, 5.712239571064549, 0.9501954403609046, 1.067276591618444],
+        [1.238116388712461, 4.877553233682591, 0.9479337446834858, 1.018485350394585],
+        [1.020857350916731, 4.9140680959419, 0.9480840434866271, 1.021595859415816],
+        [1.008491248842956, 5.000905167590744, 0.9483432840905746, 1.027003508718274],
+        [0.4726274094418975, 5.358018352969231, 0.9438970774175833, 0.9411791603157388],
+        [0.9116276029692449, 4.937949255863493, 0.9481749729185507, 1.023486448851753],
+        [0.7539653003299108, 5.094606633506711, 0.9486333835611241, 1.033119577082309],
+        [0.9149917123156084, 3.436220113153172, 0.9435414600216012, 0.9348985620424509],
+        [0.7012576441104698, 0.8340306670917509, 0.9312354207099125, 0.7575788524137729],
+        [0.5981581940380818, 2.127242575479303, 0.9388953445521849, 0.8595596744999526],
+        [0.6587324305550234, 5.172310713963188, 0.9488533736747877, 1.037803808675435],
+        [0.730740793123161, 4.944423463833048, 0.9483828047830543, 1.02783266519592],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.5747974797234631, 2.327695337742199, 0.939785553231548, 0.8730944161624444],
+        [0.4123697106611692, 5.422498581800581, 0.9422455904430185, 0.9126665049033978],
+        [0.3895255745899861, 5.446295290623486, 0.941520464959143, 0.9006561108735835],
+        [2.21449405058863, 3.533498693447943, 0.9436581273437248, 0.9369502979327569],
+        [0.9147585230299907, 1.882949512233937, 0.9410968529916729, 0.8937765778742977],
+        [0.6602862830619307, 5.096882307107408, 0.9487149917857284, 1.034852565610213],
+        [0.6251667737744465, 5.180909588502193, 0.9489480446253279, 1.039832054127495],
+        [0.8044004857810303, 3.496817587789341, 0.9440420262927697, 0.9437620183184142],
+        [0.7681891242761639, 1.787056566542655, 0.9370038866643842, 0.8320717614831266],
+        [1.313861785510159, 4.837434263532883, 0.9569968978816572, 1.244927014932357],
+        [0.8164541023843558, 5.018497834168232, 0.9484353357262416, 1.028936748261368],
+        [0.7470492689437811, 1.729262910673514, 0.9368561990930938, 0.8299947800264361],
+        [0.6540603821361174, 7.527193736979473, 0.9657923519977788, 1.579405674359183],
+        [0.6198429693876549, 5.205369013688697, 0.9489445739415692, 1.03975756482554],
+        [1.073797442836695, 2.648298553956084, 0.940791599190949, 0.8888802285191948],
+        [0.6084144345982954, 5.248130020802569, 0.9457135342014537, 0.9745433945935381],
+        [1.296938435975349, 4.932147738300079, 0.9481887148665527, 1.023772746344789],
+        [0.6186471429167045, 5.194216111127559, 0.9489844653827406, 1.040614343259369],
+        [1.196632800708615, 5.173739958550355, 0.9466223002046171, 0.9920876036944878],
+        [1.120122454431319, 5.173660433489718, 0.9465955558339892, 0.9915627620655442],
+        [1.615475053621072, 3.508861452458479, 0.9443731748843717, 0.9497132903971162],
+        [1.367861709665039, 4.890616364958, 0.9479905174119199, 1.01965817761262],
+        [1.005871114099322, 4.924681857067148, 0.9481300509393205, 1.022551610178904],
+        [0.7899007927794202, 5.057851009418735, 0.9485642898150984, 1.031656638189331],
+        [0.7999279166704165, 5.028238248973198, 0.9484675185037308, 1.029614270287688],
+        [0.3609891175111274, 5.475923588289561, 0.9403295194796233, 0.8815636644394751],
+        [1.108966836275959, 4.862299745997857, 0.9478969307171824, 1.017726202999714],
+        [0.7082580186568477, 1.765726228348504, 0.9398733344305992, 0.8744507507445941],
+        [0.7153497742341799, 5.087990069031143, 0.9486637177568508, 1.033763094428592],
+        [0.9688411219499461, 4.951233650443339, 0.9482176087678673, 1.02437521279264],
+        [1.98898153939553, 3.989645637035613, 0.9453638604629302, 0.9679482459360338],
+        [2.196530753677654, 4.789349875094986, 0.9475898620544625, 1.011435632497601],
+        [2.976898215029736, 4.897916523562285, 0.9478648254620164, 1.017065029964401],
+        [0.9888404298464679, 4.926536979368811, 0.9481307695528234, 1.022566551978044],
+        [0.7254086164991906, 4.406718870139403, 0.9557768194991647, 1.209037208170425],
+        [8.372573151441651, 5.25436292374592, 0.9488231552817872, 1.037157984924028],
+        [7.639070679430591, 5.18307653796193, 0.9486904494527552, 1.034330818141345],
+        [2.853881547193041, 4.40475897744442, 0.9470032976072057, 0.9996219652901267],
+        [1.900415814998416, 2.295265402879491, 0.9387564071370971, 0.8574827658217037],
+        [1.773713072634314, 4.865599201936117, 0.9478804387885216, 1.017386467807952],
+        [1.033836550428588, 4.902845814762556, 0.9482029635626121, 1.024069761761547],
+        [1.632058170979777, 4.79899579269979, 0.948063395089069, 1.021167463734884],
+        [0.9347137781151064, 4.954381420333664, 0.948233071082606, 1.024697893613521],
+        [1.93076507142766, 2.689494024399091, 0.9426174344479576, 0.9189431680376781],
+        [1.880023815569857, 4.813509078163882, 0.9476581761485309, 1.012828722917802],
+        [0.3520377111243649, 5.48447061875738, 0.9398756186777095, 0.8744860982272773],
+        [0.4726274094418975, 5.358018352969231, 0.9438970774175833, 0.9411791603157388],
+        [0.6691893106233268, 5.693245891307376, 0.9501789591442202, 1.066905021727599],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.5274691392595153, 5.311409907449688, 0.9492013653216488, 1.045296415328454],
+        [0.4130281355773057, 5.421810801978526, 0.9422664168665958, 0.9130159139807292],
+        [0.3334767190384045, 5.502562918261597, 0.9383702237474674, 0.8517590839780943],
+        [0.9832342350689622, 0.8793012301867492, 0.9348321177902622, 0.802478053248519],
+        [3.606674409945534, 5.195424496402555, 0.9470222708129752, 0.9999999999999846],
+        [0.7515946434111977, 5.098052642181032, 0.9486410651528525, 1.033282464448175],
+        [1.132915793898394, 4.903873760550092, 0.9480402571471422, 1.020687821603871],
+        [0.7107442288187383, 5.155034370852967, 0.9489075821109543, 1.038964259061035],
+        [3.009275538913979, 9.217563298586068, 0.9682069289600644, 1.703604790224069],
+        [0.4938177526840662, 9.356161822924273, 0.9680618466963327, 1.695611875337968],
+        [1.046037802776184, 4.925511689106543, 0.9481402270008261, 1.022763234918636],
+        [0.9219177432561133, 3.427574637405767, 0.9443087632424707, 0.9485501654238393],
+        [2.661917433861352, 4.896402102850412, 0.9479446624736299, 1.018710694539573],
+        [0.6179729632034782, 5.238113241498177, 0.9457505219380414, 0.9752459875146877],
+        [0.7219315838371045, 5.098759611687163, 0.9486922063369561, 1.034368151299844],
+        [0.3756397620002241, 5.460794731366979, 0.9409016589521507, 0.8906397845127727],
+        [5.256365685913773, 5.113423437050866, 0.9487579760189913, 1.035767575158955],
+        [1.039387840811315, 4.90010986106579, 0.9480316832684821, 1.020510196298972],
+        [0.6179729632034782, 5.238113241498177, 0.9457505219380414, 0.9752459875146877],
+        [1.033953011941588, 1.957230347926372, 0.937403629777787, 0.8377426515869405],
+        [0.8242846542377243, 4.988011640980946, 0.9483557895033018, 1.027265738939578],
+        [1.118840274751836, 3.195882263923888, 0.9426020412691172, 0.9186817202010104],
+        [0.4726274094418975, 5.358018352969231, 0.9438970774175833, 0.9411791603157388],
+        [1.467482535546186, 4.865368202349286, 0.9478810529247438, 1.017399115214401],
+        [0.8903809058092421, 4.915858812274692, 0.9482912251181895, 1.025913229592711],
+        [1.487715183315363, 4.835296314382185, 0.9477751149749448, 1.015221848743647],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.790715470434448, 4.026028001816698, 0.9459047609953662, 0.9781861606212654],
+        [0.6886126142282195, 5.126110369716036, 0.9487788915853211, 1.03621336229034],
+        [4.998747850948816, 4.522693828360886, 0.9470243548264055, 1.000041539767976],
+        [0.6790530064377419, 1.854438894210898, 0.9403999189715867, 0.8826710434470234],
+        [0.7206115198544857, 11.46061078923562, 0.9781400890511943, 2.503143900902291],
+        [0.7569563137281993, 5.095027127910775, 0.9486324051448792, 1.033098833363794],
+        [1.00172778034408, 4.906699034163544, 0.9480722841327697, 1.021351844414629],
+        [0.6463055944372494, 5.182499203288885, 0.9488817671112771, 1.038411325459357],
+        [0.9367996565205766, 4.917909000691235, 0.948112472552296, 1.022186239770032],
+        [0.4449849189562151, 4.917389096257407, 0.9482678638189046, 1.025424683572847],
+        [0.8615950784290014, 4.971204817882683, 0.9482981539380456, 1.026058214274022],
+        [0.5970187345273854, 5.225850474298216, 0.9490008589491372, 1.040966828784129],
+        [0.2775524204226806, 5.555578061255454, 0.9351087033455037, 0.8061368862012246],
+        [1.865159891333924, 4.873587052992843, 0.9479129148277767, 1.018055682395073],
+        [0.3895255745899861, 5.446295290623486, 0.941520464959143, 0.9006561108735835],
+        [1.861741161596287, 4.853792549646276, 0.9477503331001242, 1.014713798941042],
+        [0.4123697106611692, 5.422498581800581, 0.9422455904430185, 0.9126665049033978],
+        [1.126904710714616, 1.760455634432703, 0.9375089597850618, 0.8392489754508362],
+        [0.6084144345982954, 5.248130020802569, 0.9457135342014537, 0.9745433945935381],
+        [1.197045326898125, 4.886139479094295, 0.9480058168760033, 1.019974676416025],
+        [0.9931204095823027, 5.1733154634875, 0.9465648462399279, 0.9909607533764646],
+        [2.7293413135038, 4.853212095183247, 0.9477435035204452, 1.01457387136609],
+        [0.5607976921489601, 5.085391470174423, 0.948742341703665, 1.035434588390569],
+        [1.110993646120782, 4.883173745008576, 0.9479757757075332, 1.019353393238084],
+        [0.3002265476599614, 5.53620576719285, 0.9367648108796954, 0.8287144150329059],
+        [0.7140746725650921, 5.126271568494199, 0.9487240912994609, 1.035046139838443],
+        [0.6691090854876633, 5.137979696856703, 0.9488187043101135, 1.037062923745376],
+        [0.9931204095823027, 5.1733154634875, 0.9465648462399279, 0.9909607533764646],
+        [0.766315629009272, 5.026856904719276, 0.9485055281597217, 1.030415552351762],
+        [0.3756397620002241, 5.460794731366979, 0.9409016589521507, 0.8906397845127727],
+        [2.878289504374241, 4.833745270823453, 0.9476833064042582, 1.01334210524494],
+        [1.788087535154093, 4.750968910430047, 0.9476014136626718, 1.011670942682069],
+        [0.4726274094418975, 5.358018352969231, 0.9438970774175833, 0.9411791603157388],
+        [0.4958056478850861, 5.346259687885857, 0.9492794573908137, 1.046991940126977],
+        [0.5807971360759521, 2.093246999332637, 0.9388650924320739, 0.8591066461262886],
+        [1.011960343176487, 3.110459694884216, 0.9441544873974275, 0.9457752104773899],
+        [0.4820682664283337, 5.362851867975322, 0.9493153109943214, 1.047772138932521],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.7673734726191691, 5.068993102153763, 0.9485962885100033, 1.032333665509637],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.970865503760904, 4.561635108975969, 0.9476455875570549, 1.01257173769855],
+        [1.065746370858319, 4.86879140705642, 0.9479438910258174, 1.018694768685615],
+        [0.7789045550225083, 3.943771483080476, 0.945847758693738, 0.977097606420037],
+        [2.736543614525115, 4.750496802738914, 0.9474921775293867, 1.009449905204557],
+        [3.054470846909352, 4.863831809320702, 0.947813777864535, 1.016015434939526],
+        [1.558277120062742, 0.6603832587719871, 0.9231350816769086, 0.6718467680467405],
+        [3.193621533684921, 4.875792156125743, 0.9478239988929065, 1.016225426137545],
+        [1.067221892172477, 4.886186678777041, 0.9479998011102232, 1.019850206527252],
+        [2.423828405205988, 4.855192261473439, 0.947806640162796, 1.015868839510158],
+        [5.398676109276754, 5.844437154493444, 0.950370802777288, 1.07124542907697],
+        [1.467124601436491, 3.17661390119595, 0.9414611419135865, 0.8996866987913529],
+        [0.8375554672232373, 4.947458189402145, 0.9482513746526148, 1.025080117419424],
+        [0.5269227979754644, 5.312748887970139, 0.9491976770662949, 1.045216465319355],
+        [1.974446595056132, 3.834454555593899, 0.9455274075648651, 0.9710223456424559],
+        [0.7848087522552171, 5.050854934496508, 0.9485373311986381, 1.031086902137594],
+        [0.9182587669712949, 4.976525586245527, 0.9483060778288186, 1.026224068328266],
+        [1.35914373736259, 1.506384144617047, 0.9376634338920637, 0.8414673159660859],
+        [0.857454499464943, 4.966873140177799, 0.9482818497163257, 1.025717112337307],
+        [1.337606960655727, 3.963762301650914, 0.9460527353870154, 0.9810227158063488],
+        [1.720054261183574, 4.844114334617601, 0.9478474389957275, 1.016707314267405],
+        [0.688669063888385, 5.118901991189404, 0.9487616558956025, 1.035845980390561],
+        [1.172717163147534, 4.845356818884914, 0.9478592496351363, 1.016950284819375],
+        [0.9554596901085487, 4.959652578274347, 0.9482327876816997, 1.024691977626649],
+        [3.915337856908221, 4.814166020814148, 0.9476729181585128, 1.013129825500177],
+        [0.9447501290948002, 4.924796144776794, 0.9481274266718831, 1.022497048512803],
+        [4.377003279565214, 4.976801233638033, 0.9479843353201793, 1.019530341985428],
+        [0.6637212465566172, 1.749756598976189, 0.9399277586614567, 0.8752936671196181],
+        [0.5488170469519478, 5.289455143480807, 0.9491449844416541, 1.044075517938255],
+        [0.9931204095823027, 5.1733154634875, 0.9465648462399279, 0.9909607533764646],
+        [0.9188480769801068, 4.958268456099463, 0.9482429812326212, 1.024904808492543],
+        [0.3609891175111274, 5.475923588289561, 0.9403295194796233, 0.8815636644394751],
+        [6.887467377849182, 4.90313837687081, 0.9479275248419685, 1.018357014571456],
+        [0.3520377111243649, 5.48447061875738, 0.9398756186777095, 0.8744860982272773],
+        [2.554966774879567, 4.310741566008001, 0.9458369073271311, 0.9768906410462513],
+        [0.603741243153057, 5.223804563977486, 0.9489912843663768, 1.040760933805999],
+        [0.4844643463007494, 5.853851538734734, 0.9507062060007553, 1.078914996730227],
+        [1.377186527289517, 4.854956365678911, 0.9478726407091318, 1.017225901536166],
+        [0.6080614573496639, 5.214618879967872, 0.9490412075007719, 1.041835347349415],
+        [0.6693257019196837, 5.140047163947292, 0.9488222253747812, 1.037138123162518],
+        [1.127480686488415, 5.235223829860324, 0.9493689940043548, 1.048942383578967],
+        [1.041711042705988, 4.89060718066995, 0.9480161218835473, 1.020187960292516],
+        [0.7862342538935357, 5.049530519949831, 0.9485462011542865, 1.031274291462274],
+        [3.210669775435313, 4.854127296832574, 0.9477642991514178, 1.015000055751074],
+        [0.8760893796892568, 4.989187378393392, 0.9483341818780527, 1.026812721175351],
+        [1.320663090080028, 4.839304751706786, 0.9478037250294797, 1.015808979497724],
+        [0.9931204095823027, 5.1733154634875, 0.9465648462399279, 0.9909607533764646],
+        [0.9412861985396729, 4.930271938737741, 0.9481385974186377, 1.022729340003855],
+        [0.6323345635541804, 4.378390634461592, 0.9468352088776536, 0.9962846381362179],
+        [0.6973716758037485, 5.130036321375574, 0.9487863490554179, 1.036372396281349],
+        [0.4726274094418975, 5.358018352969231, 0.9438970774175833, 0.9411791603157388],
+        [0.5026110216314021, 5.330493067608087, 0.9444547474639117, 0.9511901735066696],
+        [0.7732945130150927, 2.482444351944839, 0.9398840890950602, 0.8746171967818005] 
+        ]
+      },
+     "I":{
+       "0":        [
+[11.46146118159072, 4.952490416699921, 0.948486916223055, 1.03759816423089],
+        [1.071772641949049, 4.821001170626288, 0.9459523958416894, 0.9862981847908403],
+        [1.385428962002997, 3.985973663125592, 0.9441503325960963, 0.9526556747888499],
+        [1.653044262340567, 4.332967185872019, 0.9470646214936081, 1.008205332515912],
+        [1.230808159710092, 3.010323460881172, 0.943987264246704, 0.9497181759830211],
+        [3.880482312932962, 2.578360433771973, 0.9408525033329892, 0.8963973744462581],
+        [15.162361038973, 8.448491267632797, 0.9564574382675219, 1.237847295779715],
+        [1.207932096317462, 5.177142102013347, 0.9499313128602296, 1.069156792296746],
+        [0.9973294031512127, 2.949037728588775, 0.9433926155927416, 0.9391496123549344],
+        [1.00467937441992, 4.764869832469153, 0.9481283948473075, 1.030037094954538],
+        [0.4722741430575994, 5.12100812820661, 0.9433067250912309, 0.9376414228832006],
+        [0.8615872998836474, 1.882722362056279, 0.9513425624857058, 1.101800824810455],
+        [0.7524587274043317, 4.860854562456507, 0.9483505958866107, 1.034710855765574],
+        [0.9094354881914869, 2.848332682550055, 0.9436760110995782, 0.9441585066560937],
+        [0.7106996464210575, 4.871043432787426, 0.9484372452072679, 1.036544348250979],
+        [0.5974586570313842, 2.040658154582071, 0.9411486414790361, 0.901191582660766],
+        [0.6403259809502163, 0.8993528380605442, 0.9324688036473039, 0.7781176509933421],
+        [0.730145357092338, 4.740168090601993, 0.9481678484201648, 1.030864032695932],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.5737457940723751, 2.095468244626383, 0.9413325539864517, 0.9041933220912677],
+        [0.3925088417215739, 1.254159272640489, 0.9263503311889781, 0.7087937222565933],
+        [0.3892608928284906, 5.201639267637476, 0.9408055211471683, 0.8956411842407972],
+        [2.1129028278395, 6.077133224193325, 0.948591036920471, 1.03981378830027],
+        [0.9178706642484592, 2.198525394129531, 0.942160937248614, 0.917950466164045],
+        [0.6605806596955763, 4.923212745475748, 0.9485274370730444, 1.038459357454423],
+        [0.6251310962271007, 4.971028404111886, 0.948616296214423, 1.040352643846016],
+        [0.8045276669164951, 4.776099166156027, 0.9482395421777373, 1.032369944010852],
+        [0.6895014263654845, 9.547242034256557, 0.9701066056008854, 1.82877227595582],
+        [1.26908862592832, 5.739169533828464, 0.9606261372824764, 1.374870443570357],
+        [0.7999797038565152, 1.08203631817199, 0.9348826644514254, 0.8090509725965301],
+        [0.7330714087195869, 4.661116165359767, 0.9459629132991684, 0.986501120180786],
+        [0.7094781823908041, 1.954334942790407, 0.9407099571896487, 0.8941067560785934],
+        [0.6039917301666647, 1.008873624176134, 0.933770947812723, 0.7945243603778165],
+        [1.049859177999405, 4.683953873135669, 0.9480174175050403, 1.027717766903131],
+        [0.6072723786647101, 5.014002908481183, 0.9452545691060467, 0.9730077656238423],
+        [1.29806304772884, 3.253354507357797, 0.9449635523692217, 0.9675648062408135],
+        [0.6184980705278929, 4.976384765761574, 0.9486250013240056, 1.040538472385216],
+        [1.188135205744903, 4.933188903399645, 0.9462250240755316, 0.9915842139905924],
+        [1.114248629504466, 4.934582807305748, 0.94620156645727, 0.991127284215643],
+        [1.598313891116214, 3.40945254856183, 0.9448687354219394, 0.9658038319333562],
+        [1.356208809315244, 4.180472142758505, 0.9469218614897736, 1.005342076088887],
+        [1.002029680855619, 4.690434471492025, 0.9480058934446487, 1.027477491699659],
+        [0.7881509963425595, 4.870637050537955, 0.9484087019435707, 1.035939694902439],
+        [0.7835813488929627, 0.9090066839772918, 0.9329253848965178, 0.7837979453106868],
+        [0.341495654067853, 1.160711990581367, 0.9229645024027525, 0.675164354529777],
+        [1.099202245348727, 3.68693035239658, 0.9459471290139622, 0.9861965905008809],
+        [0.6021814522352077, 12.22849927382059, 0.9730770275650458, 2.036758853430414],
+        [0.7147478663354253, 4.858209659297154, 0.9483960962389288, 1.035672871747487],
+        [0.9619109115265263, 7.129413043435391, 0.9533906532721355, 1.152691985235113],
+        [1.963656911121555, 2.836378761369816, 0.9429329520030594, 0.9311310408239769],
+        [2.182869388556909, 4.398878510000063, 0.9472185626039412, 1.01131019791968],
+        [2.948923425819546, 3.481879324356903, 0.9451598435537378, 0.9712297483242814],
+        [0.9859786085856554, 4.714341315201531, 0.9480876942633633, 1.02918533732291],
+        [0.761543464161875, 2.842953726110085, 0.9439013367374344, 0.9481771558058937],
+        [8.325513189616707, 4.468601796335007, 0.9473024175064068, 1.013009114098183],
+        [7.002876332591936, 6.46123999474155, 0.9533537460709356, 1.151735371254142],
+        [2.863164789701175, 4.056392322016757, 0.9453537042929755, 0.9748751538791869],
+        [1.870602647288632, 2.077793493643917, 0.9396744452266071, 0.8777917427987244],
+        [1.676989633747382, 2.850054769472214, 0.9426653691584337, 0.9265224172435657],
+        [1.030402647412888, 4.569712078902058, 0.9477425139943907, 1.022014951405511],
+        [1.621878810540166, 3.593490018399255, 0.9452332450555739, 0.9726069725441532],
+        [0.9218595707455075, 3.940587642594063, 0.9462459358306382, 0.9919918892477197],
+        [1.939752719887017, 3.045757360683949, 0.9440659253670345, 0.9511330321257108],
+        [1.831849602528972, 2.369633900652819, 0.9404130625246498, 0.8893710475560073],
+        [0.3517384923132557, 5.2331142530118, 0.9390921833829483, 0.8688615800318767],
+        [0.4722741430575994, 5.12100812820661, 0.9433067250912309, 0.9376414228832006],
+        [0.6687985565257644, 5.396374308705925, 0.9494374056150298, 1.058162551543922],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.5272314723333226, 5.080852277565593, 0.9487352466038398, 1.042897346188898],
+        [0.3931728099976786, 1.256274110314605, 0.926396048574894, 0.7092689752500605],
+        [0.3331205235530126, 5.246035110691261, 0.9375430289284112, 0.8459129814447948],
+        [1.01595940294443, 4.758529700046015, 0.9481282480000467, 1.030034019419739],
+        [3.590568726961501, 4.96855545010644, 0.9466534403164042, 0.9999999999999979],
+        [0.7503292502573533, 4.873101594442099, 0.9483784775149477, 1.035300157078575],
+        [1.126207798041573, 4.516434603771893, 0.9476798800435532, 1.020724005743151],
+        [0.7024602195872939, 5.015825380482945, 0.9487097250992291, 1.042350370814001],
+        [3.234209268840915, 5.734903333060923, 0.9595766351835208, 1.337711939042704],
+        [0.5631421609224342, 1.955968743069544, 0.9407989812293209, 0.8955360177674426],
+        [1.041687013628743, 3.279045518939768, 0.9450742358762489, 0.9696281510469285],
+        [0.9197380534695369, 3.508988406241409, 0.9454549304889212, 0.9767889342179712],
+        [2.558928961122547, 3.73714823450073, 0.9455995916126994, 0.9795362562849177],
+        [0.6170104985562824, 5.007989256130866, 0.9453095176845963, 0.9740419839519132],
+        [0.7200168976108724, 4.616600643281179, 0.9479263508199488, 1.025821938335254],
+        [0.3752401757055903, 5.207777335313542, 0.9401456861349451, 0.8851463859031975],
+        [5.159604606316393, 5.849170546928915, 0.9507988911390483, 1.089003248732485],
+        [0.9659373316048362, 4.01855320845768, 0.9557620577717615, 1.217503639410429],
+        [0.6170104985562824, 5.007989256130866, 0.9453095176845963, 0.9740419839519132],
+        [1.010273382270463, 3.921294200775695, 0.9443534499704782, 0.9563386910653072],
+        [0.8233311383768986, 4.787271379097409, 0.9482558560519545, 1.032713196103474],
+        [1.108624975097808, 2.182951649083833, 0.9413621958910556, 0.904678886251898],
+        [0.4722741430575994, 5.12100812820661, 0.9433067250912309, 0.9376414228832006],
+        [1.458957469506588, 4.672926061493391, 0.9479663835278364, 1.026654522875784],
+        [0.8873229300596907, 4.673839157019242, 0.9479973922370311, 1.027300310850124],
+        [1.475662119176816, 2.779422054144133, 0.9425464625723153, 0.9244882459749313],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.7870203712223043, 3.582619290931206, 0.9449807958689131, 0.9678857109682072],
+        [0.6872875935935951, 4.733194771761116, 0.9481609724992193, 1.030719824417667],
+        [4.251917396434731, 8.959081393934564, 0.9548406017998344, 1.191511206865394],
+        [0.6807761611921748, 2.394552982145845, 0.9426647520446871, 0.926511838309641],
+        [0.8742041687306267, 1.620480677552391, 0.9396190142820334, 0.8769341795602424],
+        [0.7555496839469416, 4.866199216430275, 0.9483641802267871, 1.034997892550165],
+        [0.9980978408133264, 4.647315057866687, 0.947942207428346, 1.026151564698365],
+        [0.6280838848982235, 0.8946630213968363, 0.9323215685988495, 0.7763022528993285],
+        [0.9355538052642756, 4.72689206447194, 0.9481037974260187, 1.029522175012714],
+        [0.4405663869123416, 3.938145330278552, 0.946073904231852, 0.9886475267797034],
+        [0.8604698875852231, 4.743540608632365, 0.9481705053835868, 1.03091976727994],
+        [0.5964153118302554, 4.983321337174387, 0.9485727169083363, 1.039423299366113],
+        [0.2772879419605842, 5.294809467795244, 0.9341893558941677, 0.799934030494499],
+        [1.835283813960157, 4.31590539164916, 0.9471358255135551, 1.009639211287557],
+        [0.3892608928284906, 5.201639267637476, 0.9408055211471683, 0.8956411842407972],
+        [1.855428235521041, 4.849865367019945, 0.9483403624328196, 1.034494722825096],
+        [0.3925088417215739, 1.254159272640489, 0.9263503311889781, 0.7087937222565933],
+        [1.117733573428163, 4.374559511449211, 0.9473313745114883, 1.013597045104866],
+        [0.6072723786647101, 5.014002908481183, 0.9452545691060467, 0.9730077656238423],
+        [1.197800905862737, 4.195138965676499, 0.9468823124284039, 1.004551585440371],
+        [0.9877552784018112, 4.933331073315858, 0.9461682866397789, 0.9904797115596821],
+        [2.432070666213958, 2.462340293881835, 0.9485485464307589, 1.038908533902982],
+        [0.5595111185170817, 4.605803851192089, 0.947808871249475, 1.023386018190329],
+        [1.092931861263422, 3.584573204340237, 0.9452844982818741, 0.9735708220155753],
+        [0.2998607087450406, 5.273588365485377, 0.9358749283889446, 0.8224421302274817],
+        [0.7124249357297771, 4.885178603961408, 0.9483905337556694, 1.035555172904857],
+        [0.6688521853954299, 4.935514572454005, 0.9485679287158887, 1.039321285454364],
+        [0.9877552784018112, 4.933331073315858, 0.9461682866397789, 0.9904797115596821],
+        [0.75920004370789, 6.369759344366289, 0.949838335931846, 1.067070609043195],
+        [0.3752401757055903, 5.207777335313542, 0.9401456861349451, 0.8851463859031975],
+        [2.835443594860283, 5.090923414620454, 0.9480767338131736, 1.028956191750715],
+        [1.769331473624417, 3.934286323418441, 0.9461032529129511, 0.989216566334316],
+        [0.4722741430575994, 5.12100812820661, 0.9433067250912309, 0.9376414228832006],
+        [0.4956834814552514, 5.118688611520881, 0.9487883895182, 1.044038051492614],
+        [0.5801320075419037, 1.953952801003404, 0.9408208467021374, 0.8958877209876652],
+        [1.014866294354775, 3.785566913601912, 0.9461870048981031, 0.9908438407276108],
+        [0.4766365253924209, 3.866618717951998, 0.9462689478079611, 0.9924408751307832],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.7656131828048229, 4.818243572402765, 0.9483059165982936, 1.033767847516667],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.9690208203883477, 4.25170496903247, 0.9471113219689712, 1.009145332759513],
+        [1.062072155471438, 4.610743697746482, 0.9478133108048754, 1.023477872268783],
+        [0.7769770569538715, 3.742037919612363, 0.9460438997318469, 0.9880664115440899],
+        [2.721226817885293, 3.862904350259702, 0.9458864587328878, 0.9850277192297404],
+        [3.036600883531536, 4.631223770068938, 0.9476755976780825, 1.02063585497101],
+        [1.577633326854913, 4.686112121627714, 0.947975065403764, 1.026835254195603],
+        [2.975896267506322, 2.690067852807049, 0.9476988233985569, 1.02111412025638],
+        [1.062397261268976, 4.628082366982285, 0.9478912604718938, 1.025093195170246],
+        [2.43269138603567, 4.034311335343268, 0.9465203411586486, 0.997370969275262],
+        [5.407973696459128, 5.433356459649112, 0.9497562972649196, 1.065236266572636],
+        [1.42221773070166, 4.577457558015826, 0.9477024939767709, 1.021189743873198],
+        [0.8365810081897462, 4.700641322654179, 0.9480809680423635, 1.029044703550428],
+        [0.5266625263466564, 5.080633083389873, 0.9487297028942566, 1.042778487437503],
+        [1.946273083560351, 4.836056841197068, 0.9484109170978077, 1.035986596226966],
+        [0.7704016930554718, 0.9611392368769202, 0.933515660737951, 0.7912571557946761],
+        [0.9149292162541806, 4.765808767355684, 0.9482224755438324, 1.032011084979463],
+        [1.411479326713969, 4.605859822137775, 0.9477426014737116, 1.022016756602098],
+        [0.8560292875770136, 4.737975859931984, 0.9481482497669469, 1.030453092171725],
+        [1.334283866137467, 4.004643945805792, 0.9465429799454262, 0.9978172161370678],
+        [1.546685829063326, 5.406490505177601, 0.9565629703950802, 1.240991610422404],
+        [0.6882872910316966, 4.919139711592448, 0.9485034248403302, 1.037948859738615],
+        [1.166329000831224, 4.569203086737788, 0.9477197003124328, 1.021544381443889],
+        [0.9536509434432917, 4.74045539567757, 0.9481192354404937, 1.02984529579792],
+        [3.87478254461864, 5.294835358826284, 0.9497225588978937, 1.064483631149827],
+        [0.8859687335835301, 1.748187670691796, 0.9504816199693442, 1.081664792810482],
+        [4.363127422999082, 4.737526503049491, 0.9478858515834367, 1.024980952701213],
+        [0.6657561921974422, 2.503959676880555, 0.94307971262184, 0.9336771231486189],
+        [0.5484397111268129, 5.056764712829757, 0.9486942683129964, 1.042019366474231],
+        [0.9877552784018112, 4.933331073315858, 0.9461682866397789, 0.9904797115596821],
+        [0.9137941020092655, 4.62897927904883, 0.9479161639561984, 1.025610280221749],
+        [0.341495654067853, 1.160711990581367, 0.9229645024027525, 0.675164354529777],
+        [6.7040880724791, 4.223665668507881, 0.9471940967681874, 1.010815532254845],
+        [0.3517384923132557, 5.2331142530118, 0.9390921833829483, 0.8688615800318767],
+        [2.497700222237493, 4.424827815254731, 0.9471946841966105, 1.010827403881656],
+        [0.6073151757056681, 6.762538450222815, 0.953069236712617, 1.14441155287531],
+        [0.4834013850390196, 4.998982926302263, 0.9485632896223628, 1.039222466255805],
+        [1.371269807494313, 3.550280490918559, 0.9455624424398149, 0.9788293468848129],
+        [0.6032881785188227, 3.403796122804411, 0.945390785245097, 0.9755753821112478],
+        [0.6670418467790868, 3.482609259839849, 0.9446063981121022, 0.9609630234554112],
+        [1.131825508618991, 4.163815681585556, 0.9469829750401709, 1.006565908293184],
+        [1.03534163458143, 3.652166398869652, 0.9452677146380082, 0.9732549961561493],
+        [0.7841257898782931, 3.69139376815326, 0.9461780083715441, 0.9906687982962767],
+        [3.205342997667231, 3.543390607059544, 0.9447961600410124, 0.9644600231323538],
+        [0.7979827225341964, 4.148058368597858, 0.9583016367831416, 1.295086038201374],
+        [1.3171612037419, 4.621509741854369, 0.9478300056752408, 1.023823427853106],
+        [0.9877552784018112, 4.933331073315858, 0.9461682866397789, 0.9904797115596821],
+        [0.9393158031181599, 4.699134827294165, 0.9480501696431992, 1.028401226855003],
+        [0.6281768961017737, 3.248581244563172, 0.9446933643826299, 0.9625626897702464],
+        [0.6955701352610011, 4.552062706528575, 0.9478032127099941, 1.023268966069395],
+        [0.4722741430575994, 5.12100812820661, 0.9433067250912309, 0.9376414228832006],
+        [0.502157508821901, 5.095232763680567, 0.9439005383137919, 0.9481628590473909],
+        [0.7709958965712405, 1.768407662745674, 0.9402473487602974, 0.8867482441588289] 
+        ]
+      },
+     "K":{
+       "0":        [
+[6.996444034174777, 19.07139331789474, 0.9807335606804221, 2.918983201076514],
+        [0.9971299318258502, 2.97245016829589, 0.9402775511914476, 0.9028185591124578],
+        [1.459492245925321, 4.706045897687489, 0.9450432449652545, 0.9860810620145349],
+        [1.583610554161911, 5.734349766707375, 0.9489754159137922, 1.066491763869161],
+        [1.218061173738084, 4.354687951056145, 0.9475154330360949, 1.035229624970286],
+        [4.090341443270333, 4.259792020593995, 0.9460534970276718, 1.005621189121199],
+        [17.29328791899241, 6.236373959276283, 0.9491427335692096, 1.070189120146345],
+        [1.173561577009271, 3.286153902337215, 0.9438874288031336, 0.9645884336354423],
+        [1.001291308154041, 4.111017879109648, 0.9454634703774788, 0.9941210564697612],
+        [0.9952164307121733, 4.70295441497592, 0.9468705868455654, 1.021968770198534],
+        [0.4650275272405981, 4.009516135430544, 0.9403853017144335, 0.9045540024844659],
+        [0.8972687725465853, 2.834979072512327, 0.9426055764048756, 0.9417645171455998],
+        [0.7488960814114459, 4.813395750012112, 0.9472254057222319, 1.029225297139604],
+        [0.8950563242766922, 3.560819534519849, 0.941996335906542, 0.931270406119139],
+        [0.7093929098219942, 4.827449036229275, 0.9472810757856563, 1.030372690390386],
+        [0.604374982414605, 4.660855752475618, 0.947054832412679, 1.025724702181721],
+        [0.6479305196972547, 2.863261761126529, 0.9430547795388502, 0.9496458163939403],
+        [0.7288975815374445, 4.794395018655606, 0.9471743643538151, 1.028175429155644],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.582407719556853, 4.965792332945706, 0.9477351376555442, 1.039822448688779],
+        [0.4030099434062097, 3.523986656901931, 0.937315559866728, 0.8574485943968269],
+        [0.3891642838591853, 5.160171244087421, 0.9404425646690597, 0.9054788421162547],
+        [2.227223402544, 3.597490359111336, 0.939791097998479, 0.895061005928251],
+        [0.9115656100669045, 1.753389446464144, 0.9391298602162163, 0.8847149535736063],
+        [0.6594465449308847, 4.881747417541142, 0.9475022785176151, 1.034955855572841],
+        [0.6207983042809743, 3.513234146686183, 0.9429626484702318, 0.948019251120369],
+        [0.8016361635069207, 4.658143970447155, 0.9466547388935506, 1.017601610376616],
+        [0.7700405321905059, 3.109785847712132, 0.941712722902785, 0.9264600308224934],
+        [1.422812144806481, 5.682984960435661, 0.94850578687604, 1.056242349296098],
+        [0.8041921959022673, 3.096003457179657, 0.943423151494959, 0.9562023236589924],
+        [0.7486906836930988, 2.938166700581276, 0.9414493549771364, 0.9220347641278263],
+        [0.7086594325514279, 1.615851653497881, 0.9349380114920316, 0.8240195243218732],
+        [0.6106859100377261, 3.062742848963264, 0.943616929821506, 0.9596856947702747],
+        [1.028272254423641, 2.079083275192675, 0.9374952971603265, 0.8600791517158866],
+        [0.6044787057890848, 4.96509809239094, 0.944440241115365, 0.9747565194486006],
+        [1.307037578614543, 0.7249865846524752, 0.9207357467917909, 0.6661003315596248],
+        [0.6064432224899355, 1.053488139422221, 0.9288395562899233, 0.7484866736891138],
+        [1.178620989534499, 4.881582006591117, 0.9452856402603087, 0.9907036352480939],
+        [1.103958505050634, 4.881794705442285, 0.9452581530373096, 0.9901773852399434],
+        [1.614843678930832, 3.963667731714484, 0.9455379912435532, 0.9955597846720343],
+        [1.134518611090373, 5.068430542107373, 0.9584063579302868, 1.321310095911475],
+        [0.9895122679322116, 1.870747444801736, 0.9353174331222982, 0.8291895121950172],
+        [0.7734414980407961, 1.479163666316061, 0.929381062815633, 0.7546657831353788],
+        [0.7881898087101306, 2.79466953454856, 0.9427013455285184, 0.9434344284646398],
+        [0.3542141794599185, 3.993011399715719, 0.936482400836091, 0.8454492892454594],
+        [1.002034809462301, 4.419688972588395, 0.9570625480761905, 1.278162498234735],
+        [0.7034872684084507, 2.424796660999156, 0.9408461370909598, 0.9120476173276344],
+        [0.7036853749707825, 1.16784612278954, 0.9283677782915634, 0.7431793859695114],
+        [0.9095777315329564, 4.483751803178806, 0.9453756317467165, 0.9924302509810734],
+        [1.814462627370453, 1.661217896139969, 0.9394355175614737, 0.8894693407399155],
+        [2.13515705752881, 1.521337184541983, 0.9328918561511645, 0.7971464062884768],
+        [2.374949018295513, 2.665142596391023, 0.9521823131020151, 1.141861850937393],
+        [0.9791197796400556, 4.640293924785365, 0.9465876399074659, 1.016251216805363],
+        [0.6744387888368704, 12.30671243802577, 0.9731446527215718, 2.077919148842968],
+        [6.807863840491892, 5.818887589077413, 0.9604566132194832, 1.392790853305601],
+        [4.7297163279455, 8.936034364226485, 0.962319980630551, 1.464503463984432],
+        [2.38542823470309, 4.548316062476677, 0.9547532568987235, 1.21000131483758],
+        [1.832957320200456, 4.031138478487494, 0.9454659183752089, 0.9941682559836499],
+        [1.773453188913394, 3.421337101639771, 0.9420368467972424, 0.9319613557315266],
+        [1.019179569014044, 4.456640803646596, 0.9463718558224752, 1.011931384465926],
+        [1.44235075192608, 2.813505133899921, 0.9508065852123146, 1.10832525141488],
+        [0.9243663778185232, 4.51302168355528, 0.9464177283662345, 1.012846805634764],
+        [1.916402463759158, 2.592353541965976, 0.9413204046861622, 0.9198825496425247],
+        [1.733609323285938, 3.498140881543613, 0.9422832327471156, 0.9361845781553479],
+        [0.3518299596566422, 5.19556173377958, 0.9388410189012255, 0.8802658062117308],
+        [0.4650275272405981, 4.009516135430544, 0.9403853017144335, 0.9045540024844659],
+        [0.6663549175983222, 4.89497540463516, 0.9475429505769559, 1.035802758953654],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.5095790808016799, 0.9486186812803051, 0.927808372430282, 0.7369762146517209],
+        [0.4036678068082355, 3.525416606061957, 0.9373425651657726, 0.857842868857106],
+        [0.3139859649473448, 1.144905418940013, 0.9170297467907739, 0.6337865604146029],
+        [1.017083695177391, 4.23072115467849, 0.9455186559412982, 0.9951861118480222],
+        [3.569659523075103, 4.918547349168867, 0.9457666994276823, 0.9999999999999978],
+        [0.7467923730100269, 4.82551538780304, 0.9472541842148661, 1.029818136654514],
+        [1.073500840159629, 3.14630428582394, 0.9458985935371996, 1.002577702698505],
+        [0.7034253564612701, 5.043080303138453, 0.9477760551815496, 1.040682079354736],
+        [4.228914848706168, 3.762167206170898, 0.9420085468625727, 0.9314785733019229],
+        [0.5721588772591082, 4.963327931048383, 0.9477314044152011, 1.039744084557074],
+        [1.078814016971928, 0.9977022945021481, 0.9217433891438539, 0.6754154852071088],
+        [0.9106946990045706, 3.22654496395992, 0.9435276105063168, 0.9580771153155008],
+        [2.623335464880979, 4.031446011229225, 0.9452013685207767, 0.9890919028276944],
+        [0.6139825683879583, 4.958723980840657, 0.944485462700794, 0.9755972575409712],
+        [0.6763966166272112, 2.880004259295387, 0.9490494749229683, 1.068125311407329],
+        [0.3752762086112825, 5.171041025156913, 0.939833043623571, 0.8957249781927153],
+        [5.315928672683273, 4.652908042651899, 0.9469658549636721, 1.023907596992976],
+        [1.016399412716199, 3.279408279287612, 0.9435118431145227, 0.9577936836897766],
+        [0.6139825683879583, 4.958723980840657, 0.944485462700794, 0.9755972575409712],
+        [1.029373164825984, 4.239928177706246, 0.9453915945210439, 0.9927371139400143],
+        [0.8210006720985367, 4.321481241366081, 0.9455459657460451, 0.9957139766926554],
+        [1.073730238707075, 5.61260985765032, 0.9519650301129184, 1.136437326652711],
+        [0.4650275272405981, 4.009516135430544, 0.9403853017144335, 0.9045540024844659],
+        [1.391293037415146, 1.9745748785751, 0.9361214067284954, 0.8403473801907061],
+        [0.8830605544921319, 4.519366758284479, 0.9462499406343806, 1.009506069682642],
+        [1.467455487251931, 5.441223878882909, 0.9483770726805657, 1.053465787076802],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.7767423245004127, 0.5359432190748366, 0.914071996027472, 0.6099969980123906],
+        [0.6487963696922142, 2.557671244129931, 0.9471325411891334, 1.02731668114836],
+        [5.303089907429725, 3.185036951500786, 0.9404150107447751, 0.9050336037044185],
+        [0.6776841567472639, 1.969828759748566, 0.9402183699511703, 0.9018680402917266],
+        [0.8791325533519789, 4.538423033481403, 0.9462904981693112, 1.010311677173725],
+        [0.7518227970836275, 4.814901854497425, 0.9472263808442323, 1.029245374156783],
+        [0.9803852376154971, 1.891587907305454, 0.9356135767309397, 0.8332670954317046],
+        [0.6357755334970814, 2.84610267511309, 0.9430255292710182, 0.9491288357460388],
+        [0.9301828418629677, 4.686140207603795, 0.9467463748646038, 1.019451317554267],
+        [0.4204453727942086, 0.6191719665053108, 0.920798412462606, 0.6666727326487751],
+        [0.8556045771878803, 4.041694990439825, 0.9443933680254128, 0.9738865206400957],
+        [0.5954513660844727, 4.944678367702205, 0.9476767899118299, 1.038598954551321],
+        [0.2775077488471633, 5.259450034244018, 0.9341605387197108, 0.8136118521312431],
+        [1.197033808500916, 16.05296815119095, 0.9786669911986413, 2.630660752478421],
+        [0.3891642838591853, 5.160171244087421, 0.9404425646690597, 0.9054788421162547],
+        [1.759323005036529, 2.458842682139084, 0.941754538134267, 0.9271663169265709],
+        [0.4030099434062097, 3.523986656901931, 0.937315559866728, 0.8574485943968269],
+        [1.113952013727958, 4.511789241222067, 0.9461437761607454, 1.00740303526268],
+        [0.6044787057890848, 4.96509809239094, 0.944440241115365, 0.9747565194486006],
+        [1.209592115644821, 2.160925158390705, 0.9360619207256919, 0.8395121967491026],
+        [0.9784548251441011, 4.880364912565138, 0.9452219090012612, 0.9894842910921884],
+        [2.66562636834016, 3.040408140841016, 0.9427582286496039, 0.9444289356990033],
+        [0.5608212854128864, 5.001920486494367, 0.9478540173264478, 1.04232370930389],
+        [1.104044602620665, 2.816805099526826, 0.9391171143492649, 0.8845177331574994],
+        [0.3001390958632848, 5.242025728615135, 0.9357904903648233, 0.8357209547867934],
+        [0.7098019076195229, 4.842870718213386, 0.9473289653068204, 1.031361662679289],
+        [0.6676860224953013, 4.905179892459593, 0.9475478189233941, 1.035904219239691],
+        [0.9784548251441011, 4.880364912565138, 0.9452219090012612, 0.9894842910921884],
+        [0.6813544636326393, 4.545355299210466, 0.9562341987164854, 1.25288556355723],
+        [0.3752762086112825, 5.171041025156913, 0.939833043623571, 0.8957249781927153],
+        [2.753975577849071, 6.169235196544467, 0.9505092060061557, 1.101321008112408],
+        [1.712823905238584, 4.172451059344828, 0.9478174491167602, 1.041553090583787],
+        [0.4650275272405981, 4.009516135430544, 0.9403853017144335, 0.9045540024844659],
+        [0.4952614953235654, 5.071394065593974, 0.9480773850765086, 1.047054405676616],
+        [0.5891036602223507, 4.96031425036263, 0.9477184050257815, 1.03947130280653],
+        [1.007014140747837, 3.527822632963852, 0.944204613790376, 0.9703978992217365],
+        [0.4305989546797459, 2.038862484747644, 0.9466702020787018, 1.017913294865726],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.7562211682158485, 1.27538426262111, 0.9287804990869051, 0.7478184569990054],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.9586920182987394, 4.04886816991691, 0.9455401595135211, 0.9956017050656109],
+        [1.055169637296099, 4.580581601136485, 0.9464251539648803, 1.012995136467898],
+        [0.7780365919908763, 4.63736866440776, 0.9468113139900221, 1.020765997428229],
+        [1.800094936166726, 16.05010662674107, 0.9768729185503141, 2.42214008798458],
+        [2.653867475415638, 3.774319033251165, 0.9479298745492274, 1.043925734993834],
+        [1.559046765629353, 4.515273230851101, 0.9461965089599954, 1.008446593013976],
+        [3.209177850745748, 2.719348113098127, 0.9418331624905021, 0.9284970825526919],
+        [1.049929558142319, 1.269579037913069, 0.9296322928606797, 0.7575648552350552],
+        [2.254151005312019, 4.621808852998188, 0.9510463660651759, 1.114034837321007],
+        [5.573902397766352, 4.95393510874502, 0.946895114667181, 1.022467277475349],
+        [1.405424880682471, 4.589573531868123, 0.9465109185593445, 1.014711321003954],
+        [0.8349571073793983, 5.19217286932533, 0.9477547895061939, 1.040235143661249],
+        [0.5098039001307715, 1.039685838280613, 0.9282091588427722, 0.7414106582150291],
+        [1.94442048647598, 3.961014818070649, 0.9449569605965414, 0.9844454109716522],
+        [0.7743716050828485, 3.285539095214837, 0.9440006177516956, 0.9666540165732278],
+        [0.9109398886357778, 4.730017054393489, 0.9469140611605033, 1.022852664315628],
+        [1.39651650100636, 4.536359038322596, 0.9463461712940459, 1.011419513935152],
+        [0.8459535573046081, 1.301575208944094, 0.9303401707426335, 0.7658458889806045],
+        [1.319851724773132, 3.825484260549345, 0.9448698785903763, 0.9827998306429787],
+        [1.695444890659775, 4.311995619441152, 0.9458073681535294, 1.000793480585081],
+        [0.6865314200551462, 4.831252545332764, 0.9473082949140886, 1.030934575393029],
+        [1.167326967531706, 2.937011365475898, 0.9400800988460032, 0.8996545653456478],
+        [0.947239806609655, 4.689949853249775, 0.9467936158949495, 1.020407384836673],
+        [3.699165753479382, 5.673088633996419, 0.9506428588477761, 1.104458523007284],
+        [0.9145428360398538, 5.123536692741963, 0.9485379100101314, 1.056937460169412],
+        [4.177710210873647, 2.663861886375288, 0.9406332510837114, 0.9085714333199798],
+        [0.6626827436212014, 1.91904267262099, 0.9400093374128654, 0.8985257474374763],
+        [0.530733220954086, 1.004311658263858, 0.9281824367542494, 0.7411134555438502],
+        [0.9784548251441011, 4.880364912565138, 0.9452219090012612, 0.9894842910921884],
+        [0.8321345398296051, 10.90103569699965, 0.9707262548729477, 1.901518285958068],
+        [0.3542141794599185, 3.993011399715719, 0.936482400836091, 0.8454492892454594],
+        [6.908873620061615, 4.079083465513297, 0.9436621638120798, 0.9605022734517736],
+        [0.3518299596566422, 5.19556173377958, 0.9388410189012255, 0.8802658062117308],
+        [2.476933212985246, 1.599577702421835, 0.9329213294507824, 0.7975218554191913],
+        [0.6014133273584322, 4.83495761549967, 0.9474361262481278, 1.033581184013517],
+        [0.482894055732212, 5.010108659452539, 0.9479028489385403, 1.043354447212769],
+        [1.148125267997062, 4.129707472071327, 0.9604304512635666, 1.391832077057014],
+        [0.5743554219185725, 0.9540031773289316, 0.9338230731874504, 0.8091704655554564],
+        [0.666275127346375, 4.402818523350643, 0.9464525683501853, 1.013543111730093],
+        [1.011585530760189, 8.564286892052234, 0.965697301915566, 1.614339058825456],
+        [1.029048546048537, 5.231190026264694, 0.9479396819989818, 1.044133198956422],
+        [0.7536269025671334, 0.8281499808879826, 0.9318133561622413, 0.7836310462084598],
+        [3.192068444021558, 4.086906919211811, 0.9454523405510225, 0.993906517203476],
+        [0.8603782933053091, 3.021869118898455, 0.9430848440715074, 0.9501777424519969],
+        [1.305886203958196, 4.583200966696833, 0.9464401650050086, 1.013295116703178],
+        [0.9784548251441011, 4.880364912565138, 0.9452219090012612, 0.9894842910921884],
+        [0.9340158439199034, 4.644532037936963, 0.9466157331713257, 1.016816191719609],
+        [0.6120967563594245, 0.5933640697998882, 0.9182150293585722, 0.6438028759452694],
+        [0.6616837693851515, 1.965727302611965, 0.9420731396191535, 0.9325811831184256],
+        [0.4650275272405981, 4.009516135430544, 0.9403853017144335, 0.9045540024844659],
+        [0.5011170667787278, 5.049219494285906, 0.9432611114860252, 0.953307749373297],
+        [0.7764928558521266, 4.716399133487616, 0.9468878388119117, 1.022319353823484] 
+        ]
+      },
+     "L":{
+       "0":        [
+[11.54646328911608, 5.018922604316717, 0.9484393299997791, 1.038444358351164],
+        [1.086740298192068, 4.95248468507619, 0.9461139101903149, 0.9911947325574313],
+        [1.431668132953285, 4.462233100222655, 0.9452103765163361, 0.9739180010221951],
+        [1.656469985998044, 4.698317334582784, 0.9477683497126733, 1.024379036011853],
+        [1.244737497654135, 4.596937905819748, 0.9475201153138323, 1.019266603692701],
+        [4.181468139054959, 4.437220570985491, 0.9468780887634076, 1.00626554698232],
+        [15.82151298965545, 3.336434286601816, 0.9437514893182569, 0.9471938081322759],
+        [1.223507243955961, 3.942617654546245, 0.9459657117382352, 0.9883213742232521],
+        [1.0037188592795, 3.813748848827779, 0.9457297154746239, 0.9837781327351841],
+        [1.001534522771721, 4.846988805706464, 0.9483062016917297, 1.035624640559037],
+        [0.4683549692351834, 4.680698788736254, 0.942384914063441, 0.9233882406422014],
+        [0.9046579465044864, 3.934072463955587, 0.9461794979939968, 0.9924714385635665],
+        [0.7310190261461327, 1.075448845917173, 0.9342755912918607, 0.8024916890360344],
+        [0.9107210734766427, 4.225116921898378, 0.9469143203755166, 1.006990865579522],
+        [0.7059631663312461, 2.846135428485704, 0.9438907890079564, 0.9496855163682263],
+        [0.6064584244397497, 4.886054433038204, 0.9483183575648133, 1.035881504791497],
+        [0.5555175344169907, 8.717652571333121, 0.9682405965068054, 1.721088406930926],
+        [0.7308348719091604, 4.858511377148546, 0.9482350685192044, 1.034123952871479],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.5829987703595328, 5.005362168521907, 0.9485506758604939, 1.040813920363807],
+        [0.3967750108418744, 2.119357068311833, 0.9324738971403984, 0.7795737835814369],
+        [0.3884895800278157, 5.232493389258639, 0.9409273716798918, 0.8992118807331206],
+        [2.187162011603314, 4.240610609862539, 0.9465821245356474, 1.000377501613714],
+        [0.8569415279332478, 2.133561891717687, 0.9523641164320975, 1.128654524072821],
+        [0.6602887231922738, 4.925163888243695, 0.9484099398505734, 1.037820609968072],
+        [0.6248049374983614, 4.961648767117164, 0.9484998186634381, 1.039730352249377],
+        [0.8019075922696435, 3.99725701589157, 0.9463928185867111, 0.9966454563221003],
+        [0.7752498316469058, 4.457331971569972, 0.9471111704477777, 1.010948962906998],
+        [1.422223293437268, 3.726452368364442, 0.945133865418356, 0.972481142585629],
+        [0.8041296112531194, 1.85101064027157, 0.9401980001413579, 0.8875561625420038],
+        [0.754548366224579, 4.825380907720758, 0.9481513372117671, 1.032362760087767],
+        [0.7140544677723547, 4.034538618288908, 0.946548273505649, 0.9997082094083674],
+        [0.6076611756243119, 1.692851287526004, 0.9394705651692997, 0.8762111735689211],
+        [1.053491946322834, 3.821805173963059, 0.945971923449011, 0.9884414939989993],
+        [0.6063625406584043, 5.030177782318238, 0.945226639317594, 0.9742239294808542],
+        [1.293622813455904, 4.646943423050799, 0.9476589078086686, 1.02211908336303],
+        [0.6182281256938921, 4.971128132482454, 0.948522362318998, 1.040210405264275],
+        [1.189802580400354, 4.95071733269745, 0.9461600833698822, 0.9920931971378176],
+        [1.113761010994887, 4.950778406768084, 0.9461339825703896, 0.9915851233464601],
+        [1.628400942481138, 3.942167907096889, 0.9461499451866341, 0.9918957904613813],
+        [1.360914771714275, 4.61846626271704, 0.9475772135239547, 1.020438264085171],
+        [1.00264241765279, 4.706740648584343, 0.9478197712510275, 1.025444153626326],
+        [0.7728254049966297, 4.86406002900654, 0.9484481035554254, 1.038630697739161],
+        [0.7879999703170898, 1.537231845334035, 0.9388682679133999, 0.8670221409578088],
+        [0.3599690382446046, 5.263283051514461, 0.9397199297273854, 0.8800693900086873],
+        [1.105355230722481, 4.615740033032512, 0.9475700071044726, 1.020290246993609],
+        [0.6856382069857941, 1.992516741313701, 0.9375963360467334, 0.8481995551417462],
+        [0.7147267889990488, 4.875410160288101, 0.9482776504682415, 1.035021803055095],
+        [0.9674793367245391, 4.512565185482422, 0.9473143268446189, 1.015064876421276],
+        [1.9739216698204, 4.344165537894179, 0.9468638481418379, 1.005980735573069],
+        [2.188419798054115, 4.540894658735971, 0.9472908803368618, 1.014588234651929],
+        [2.972496200245216, 4.587707833193882, 0.9473532772675083, 1.015857634233994],
+        [0.9937275373378248, 5.247154297376889, 0.9490918379731951, 1.052478054898208],
+        [0.751955956622128, 1.063435300202452, 0.9337473733475685, 0.7956435023597747],
+        [8.526926999776078, 3.170875209295664, 0.9414096202645933, 0.9070778198921136],
+        [7.692055946908172, 4.768089654346552, 0.9475598316908543, 1.020081317176388],
+        [2.866196306470867, 4.360104895985397, 0.9467828198174583, 1.00436307601543],
+        [1.898383425494632, 4.375717894412641, 0.9469714817027748, 1.008137190301165],
+        [1.759977135806744, 4.613002654920503, 0.9475210879223716, 1.019286540362283],
+        [1.018009015334268, 3.987314185459314, 0.9462366522595419, 0.9935865206235256],
+        [1.630019337062599, 4.544440107449625, 0.9473524057696497, 1.015839883812072],
+        [0.9221735215437065, 4.314832457196292, 0.9475813560963031, 1.020523369353869],
+        [1.076228733913891, 15.19323991382157, 0.9878854405716444, 4.603532234063535],
+        [1.869359757456768, 4.548643480063953, 0.9473099786062067, 1.014976449466668],
+        [0.3510396695955084, 5.273501390735112, 0.9392631837888819, 0.8730266582108971],
+        [0.4683549692351834, 4.680698788736254, 0.942384914063441, 0.9233882406422014],
+        [0.6673979279481893, 4.913849693012484, 0.9483816167549205, 1.037220179785441],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.526784271944534, 5.086856097324162, 0.9487168225747855, 1.044368836713153],
+        [0.3974325162372736, 2.121513608793487, 0.9325099421958474, 0.7800202886982909],
+        [0.3324487307487672, 5.293524463027779, 0.9377442235279531, 0.8503485426791061],
+        [1.011034355220712, 1.261053223141087, 0.9377977905767765, 0.8511294589710634],
+        [3.594934250231269, 4.978299807061322, 0.9465630367756792, 0.9999999999999869],
+        [0.7271988716408258, 0.9889887363029946, 0.933411248891388, 0.7913423149068889],
+        [1.128875169442267, 4.674604375962374, 0.947724428229983, 1.023470929727118],
+        [0.6993182345535317, 6.035253529134496, 0.9508430104093476, 1.091982725491858],
+        [3.898484723167756, 3.546603232516683, 0.9446049484285004, 0.9626567793673469],
+        [0.570215400609679, 4.414501583448336, 0.9473904381582681, 1.016615063911685],
+        [1.042915445458586, 4.682046998384995, 0.9477587923224464, 1.024181300537115],
+        [0.9215799221434046, 4.075346313285413, 0.946604406418965, 1.000818515326873],
+        [2.109137994048569, 8.801350130301925, 0.962202745401371, 1.437138301405174],
+        [0.6158660941664404, 5.021171674987329, 0.9452712252668325, 0.9750635927043457],
+        [0.7209897851929201, 4.877054013250101, 0.948279850236081, 1.035068225825869],
+        [0.3745744295441779, 5.246211037605863, 0.9402969373295993, 0.889120532524788],
+        [5.323229098659453, 4.63076439113825, 0.9472690437707996, 1.014144702443996],
+        [1.019137933788917, 2.378754001425134, 0.941689885489437, 0.9117089953524214],
+        [0.6158660941664404, 5.021171674987329, 0.9452712252668325, 0.9750635927043457],
+        [1.040304999251207, 4.582552593797405, 0.9475387656534913, 1.019649029856492],
+        [0.823112580640513, 4.773041122048238, 0.9480134394582307, 1.029474603244551],
+        [1.116234427077177, 4.581588355345961, 0.9475006398458592, 1.018867548241388],
+        [0.4683549692351834, 4.680698788736254, 0.942384914063441, 0.9233882406422014],
+        [1.460711256841314, 4.640650773524774, 0.9475998308040704, 1.020903078742117],
+        [0.8847674199105034, 3.881956110406182, 0.9461428118940411, 0.991756938364778],
+        [1.474738359598277, 4.030403848304066, 0.9461734559628735, 0.9923536966891239],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.793134308474535, 4.806100919431636, 0.9481062963120399, 1.031417726905608],
+        [0.6879078595426394, 4.90463900243576, 0.9483525275937204, 1.036604195040859],
+        [4.744782658843782, 4.284255610039867, 0.9467082345057503, 1.002878393580936],
+        [0.6172043644504596, 3.213285208105728, 0.9554978991360744, 1.212108372506975],
+        [0.8789761384092039, 3.409825853582111, 0.9449753934767987, 0.9695177902096818],
+        [0.7327060362658503, 1.014910512648804, 0.9336081764067766, 0.7938569974243777],
+        [0.9988722363542699, 4.693030284869469, 0.9477869505074845, 1.024764080511291],
+        [0.5465006822499606, 8.920269507197101, 0.9689213661277081, 1.760025017049481],
+        [0.9062313800586461, 1.733081678959528, 0.9380114779698798, 0.8542580877532563],
+        [0.4461533124433988, 5.183100385927043, 0.9488935151488381, 1.0481747561372],
+        [0.8602971535473026, 4.743729967908412, 0.9479345393221196, 1.027828984672408],
+        [0.5974625701791519, 5.355196147456175, 0.9493118446285301, 1.057291257497039],
+        [0.2766483822277366, 5.35161770176359, 0.9344562773054735, 0.804859565128263],
+        [1.857788523553958, 4.599485801615609, 0.9475018530878199, 1.018892399115323],
+        [0.3884895800278157, 5.232493389258639, 0.9409273716798918, 0.8992118807331206],
+        [1.853392407095795, 4.594023782924671, 0.9474167655726058, 1.017152328795495],
+        [0.3967750108418744, 2.119357068311833, 0.9324738971403984, 0.7795737835814369],
+        [1.112702946651881, 2.885354184292008, 0.9436145274590791, 0.944755920867613],
+        [0.6063625406584043, 5.030177782318238, 0.945226639317594, 0.9742239294808542],
+        [1.192616685308739, 4.153969414313178, 0.9464206873975772, 0.9971932166259065],
+        [0.9874024301563478, 4.950446146392183, 0.9461037373382979, 0.9909969902335249],
+        [2.662170798408182, 2.097744277661413, 0.9397540979759207, 0.8806005357266822],
+        [0.5610237323545627, 5.036699362759165, 0.9486180861605851, 1.042253476278344],
+        [1.106042977326902, 4.658945613900423, 0.9476836208350964, 1.022628575754094],
+        [0.2992686920505683, 5.329073982857186, 0.9361218892411621, 0.8273181757251753],
+        [0.6957289574733035, 1.347896416214744, 0.936738116483167, 0.8359269028231698],
+        [0.6684712486330336, 4.905864476442301, 0.9483638299874041, 1.036843449237625],
+        [0.9874024301563478, 4.950446146392183, 0.9461037373382979, 0.9909969902335249],
+        [0.7658872862017477, 4.829407699584593, 0.9481667163199211, 1.032685815556094],
+        [0.3745744295441779, 5.246211037605863, 0.9402969373295993, 0.889120532524788],
+        [2.809549763405183, 3.050934224980371, 0.9425596314774587, 0.9263686436282577],
+        [1.781601539520804, 4.527211911289008, 0.9472947919799756, 1.014667724589882],
+        [0.4683549692351834, 4.680698788736254, 0.942384914063441, 0.9233882406422014],
+        [0.495164395032605, 5.121227868881578, 0.948784811738505, 1.045830200121164],
+        [0.5897077492064501, 4.994709179803211, 0.9485275806978174, 1.04032158730492],
+        [1.009193223066061, 2.078869326985083, 0.9404083954005394, 0.8908891017376612],
+        [0.4814618857456329, 5.139673328377968, 0.9488201532903983, 1.046591367364175],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.7660916510946622, 4.852320705871243, 0.9482127946771916, 1.033654891958417],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.9598693139915286, 3.237555318348448, 0.9441309715658748, 0.9540109376557802],
+        [1.047406929016851, 2.383154787292376, 0.9400765633662934, 0.8856430961878111],
+        [0.7811332489841571, 4.696099122800018, 0.9478936200390558, 1.026977494525587],
+        [2.709492407932091, 3.717621198616648, 0.9455599568313834, 0.9805344111973208],
+        [3.047039140343488, 4.608145593146393, 0.9474348583243518, 1.017521860509917],
+        [1.290700280873957, 9.54572882593588, 0.9702226814553423, 1.839407972984919],
+        [2.509179850660672, 5.373942133433619, 0.9582360514879859, 1.295278577458708],
+        [1.063901048033218, 4.674690733751121, 0.9477351731467829, 1.02369294710936],
+        [2.417868325445236, 4.59549424286351, 0.9474612208528058, 1.018060752183956],
+        [4.913788985272692, 3.467629377588986, 0.942681406176089, 0.9284566727271125],
+        [1.429007854908218, 3.614301219742001, 0.9452145077346803, 0.9739956984234311],
+        [0.836698475961197, 4.869344224571774, 0.9482031356339117, 1.033451609269997],
+        [0.5262152299765583, 5.088346633645926, 0.948714794505043, 1.044325304766487],
+        [1.960793333763621, 5.71912057917563, 0.9503758999093366, 1.08117252035229],
+        [0.7732097631693891, 1.584076448708799, 0.9390622317690227, 0.869961548410347],
+        [0.9195650708950849, 5.044317773399662, 0.9485827221964971, 1.041497803439468],
+        [1.381708080244398, 3.476048906177453, 0.9450991204886682, 0.9718299641664154],
+        [0.856134197057535, 4.75804554758373, 0.9479690151177588, 1.028547431719251],
+        [1.328378493092375, 3.33816654990299, 0.9443995340385112, 0.9588917038603108],
+        [1.71386530290558, 3.849657912275591, 0.9457094506316561, 0.9833898490558997],
+        [0.688038154834706, 4.899218010047888, 0.9483402582550097, 1.036344590621631],
+        [1.167653512528822, 4.613153812098028, 0.9475638416335188, 1.020163642879384],
+        [0.929044347689485, 1.712413129970971, 0.9388116146788484, 0.8661671111707],
+        [3.928647484965764, 4.22671622622723, 0.9462571329594913, 0.9939866771352854],
+        [0.9378522946406753, 3.779390287753592, 0.9457796078117342, 0.9847353297231051],
+        [4.213146963569278, 6.505052973373631, 0.9524994128555425, 1.132030080261438],
+        [0.6564982400755376, 0.8830099001810239, 0.9326498757152273, 0.7817582327188448],
+        [0.5480427573431782, 5.064565051462152, 0.9486676226128975, 1.043313743837275],
+        [0.9874024301563478, 4.950446146392183, 0.9461037373382979, 0.9909969902335249],
+        [0.915423961533828, 4.715052718414841, 0.94785703090977, 1.026217242398191],
+        [0.3599690382446046, 5.263283051514461, 0.9397199297273854, 0.8800693900086873],
+        [6.846506780752565, 4.172028093179637, 0.9459770745276649, 0.9885411246124821],
+        [0.3510396695955084, 5.273501390735112, 0.9392631837888819, 0.8730266582108971],
+        [2.535071008949212, 3.555464988015356, 0.9449857783361603, 0.9697114595749092],
+        [0.6025120210968949, 4.968900433897946, 0.948471794582736, 1.039134182648084],
+        [0.4832693567973369, 5.1129258332346, 0.9487673609117612, 1.045454740935548],
+        [1.371528617500322, 4.6171648000831, 0.9475528556457523, 1.019938126221752],
+        [0.6076276361479446, 4.982930012370001, 0.9485517031438629, 1.040835829830636],
+        [0.6666015318274037, 3.927601784630151, 0.9461694441223355, 0.9922755320135657],
+        [1.131605370904652, 4.630644791967605, 0.9476401812238463, 1.021733329845507],
+        [1.034003395584375, 4.421573918310028, 0.9471808655051942, 1.012357404922071],
+        [0.7851536508405906, 4.825849766907228, 0.9481540373233673, 1.032419465098889],
+        [3.233252354267688, 3.722746249019892, 0.9450444360182146, 0.9708067530067481],
+        [0.8631584981646886, 1.751514361445709, 0.9396507461491469, 0.87899577247919],
+        [1.3138650589674, 4.593814388489005, 0.9474896539697347, 1.018642576466122],
+        [0.9874024301563478, 4.950446146392183, 0.9461037373382979, 0.9909969902335249],
+        [0.9389062657947818, 4.71394749250261, 0.9478368936632424, 1.025799283945789],
+        [0.6332554271500554, 4.882149770507418, 0.9483443671398368, 1.036431515937792],
+        [0.6965304744950663, 4.898419194187772, 0.9483351930487475, 1.036237452920916],
+        [0.4683549692351834, 4.680698788736254, 0.942384914063441, 0.9233882406422014],
+        [0.4806783117696812, 1.348428347467156, 0.9302636543778353, 0.7530765011973177],
+        [0.7793672805674204, 4.787831141996395, 0.9480624914841251, 1.030500200806067] 
+        ]
+      },
+     "M":{
+       "0":        [
+[11.12089148941739, 4.143408832044464, 0.9457653941884109, 0.9876159201486523],
+        [1.056740916371472, 4.697466414277313, 0.9455811663390765, 0.9840807467893946],
+        [1.45027528032305, 4.653773305076442, 0.9456320515081025, 0.9850547944267006],
+        [1.632371493363489, 4.594239323176211, 0.9474694947403214, 1.021491622016719],
+        [1.232114584038702, 3.928018554131193, 0.9455472732352994, 0.9834329726132869],
+        [4.188756953953877, 4.367428082895338, 0.946432907777461, 1.000628598714736],
+        [14.80469314176305, 8.266802561021329, 0.953467730194082, 1.160467313907541],
+        [1.206142865652315, 4.740589478826124, 0.9479805115386509, 1.032082663580494],
+        [0.9997391709369632, 3.995504563637942, 0.9462966185332959, 0.99794546059383],
+        [0.9919701754065146, 4.396097971593291, 0.9471491816824311, 1.014957420858011],
+        [0.460891201341427, 3.111047565190542, 0.9385055203589782, 0.864334506647766],
+        [0.903526284748957, 4.267834305682885, 0.9469478366727185, 1.01089048608495],
+        [0.7379252351670703, 2.421050807990321, 0.9425853023190387, 0.9297768573626323],
+        [0.8959277623945635, 3.018934262628716, 0.9437670236817639, 0.9505060355446658],
+        [0.7065026187282928, 3.23822536567898, 0.9448077674763949, 0.9694973904086187],
+        [0.6037992117999957, 4.365127533973584, 0.9473301554601188, 1.018639414637313],
+        [0.6424292402420305, 3.699581154664379, 0.9452854995329421, 0.9784569184882379],
+        [0.7294545326395003, 4.796164563121208, 0.9481590135916497, 1.035831401098195],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.5827438681160237, 4.987010106655451, 0.9485653158342926, 1.044461207173264],
+        [0.4016372609279709, 3.210246109200792, 0.936775099495381, 0.8391282352383457],
+        [0.3891338210751467, 5.246947438335837, 0.9410514548067123, 0.9041103270398781],
+        [2.175131581300846, 3.845213594110762, 0.9450472534483991, 0.9739693087586228],
+        [0.92494235937555, 4.338831895779922, 0.9470614754492294, 1.013182054192166],
+        [0.6596383147968479, 4.869891372620134, 0.9483574903395343, 1.040030056096358],
+        [0.5896001616611386, 0.7306768375053631, 0.931577955900614, 0.7710886483247434],
+        [0.8015130885981691, 4.164190231573866, 0.946843048120952, 1.008786068987851],
+        [0.7736664292649782, 4.609038895864282, 0.9476088328906688, 1.024358977516337],
+        [1.414904917402769, 4.875648471572473, 0.9476086564896694, 1.024355337824762],
+        [0.8042007115138321, 2.768661107882043, 0.9436447725576627, 0.9483212503975447],
+        [0.7520911052031173, 4.506646110209594, 0.9475485800291122, 1.023117200820653],
+        [0.7124239744648641, 3.609373979746267, 0.9456793810562887, 0.9859624181819162],
+        [0.6103073219807762, 2.710828655162033, 0.9434899603241017, 0.9455681210976421],
+        [1.025904160701012, 3.7838609111942, 0.9458432868413275, 0.989117847271004],
+        [0.6048591264310915, 4.999536858980709, 0.9452102163668988, 0.9770346650178053],
+        [1.291293311795129, 2.565198476526078, 0.9427489090449115, 0.9325957300087788],
+        [0.6121329515755007, 2.011041760056481, 0.9402513897409885, 0.8912454523886248],
+        [1.180219368618043, 4.889398981184226, 0.946016884890265, 0.9924807611859802],
+        [1.105454513598039, 4.890626853490008, 0.9459951977362014, 0.9920594593096063],
+        [1.605413857897039, 2.939206936718294, 0.9433222475272992, 0.9426025446770783],
+        [1.293878631192419, 3.971462634670916, 0.9443578875537566, 0.9612008660695848],
+        [0.9884548052730145, 2.95089925072461, 0.9437110951800234, 0.9495053434551489],
+        [0.5986741279543244, 16.31252560522164, 0.9748423963984914, 2.194554091209314],
+        [0.7883494484476586, 2.442313169511699, 0.9427973874647455, 0.9334340889015836],
+        [0.3606858017902954, 5.283306272982982, 0.9398590567207423, 0.8850619010776035],
+        [1.082484408515005, 3.518499698102375, 0.9440467322711303, 0.9555406988066132],
+        [0.7189636065011923, 4.830475003829075, 0.9481083539609163, 1.034764872593254],
+        [0.7089798693324995, 1.787550141705444, 0.9388855498380224, 0.8700613907948836],
+        [0.8928681193634391, 7.719192553702568, 0.9562806678635116, 1.238776643030965],
+        [1.91491856016437, 3.591378903133635, 0.9437515876984222, 0.9502296507712116],
+        [1.518644327658945, 7.098739351534149, 0.9713807869639863, 1.922263735334442],
+        [2.565627964363285, 4.347255542248531, 0.9532757087115202, 1.15546542537587],
+        [0.9830387823664467, 5.359534534868056, 0.9493057774951067, 1.060544285747459],
+        [0.7648264763794788, 3.171203875735396, 0.9443605547374315, 0.9612496579633081],
+        [7.993395478079703, 4.040805907248204, 0.9457270305465383, 0.986877776465911],
+        [5.525040253676158, 13.14856060469339, 0.9646678277605314, 1.546281667154188],
+        [2.467014480149219, 6.15909859522141, 0.9542597645398716, 1.181542554066135],
+        [1.862805646612138, 4.991667936230018, 0.9469444810973467, 1.010822968875406],
+        [1.749151399183032, 4.056954912196582, 0.9467575638128177, 1.007075464672394],
+        [1.027468687238526, 4.677210305710327, 0.9476939066320149, 1.026117169621167],
+        [1.364512927085234, 6.728242479888183, 0.9607143695721333, 1.384974287872262],
+        [0.9285869893975317, 0.8529698379842841, 0.92357913285826, 0.6844524804439922],
+        [1.919503172586934, 2.100639572147981, 0.9406698052530856, 0.8979302050977519],
+        [1.708524541398916, 3.343596525186294, 0.9499000915823059, 1.073796906709932],
+        [0.351736659376683, 5.293336788811861, 0.9394016657262749, 0.8779540578781505],
+        [0.460891201341427, 3.111047565190542, 0.9385055203589782, 0.864334506647766],
+        [0.6667717946817246, 4.893763142017518, 0.9484067419256615, 1.041076946162406],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.5178176253295015, 1.88921095940703, 0.9393570794111731, 0.8772669230898767],
+        [0.4022964728231313, 3.212013747796585, 0.9368052890174339, 0.8395561610686151],
+        [0.321650341035935, 2.369009391488082, 0.9280744744836993, 0.7307703790540948],
+        [1.00034417247337, 2.390886247295616, 0.942368674814798, 0.926069085034263],
+        [3.576480160390781, 4.912463418562362, 0.9464010403673108, 0.9999999999999825],
+        [0.6304491791341287, 10.60195246158876, 0.9721853938458079, 1.979508304542972],
+        [0.9634894197943674, 3.701269164336891, 0.9607653949851229, 1.386849129846004],
+        [0.6977249906525677, 9.224982864215468, 0.9566357269905871, 1.24938324430541],
+        [3.939818549048507, 3.799963013305871, 0.9450905313546948, 0.9747815980889891],
+        [0.5709587856636735, 4.596838702365027, 0.9478070980889466, 1.028465347930432],
+        [1.039505678863528, 2.630181065498647, 0.9430472466455497, 0.9377776493900509],
+        [0.9097093831078803, 2.177085547731798, 0.9417303648135809, 0.9153041380556556],
+        [2.526679237746549, 5.604425938489465, 0.9490601002908647, 1.055156262511035],
+        [0.6143822341889521, 4.99144829349619, 0.9452553661312254, 0.9778871671968672],
+        [0.7109050460931223, 2.285113659581308, 0.9401538518211494, 0.8897005870522886],
+        [0.3751626675457733, 5.259283661692849, 0.9404152463403344, 0.8938520988503982],
+        [5.455700586348224, 3.627801977783612, 0.9430731452855284, 0.9382300531395277],
+        [1.016259264608087, 3.035959574613738, 0.9440777559739074, 0.9561022181697556],
+        [0.6143822341889521, 4.99144829349619, 0.9452553661312254, 0.9778871671968672],
+        [1.032908633075195, 4.281093104759017, 0.9468420882152287, 1.008766830020827],
+        [0.8199237165649182, 4.59487117092029, 0.9479767425824605, 1.032003788716895],
+        [1.101718288847909, 4.418029065543203, 0.9465682873948348, 1.003307380063987],
+        [0.460891201341427, 3.111047565190542, 0.9385055203589782, 0.864334506647766],
+        [1.276187562389319, 3.408382441768387, 0.9535701245269068, 1.163151454840884],
+        [0.8829765375508152, 4.193342038398979, 0.9467687445837998, 1.00729888787612],
+        [1.432282172713598, 4.730843363181782, 0.9476999050738113, 1.026241353390664],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.7876822616008416, 2.341753235131878, 0.9424142223282147, 0.9268463551695403],
+        [0.6789308236852126, 2.055976973212894, 0.9393904630979548, 0.8777813152884754],
+        [5.035952976182944, 3.481205514313594, 0.9448849753518865, 0.9709348471556141],
+        [0.685828931856048, 4.19008360097909, 0.9469306580559864, 1.010544926820485],
+        [0.8773580655346431, 3.625328475412289, 0.9454657716851658, 0.9818785889769074],
+        [0.7404773516223278, 2.354089803868313, 0.9423404166263065, 0.9255874751819483],
+        [0.9860262100430436, 2.392371964339527, 0.9415454025965623, 0.9122287267924964],
+        [0.6314365928467149, 3.545984507473279, 0.9449248429712103, 0.971678680604101],
+        [0.9166469986789135, 3.382724153057069, 0.9446677288386036, 0.9669003866967235],
+        [0.4390781996591052, 3.023386790938086, 0.9441892779758745, 0.958125887159292],
+        [0.8174501673176641, 2.662801467671637, 0.9456733525769783, 0.9858467240555225],
+        [0.5949286791473107, 4.855199985365434, 0.9483916052942347, 1.040754989747624],
+        [0.2774120146479326, 5.383246375825815, 0.9346295047149334, 0.8097274503225026],
+        [1.638938608699536, 6.622181056464417, 0.9517736985782244, 1.117714523222077],
+        [0.3891338210751467, 5.246947438335837, 0.9410514548067123, 0.9041103270398781],
+        [1.672573472501623, 1.565334460317754, 0.9417368229992319, 0.9154118726584828],
+        [0.4016372609279709, 3.210246109200792, 0.936775099495381, 0.8391282352383457],
+        [1.10611116994661, 3.204247768703003, 0.9445053002703785, 0.9639045815354055],
+        [0.6048591264310915, 4.999536858980709, 0.9452102163668988, 0.9770346650178053],
+        [1.183704342600694, 3.747025957429154, 0.9457922093994382, 0.9881324841951163],
+        [0.9796980226888625, 4.89065560818871, 0.9459668952224912, 0.9915101539239576],
+        [2.650957215935254, 2.983447339818136, 0.9432093403624113, 0.9406159323773107],
+        [0.5609084500251574, 5.022151804998466, 0.9486407491224464, 1.046078428396997],
+        [1.094502737260034, 3.607917562747081, 0.9457655872763142, 0.9876196379380793],
+        [0.3000065933906724, 5.356426420563507, 0.936281938583415, 0.8321952689371248],
+        [0.7005007469051636, 2.864662754206939, 0.9438721642857091, 0.952392646063643],
+        [0.6676721537624958, 4.854491177020392, 0.9482918367089511, 1.038637625854309],
+        [0.9796980226888625, 4.89065560818871, 0.9459668952224912, 0.9915101539239576],
+        [0.7523669393973026, 3.696972087992259, 0.9447611318424926, 0.968631074474544],
+        [0.3751626675457733, 5.259283661692849, 0.9404152463403344, 0.8938520988503982],
+        [2.578355803805064, 1.194263087887754, 0.9358261860716989, 0.8258829371672378],
+        [1.758575626961126, 3.479653608348491, 0.9439598778397863, 0.9539719673543295],
+        [0.460891201341427, 3.111047565190542, 0.9385055203589782, 0.864334506647766],
+        [0.4953459056315128, 5.121692978964261, 0.9488347404447115, 1.050259326587479],
+        [0.5894218527649459, 4.976751327281332, 0.9485422551688979, 1.043967753758321],
+        [1.014626712459672, 4.590005220246177, 0.9475074907258697, 1.022272008885547],
+        [0.471291117065872, 3.719808931253234, 0.9448190962983778, 0.9697080586807237],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.7591559603606866, 1.656114653018429, 0.9380157365973468, 0.8570572455368082],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.9695853293652987, 4.690857359257484, 0.9477491291230797, 1.027261499734253],
+        [1.04484829371877, 2.924620741737275, 0.9439055335883247, 0.9529928930164673],
+        [0.7769983305259213, 4.301127410735666, 0.9470588660370567, 1.013129324071796],
+        [2.05828637968008, 12.90071451165223, 0.9626475459275499, 1.459584754893164],
+        [2.88511468235225, 3.504067458286539, 0.9446431898021984, 0.9664466654650646],
+        [1.352375962906894, 7.678002382841544, 0.959795738618879, 1.352034832721225],
+        [3.080044657910243, 2.051589617170126, 0.939695162566787, 0.8825025950049379],
+        [1.049783778138455, 1.975955024189177, 0.939623994793136, 0.8813955940246487],
+        [2.418417455208109, 3.924188697111596, 0.9452688929133464, 0.9781428490216675],
+        [5.039928724679458, 4.469627736498372, 0.9470705976642327, 1.013366433691771],
+        [1.409004194651489, 4.290685627565372, 0.9467239625353101, 1.006404581180239],
+        [0.8366190619429748, 5.666239839055454, 0.9495127270579462, 1.065123651001685],
+        [0.5175805698015677, 1.936770294303173, 0.9394595090766095, 0.8788470095730123],
+        [1.931168009576305, 4.061329148470358, 0.9460932054032762, 0.9939660844432788],
+        [0.7296783520450687, 2.145908633443113, 0.9489778711446172, 1.053364459461665],
+        [0.9119722666273283, 5.250772435923531, 0.9490840773224446, 1.055679820586234],
+        [1.376683280292992, 3.6394553761445, 0.9453225643053325, 0.9791585868772232],
+        [0.8487899503474103, 2.049803381643031, 0.9405187903430311, 0.8955066917648095],
+        [1.336999058600456, 4.543018278529006, 0.9472512467358681, 1.017030874370483],
+        [1.697946232145576, 4.313609153680856, 0.9467795668440793, 1.007515236437644],
+        [0.6871048148905975, 4.852781198910064, 0.9483232560504529, 1.039303548794853],
+        [1.158164105842716, 3.089627394431934, 0.943396776077179, 0.9439182239537223],
+        [0.9338108444118562, 3.259915466624444, 0.9446447646741691, 0.9664757724114678],
+        [3.831609224486358, 5.068994315188315, 0.948260120206742, 1.037966224968373],
+        [0.935481529227373, 4.313029260777377, 0.9472162590958839, 1.016319196544982],
+        [3.938682283132802, 6.862828426591634, 0.9527096124116766, 1.140955810976044],
+        [0.6741755540158086, 4.883986803198109, 0.9483299245497873, 1.039444989699576],
+        [0.5383793673105136, 1.820031062764831, 0.9389016968764942, 0.8703062976679787],
+        [0.9796980226888625, 4.89065560818871, 0.9459668952224912, 0.9915101539239576],
+        [0.9022446542353973, 5.827006832944823, 0.9497607402631704, 1.070661368686443],
+        [0.3606858017902954, 5.283306272982982, 0.9398590567207423, 0.8850619010776035],
+        [6.44714938969965, 4.307796982655922, 0.9467038760926768, 1.006003939029065],
+        [0.351736659376683, 5.293336788811861, 0.9394016657262749, 0.8779540578781505],
+        [2.413533238067975, 2.7079510317774, 0.9422876624564365, 0.92468963760186],
+        [0.6020415221983734, 4.946262502318324, 0.9484765412540902, 1.042564026501082],
+        [0.4835337166786202, 5.116134994954034, 0.9488263440493433, 1.050077711299028],
+        [1.334057511225004, 2.828028637232701, 0.9412633137334544, 0.9075756633243416],
+        [0.5994038981468285, 3.130184693557817, 0.9439896634356039, 0.9545093952279253],
+        [0.6666080947800082, 4.323025646632656, 0.9473284086422151, 1.018603753900751],
+        [1.113033258329655, 5.531254133073857, 0.9488911516134162, 1.051481055836949],
+        [0.9901969362501248, 0.5245629146595605, 0.9163346461533104, 0.6202826107659195],
+        [0.7792272499891831, 3.507152331121849, 0.9455850624097677, 0.9841552612589731],
+        [3.351379148702724, 2.758042561052818, 0.9390964892517576, 0.8732710036353053],
+        [0.8613411595356002, 2.650049123061414, 0.9432379364406509, 0.9411183357414589],
+        [1.304995294599584, 4.477976496006098, 0.9471138354338071, 1.014241226837533],
+        [0.9796980226888625, 4.89065560818871, 0.9459668952224912, 0.9915101539239576],
+        [0.9344932433148566, 4.595001674935014, 0.9475772852523516, 1.023708442881752],
+        [0.626666057530944, 2.89483669139565, 0.9437426506907153, 0.9500697009534669],
+        [0.6872437438551455, 2.000298526193534, 0.9392330656364929, 0.8753610075921061],
+        [0.460891201341427, 3.111047565190542, 0.9385055203589782, 0.864334506647766],
+        [0.4897252793147067, 3.000689980404647, 0.9388361152601244, 0.8693124059827875],
+        [0.7773082709004604, 4.719627465347147, 0.9479568036581688, 1.031586706789682] 
+        ]
+      },
+     "N":{
+       "0":        [
+[11.06585915377673, 3.702083105940501, 0.9442829432384389, 0.9653536559818169],
+        [1.035795808747754, 4.381511756976609, 0.9448881421009573, 0.9765799742864805],
+        [1.507022680783161, 4.750402048127238, 0.9457972312405222, 0.993914517962996],
+        [1.567548258331357, 6.247614600578706, 0.9505505388631135, 1.094929398452548],
+        [0.8495479460514767, 7.561793589506101, 0.9736863634845871, 2.10770916519351],
+        [3.602446272886334, 4.859350961341151, 0.9518081299948615, 1.12498854125578],
+        [17.36135162036972, 5.796236369088786, 0.9497510046511114, 1.076601166477037],
+        [1.192425840745261, 3.863030792349715, 0.9456732560473088, 0.9915163913247026],
+        [0.999671469279941, 4.364489957127162, 0.9469714881212401, 1.017184961970928],
+        [0.9843802887903059, 4.519499854219096, 0.9473274299835778, 1.024443640903123],
+        [0.4591380185110184, 3.065619801483099, 0.9384736218859218, 0.8688267576409113],
+        [0.8895179640819628, 1.291451282908529, 0.9381848065427451, 0.8645012593391902],
+        [0.7433912010516663, 4.643396702236749, 0.9477898480936262, 1.034021486597776],
+        [0.8863686111486996, 2.115000213825926, 0.938170919986092, 0.8642943028632422],
+        [0.7027117169937064, 1.55470635221883, 0.9391918610344865, 0.8797617498663265],
+        [0.5888603883775887, 1.000191266977573, 0.9324834285237211, 0.7866892390583168],
+        [0.6527213204924954, 4.738009302567336, 0.948065245201406, 1.039806692228231],
+        [0.6830530057474746, 0.6797984565521124, 0.927832479081399, 0.7323189153312768],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.5258537147934995, 2.194765834308628, 0.9497655063497136, 1.076928403121002],
+        [0.4099793214368617, 5.110925572521468, 0.9416273615937933, 0.9188449094149849],
+        [0.3875312828520734, 5.147159313067987, 0.9409234984017647, 0.9072187404757787],
+        [1.938790713500166, 4.163971230959397, 0.9448292236454776, 0.9754762269368382],
+        [0.9177419194214983, 4.414007124876234, 0.9471543519502553, 1.020901868235822],
+        [0.6570304476598336, 4.683393598852239, 0.9480151426356017, 1.038749637453103],
+        [0.6190208646852113, 3.477978540110862, 0.9450886937509673, 0.9803547563262424],
+        [0.7973978950263861, 3.622354941464657, 0.9456041617280395, 0.9901846022142395],
+        [0.7549447018853761, 0.8512406971133466, 0.930369946881756, 0.7610819360545725],
+        [1.1497985698836, 3.451982011127293, 0.9614693971412206, 1.421353583957218],
+        [0.8060609197496145, 4.524163069737253, 0.9475154856918171, 1.028318387418389],
+        [0.731724213734233, 1.317358410540029, 0.932653663692506, 0.7888217800992504],
+        [0.6960669191945787, 1.546727470449357, 0.9340273057150242, 0.8064321241311214],
+        [0.615303066513345, 4.785544164735563, 0.9481908189512486, 1.042465007693101],
+        [1.022673767152394, 2.678143666072487, 0.9429456008885386, 0.941390844971254],
+        [0.5993961850369107, 4.859878255623198, 0.9449422229625688, 0.9775951760066843],
+        [1.182511005183176, 3.014012571179514, 0.9523383004567927, 1.138136087042623],
+        [0.60903513097925, 1.317283173365255, 0.9371283304686129, 0.8490173040763471],
+        [1.171314779948442, 4.749357287806119, 0.9456989297652765, 0.9920121144370526],
+        [1.097000432577998, 4.750439752677495, 0.9456779860440342, 0.9916076856468247],
+        [1.455604624720728, 4.040178713180957, 0.9493694542539607, 1.068058678314172],
+        [1.310776200528243, 2.822343743688416, 0.9399256272366209, 0.8912031510590982],
+        [0.9495907685088775, 2.072774023442907, 0.9428895214436867, 0.94041051735257],
+        [0.7720499975639891, 1.176725707009129, 0.9353666630570229, 0.8243236809040547],
+        [0.7905176486197827, 4.536243549339572, 0.9475583975314291, 1.029206447735002],
+        [0.3480706442713083, 2.555866626598905, 0.9323147129519316, 0.7845863179510058],
+        [1.076806900078643, 2.407363457599691, 0.9400924174255542, 0.8938429565513403],
+        [0.7138858444757588, 4.670506177886199, 0.9478722515504069, 1.035746108806311],
+        [0.7040535687080889, 1.156916772971766, 0.9357082022052073, 0.8290053510300945],
+        [0.8923361107466158, 4.033657402016363, 0.9558879913086697, 1.234305428021468],
+        [1.546305278197135, 8.58123250658875, 0.96356042918419, 1.506184488560135],
+        [1.953799088543916, 2.458695044853182, 0.9477996923577739, 1.03422723084777],
+        [3.014807282343019, 1.748211468792217, 0.9354612644229426, 0.8256154736559143],
+        [0.9689138365353247, 4.372428745485441, 0.9470176775641501, 1.018121390767982],
+        [0.7568277767325791, 1.23965754816417, 0.9370782558524334, 0.84829630559297],
+        [7.961927809423671, 4.747234093728705, 0.948118573340456, 1.040934042569742],
+        [7.83604726638307, 2.774903951181659, 0.9405378100451811, 0.9009648060016169],
+        [1.491502538880266, 18.25945871344833, 0.9825475551897752, 3.206784483863021],
+        [1.525649244234415, 9.099558126993236, 0.9564531219782043, 1.251062860778164],
+        [1.717963042087824, 2.760029406556945, 0.9425999843822557, 0.9353795810351638],
+        [1.013811958275531, 4.49960576986438, 0.9472623336864069, 1.023108818964209],
+        [1.188252971534137, 12.77255747581196, 0.971944749300808, 1.97333078697911],
+        [0.9204347522760676, 4.430392737745829, 0.9472226609176702, 1.022296930108884],
+        [1.960064514704903, 4.173090932947338, 0.9458135914694112, 0.9942318033017005],
+        [1.723907166990009, 3.404779632633425, 0.9436392688169162, 0.9536781977813246],
+        [0.3160778865035072, 0.6383702883463692, 0.907580637869262, 0.5593642713861663],
+        [0.4591380185110184, 3.065619801483099, 0.9384736218859218, 0.8688267576409113],
+        [0.6654986613756849, 5.616605025253219, 0.9502444020276388, 1.087842037643254],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.5143140797880901, 1.29320572475724, 0.9365570859817242, 0.8408598173887925],
+        [0.4106268393665348, 5.109905785340755, 0.9416476452825651, 0.9191841061757035],
+        [0.3187233605580088, 1.781893278132314, 0.925564244005453, 0.7082676937594229],
+        [0.8114380263688972, 7.437408850225807, 0.9740998985346608, 2.142271450893536],
+        [3.577422114234408, 4.790238818874816, 0.9461093053718533, 0.9999999999999978],
+        [0.7410320101302267, 4.645512300700993, 0.9477958206380377, 1.034146302990037],
+        [1.088938140594498, 2.22826723829389, 0.9402056682842045, 0.8956437842399539],
+        [0.7040598192449986, 4.675173810314202, 0.948020685649144, 1.038866482687455],
+        [2.90697229290984, 5.738615766961298, 0.9611538006152089, 1.409343381111632],
+        [0.5537119182126772, 1.079480549231074, 0.9322492524845245, 0.7837732193699671],
+        [1.038633969815761, 1.857386939623326, 0.9405121832504902, 0.9005521408201933],
+        [0.8881008143882938, 2.741797000638323, 0.9412148142659933, 0.911996826222458],
+        [2.642689507105828, 4.201144565337399, 0.9461924140936162, 1.001632532294144],
+        [0.6085348158832061, 4.84940015622782, 0.9449786065446448, 0.9782792887246995],
+        [0.6640562364879795, 2.625556487792022, 0.9511734960444647, 1.109625883311117],
+        [0.3737648697901763, 5.169042221418706, 0.9403153572966916, 0.897394489269414],
+        [5.28170037895193, 5.365703615843663, 0.9488631678091056, 1.056920290428718],
+        [1.012874125561424, 3.774645769388312, 0.9457044939276924, 0.992119612339763],
+        [0.6085348158832061, 4.84940015622782, 0.9449786065446448, 0.9782792887246995],
+        [1.005084513178657, 1.068357472652478, 0.931166982001321, 0.770554256624554],
+        [0.8161507657794391, 4.141038332299224, 0.9466494035278397, 1.010700205074818],
+        [0.6953691716566982, 10.89161699392682, 0.9821202580292314, 3.128786216754501],
+        [0.4591380185110184, 3.065619801483099, 0.9384736218859218, 0.8688267576409113],
+        [1.435189589840286, 1.170897712653173, 0.93409391994927, 0.8073047936463812],
+        [0.8313945282235035, 0.7448583548490736, 0.9319754722518505, 0.7803894953907659],
+        [1.453205220309695, 4.278850961107745, 0.9463876510765882, 1.00548754853635],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.7721228171211435, 4.152553575498472, 0.9446917212892937, 0.9729094781250485],
+        [0.6753697431965774, 1.261451230818448, 0.9356553409871788, 0.8282775015776792],
+        [5.083888549369219, 4.462621033832863, 0.9452655463567542, 0.9837064272236553],
+        [0.6848715387418295, 4.694149883042695, 0.9479492596859029, 1.037362748352538],
+        [0.8530548354978876, 1.278214468603596, 0.9331903354405724, 0.7956158175255571],
+        [0.7461579317459681, 4.64122717425121, 0.9477827051026542, 1.033872247284354],
+        [0.977361506199497, 1.774451619864099, 0.9390364605593617, 0.8773739774861171],
+        [0.6407820610356011, 4.75289680671688, 0.9481053533724546, 1.040654358067256],
+        [0.9205672623571057, 4.404768013570465, 0.947135054295249, 1.020508408779943],
+        [0.4314171535345577, 3.306600678605827, 0.9435983752875104, 0.9529454427160491],
+        [0.8511791613842702, 3.608758325480571, 0.9449976790816366, 0.9786382671372601],
+        [0.5931923494588932, 4.821237143342378, 0.9482773348885088, 1.044304004446303],
+        [0.2765590301555934, 5.319250124480453, 0.9346062743254276, 0.8140762386394808],
+        [1.805430590209267, 3.23498391138087, 0.940539645353876, 0.9009943734055554],
+        [0.3875312828520734, 5.147159313067987, 0.9409234984017647, 0.9072187404757787],
+        [1.403417689005064, 7.275160141918183, 0.9669012572207382, 1.663960814297595],
+        [0.4099793214368617, 5.110925572521468, 0.9416273615937933, 0.9188449094149849],
+        [1.097421946660156, 1.605493577761012, 0.9391257859356077, 0.8787449974573229],
+        [0.5993961850369107, 4.859878255623198, 0.9449422229625688, 0.9775951760066843],
+        [1.183825317032568, 2.814433913745082, 0.9427163767551049, 0.9373958780137785],
+        [0.9709249712291921, 4.749343558903365, 0.9456488512653162, 0.9910456037459571],
+        [2.732564021193743, 2.896061040823576, 0.9422674722094099, 0.9296641704793703],
+        [0.5065235126678742, 0.9182143423961348, 0.934986230901404, 0.8191667921530599],
+        [1.08558810560746, 2.569009276425682, 0.9419849954826867, 0.9248602674091606],
+        [0.2990129591153622, 5.284244831643848, 0.9362360203694682, 0.8363390961954433],
+        [0.7052960226184415, 4.685038151941338, 0.9479097703932541, 1.03653314855103],
+        [0.6650078951486453, 4.698893564819842, 0.9480356413434505, 1.039181869063616],
+        [0.9709249712291921, 4.749343558903365, 0.9456488512653162, 0.9910456037459571],
+        [0.7459772270315468, 4.37320225757359, 0.9441887349590621, 0.9636280107886667],
+        [0.3737648697901763, 5.169042221418706, 0.9403153572966916, 0.897394489269414],
+        [2.807966303466982, 5.416908697721751, 0.9481281855866585, 1.041137490841139],
+        [1.326571659831034, 4.678964708862004, 0.9603257673861975, 1.378740440274132],
+        [0.4591380185110184, 3.065619801483099, 0.9384736218859218, 0.8688267576409113],
+        [0.4936441304951713, 4.982995548225099, 0.9486330726152777, 1.051930726337056],
+        [0.5287829870021451, 2.685925448266512, 0.9525223726086239, 1.142769510836377],
+        [1.003041181271643, 4.355590594097781, 0.9469306096452655, 1.016357565574229],
+        [0.4691875484187453, 2.330734024248489, 0.940788412599171, 0.9050190544214186],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.7005653776371595, 3.087375109711283, 0.9560936036514757, 1.24035238698383],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.9568656219010262, 4.504878536435982, 0.9473084643420524, 1.024054403434001],
+        [1.043207037623787, 4.336285682915663, 0.9468477428719903, 1.014684214428041],
+        [0.7167167446230349, 1.626250688831866, 0.9424073276983734, 0.9320600456122329],
+        [2.278957346401177, 10.56183578563669, 0.9565321074463273, 1.253439668524466],
+        [2.913162881950994, 2.872321569348231, 0.9418523444740989, 0.9226204609919835],
+        [1.53338254747316, 1.036403675604691, 0.9350261460833188, 0.8197050205511058],
+        [3.223109825268315, 3.373847102114962, 0.9437642365425726, 0.9559240497096047],
+        [1.026156257585971, 2.021978891873424, 0.9437664242757698, 0.9559634553626432],
+        [2.440356812199546, 3.661804851292653, 0.9442340041806438, 0.9644564948655816],
+        [5.600311725345903, 5.308741184826092, 0.9474685754598732, 1.027349240348345],
+        [1.410440799338241, 3.88993786534156, 0.9454114294093571, 0.9864875156655217],
+        [0.8310223292929788, 5.16996298153913, 0.948617703172122, 1.051599035481458],
+        [0.513822621133047, 1.312873023162466, 0.9365988163412585, 0.8414507583653781],
+        [1.93864080801243, 4.965528826558655, 0.9485105878998207, 1.049292859647586],
+        [0.7763497884289817, 4.582708358700549, 0.9476674279910993, 1.031469383763015],
+        [0.9038488324476029, 4.465930699448179, 0.9473361741525806, 1.024623194494157],
+        [1.341319969824733, 2.302216667647809, 0.9416007106498989, 0.9183995935408549],
+        [0.8423821652845889, 1.309791501849526, 0.936779143677375, 0.8440133316526708],
+        [1.319305336140091, 4.349841851705895, 0.9467091021808405, 1.011896242262892],
+        [1.660035378445325, 3.245393030636514, 0.9438575230972364, 0.9576070622682133],
+        [0.6840114238985616, 5.003349699611428, 0.9486435150325784, 1.052156199383324],
+        [1.039598263702302, 1.811031527976763, 0.9477030291007039, 1.032210331178018],
+        [0.9373047805514201, 4.451168191413065, 0.9472311429811645, 1.022470409867433],
+        [3.844248657777277, 5.443310993715272, 0.9491426775692771, 1.06304213265566],
+        [0.9104726999969567, 2.438056046208539, 0.9424772760589322, 0.9332627069054701],
+        [4.282056334681512, 2.564567412900645, 0.9409890097212357, 0.9082891282554785],
+        [0.670060329376325, 4.716133748853002, 0.9480071263560744, 1.038580700505909],
+        [0.4726950328909874, 5.060048622905279, 0.9598110283476924, 1.360352031670526],
+        [0.9709249712291921, 4.749343558903365, 0.9456488512653162, 0.9910456037459571],
+        [0.8990888967492823, 5.124480703330022, 0.9475830978025706, 1.029718279085113],
+        [0.3480706442713083, 2.555866626598905, 0.9323147129519316, 0.7845863179510058],
+        [6.221278076774433, 5.225727400424233, 0.9510188199767695, 1.105941958844115],
+        [0.3160778865035072, 0.6383702883463692, 0.907580637869262, 0.5593642713861663],
+        [2.036116879071318, 4.244229183596387, 0.9560329259543514, 1.238562002938656],
+        [0.5978704755431317, 4.388133124488196, 0.9474088839011843, 1.026118535755477],
+        [0.4813376055237345, 4.925749373552095, 0.948702300075221, 1.053427201052913],
+        [1.330690196304829, 2.05825417848651, 0.9380053624890049, 0.861834080226471],
+        [0.5972025361362948, 1.924237392847624, 0.9401869599154868, 0.8953458279930495],
+        [0.6653732017217628, 4.689507883435841, 0.9480158613450941, 1.038764786249873],
+        [1.110524678745288, 5.450383761142311, 0.9488434611941666, 1.056491199311301],
+        [1.023563105144708, 4.428026289723001, 0.9471130546836649, 1.02006020944604],
+        [0.7733736381189777, 1.670300617046724, 0.9391540627281115, 0.8791798456405759],
+        [3.213031324998784, 4.104697132834549, 0.9455443646120202, 0.9890347442367202],
+        [0.858017478714851, 3.774491729785125, 0.9458807276033161, 0.9955358299901375],
+        [1.280116215709355, 1.496869906767833, 0.9341525972888121, 0.8080749497315396],
+        [0.9709249712291921, 4.749343558903365, 0.9456488512653162, 0.9910456037459571],
+        [0.9263491282872908, 4.39764478445711, 0.9471167298991032, 1.020135058873701],
+        [0.6146927076658795, 3.014424950984066, 0.9422647727887375, 0.9296180406780216],
+        [0.6833016817284104, 1.279285816847336, 0.9360217460764929, 0.8333472811582308],
+        [0.4591380185110184, 3.065619801483099, 0.9384736218859218, 0.8688267576409113],
+        [0.4982455268990466, 4.979331188061199, 0.9437695662316387, 0.9560200539269217],
+        [0.7607012029574975, 0.8023795558466083, 0.9310457919423728, 0.7690998632830228] 
+        ]
+      },
+     "P":{
+       "0":        [
+[11.30704166670673, 4.677202235018993, 0.9475457412585923, 1.009031640542531],
+        [1.072767496121676, 5.098930816337145, 0.9464301911623331, 0.9868561323048632],
+        [1.525986783178829, 5.21437374486919, 0.94681731816958, 0.9944462497308126],
+        [1.646325056329226, 5.021109631935625, 0.9484987477241849, 1.028736922733765],
+        [1.240823901894788, 4.512196669296346, 0.9472696395085627, 1.003455765664171],
+        [4.185042912670943, 4.804050948895747, 0.9478283095997362, 1.014799214794919],
+        [17.4944105203935, 5.223144021999944, 0.9489830925245946, 1.03903386027279],
+        [1.222624378400333, 5.057384436928269, 0.9485893252479494, 1.030647808411702],
+        [1.015356770124586, 5.069889637131132, 0.9486232479506768, 1.031365199293051],
+        [1.00136422367639, 5.097723926685481, 0.9486640336057557, 1.032228981809954],
+        [0.4733824331092547, 5.341907031717864, 0.9437243414022048, 0.9367202859059135],
+        [0.9087517150722499, 5.104962340547592, 0.9487207042722502, 1.033431467401709],
+        [0.7523100167916925, 5.197564633398191, 0.9489055346457874, 1.037371889854857],
+        [0.9137730165586256, 4.903466299624136, 0.9483308332988653, 1.025212206849911],
+        [0.711037276152044, 5.220176945656068, 0.9490032188501135, 1.039465968916154],
+        [0.6083119001855978, 5.279714384191776, 0.9490730976566759, 1.04096890602767],
+        [0.6586106267823988, 5.252985714742258, 0.9490236121697151, 1.03990415790219],
+        [0.7313126171556553, 5.208035446637088, 0.9489642035226713, 1.038628626773621],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.5844827887054126, 5.297664041135841, 0.9491039526597479, 1.041633841699833],
+        [0.4131809200827173, 5.370532275049842, 0.9419460163915243, 0.9063153649161066],
+        [0.3669723503127471, 1.024761962578748, 0.9227668273625216, 0.6673804079779572],
+        [2.191626587031757, 4.310540952502237, 0.9468340756465052, 0.9947772972840266],
+        [0.9108400024131736, 1.384851958965947, 0.9386941981309562, 0.8552792017590103],
+        [0.6610645848226963, 4.678596087421036, 0.947357168315702, 1.005217078021938],
+        [0.624100882148011, 4.766493934693033, 0.9480660444597323, 1.019700296170222],
+        [0.8043861305797499, 5.153787355542651, 0.9488486383966133, 1.036155877649667],
+        [0.7750409546614726, 4.989558042575664, 0.9485401019029672, 1.029608524385874],
+        [1.43627800594124, 4.909568130390685, 0.948189130929547, 1.022255487304953],
+        [0.8146827119806171, 5.160279602661511, 0.9488494895532762, 1.036174049020332],
+        [0.7543587777201598, 5.00262341484727, 0.9485716853538638, 1.030275137297457],
+        [0.7159315699782823, 4.693030853010645, 0.9479915453115108, 1.018159620194544],
+        [0.6201988359781707, 5.277898507202281, 0.9490714196907001, 1.040932768397036],
+        [1.040681922046142, 4.235411003453823, 0.9468369281029401, 0.9948336689589061],
+        [0.6076845668315757, 5.278498317882421, 0.9457226849740124, 0.973264326990528],
+        [1.291895681676455, 3.440065380908305, 0.945133857416913, 0.9622197090312419],
+        [0.6137845688204356, 3.176990627136411, 0.9443448273804529, 0.9477862996759336],
+        [1.189048776180197, 5.215809584167529, 0.946709592519789, 0.9923230776111127],
+        [1.113412841609051, 5.216516157715008, 0.9466841374482854, 0.9918226350989844],
+        [1.638267570760702, 4.901792964772434, 0.9481525970245073, 1.021495802279648],
+        [1.346058137716655, 3.698332287042846, 0.9445435911562895, 0.9513835057351652],
+        [0.9958253308771737, 4.128233017144764, 0.946656052132488, 0.9912710366033528],
+        [0.7825032001622506, 3.636768400670908, 0.9446074512354766, 0.9525447182724375],
+        [0.7984921317913674, 5.168846859421264, 0.9488706087075615, 1.036625116257238],
+        [0.3617592247581735, 5.3921846151278, 0.9399175146841678, 0.8738305185210541],
+        [1.093941041482788, 4.292015311582748, 0.9463530595238105, 0.9853569554915038],
+        [0.7049348698317169, 1.297037451058597, 0.9373173669384913, 0.835265969161979],
+        [0.7102801574289992, 2.934188494940725, 0.9435667972154856, 0.933949311895053],
+        [0.961577952111916, 3.184566795264017, 0.9440935855197615, 0.9432759503215398],
+        [1.958327232984455, 3.700852080617457, 0.9450504289838265, 0.960673989452969],
+        [2.173783168077124, 3.089797106298719, 0.9435278727702323, 0.9332670691271763],
+        [1.228064923779315, 28.14096460785721, 0.9928825144845452, 7.792137820800139],
+        [0.9599060992445935, 1.487188237285003, 0.9376680290580858, 0.8402791817063259],
+        [0.7182617648988826, 8.927774753868629, 0.9583885758586029, 1.286513664783828],
+        [7.956241839927513, 5.944892304439992, 0.9510714271236443, 1.085765256927465],
+        [6.349585346838089, 8.017838933982512, 0.9573099868942034, 1.252597834014348],
+        [2.830948726814985, 3.96632167057464, 0.9453973622344921, 0.9671328119704079],
+        [1.910035340956844, 4.078725284375699, 0.9461656175696584, 0.9817316261667626],
+        [1.753908608396987, 4.917495462567147, 0.9484808608987769, 1.028360364423628],
+        [1.021891872458365, 4.636422093239195, 0.9477325684201736, 1.012838032061742],
+        [1.610185862313712, 3.441178177005754, 0.9442471255598519, 0.9460275047086382],
+        [0.9313426746878281, 5.110924957512001, 0.9487316983215204, 1.033665056220612],
+        [1.914545383234499, 2.24026671588712, 0.9410335141744334, 0.8914257998813884],
+        [1.708195183102067, 5.966300828752454, 0.9549310848021945, 1.18353275226161],
+        [0.352779250164021, 5.394412531225864, 0.9394414638929092, 0.8665222349713396],
+        [0.4733824331092547, 5.341907031717864, 0.9437243414022048, 0.9367202859059135],
+        [0.6682098068433631, 5.248888665498635, 0.949052881004671, 1.040533667132195],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.5199707988092682, 3.015443873111232, 0.9437957390607958, 0.937981182573742],
+        [0.4138391040208274, 5.37023722339907, 0.9419682346390104, 0.9066837460214665],
+        [0.3247059432303664, 3.474149122841554, 0.9326811814936407, 0.7738950768753574],
+        [1.01959435107102, 4.882318921053029, 0.9482288135579862, 1.023081861582529],
+        [3.595733805988825, 5.229733868174425, 0.9470970559131925, 0.9999999999999957],
+        [0.7501110604783554, 5.205910734870081, 0.9489220062502335, 1.037724434051205],
+        [1.114282701785384, 3.929186717610039, 0.9458519891340296, 0.9757218465830843],
+        [0.7101216191948735, 5.335699625311948, 0.9492381039025819, 1.044534243485841],
+        [4.061694366284717, 4.514762903351902, 0.9472457364560918, 1.002975788677659],
+        [0.574333695022094, 5.304902849105217, 0.9491157535509798, 1.041888368055531],
+        [1.041767734719274, 3.765576348779356, 0.9460723408629698, 0.9799369452098913],
+        [0.926453764189299, 5.095656151264127, 0.9486928318377366, 1.032839714819409],
+        [2.645599970221164, 4.974825949529006, 0.948331466135602, 1.025225447808936],
+        [0.6172901671232185, 5.273362182831463, 0.9457777352395802, 0.9743091645210761],
+        [0.7150383004824116, 3.324571249442434, 0.9441500890319094, 0.9442867769482287],
+        [0.3764194298389176, 5.385682772354992, 0.9405207418257278, 0.8832592397711994],
+        [5.310961123108015, 4.876099047910937, 0.9480641916517895, 1.019661925669961],
+        [1.033421829180401, 5.051358461679187, 0.9485781326796029, 1.030411317768429],
+        [0.6172901671232185, 5.273362182831463, 0.9457777352395802, 0.9743091645210761],
+        [1.04074085532609, 5.035550847943607, 0.9485556644932827, 1.029936892331541],
+        [0.8223953036275852, 5.219113543986171, 0.9490856608260787, 1.041239549276826],
+        [1.111041643559328, 4.627019970165777, 0.9476385417254841, 1.01091894962],
+        [0.4733824331092547, 5.341907031717864, 0.9437243414022048, 0.9367202859059135],
+        [1.452806873509749, 3.296653777472496, 0.9437290327096076, 0.9368030371019311],
+        [0.8874411709109746, 5.078894996661231, 0.9486783716714693, 1.032532967928595],
+        [1.476284228136264, 4.966276342109289, 0.9483125433855689, 1.024829663742112],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.7893680670933163, 3.373525552450477, 0.9452207666797556, 0.9638349266519735],
+        [0.6822942964158483, 3.083441688009132, 0.943619008152089, 0.9348659109994186],
+        [5.033241570552744, 4.497540730118398, 0.9472672172363843, 1.003407106251185],
+        [0.6761536837572479, 1.406990029344396, 0.938020151443089, 0.8453703519470833],
+        [0.8828326749422669, 5.079632961506254, 0.9486792589699589, 1.032551785421084],
+        [0.7552508074541526, 5.19902626634884, 0.9489085288269219, 1.037435957853417],
+        [0.8817660685947981, 13.3790215370784, 0.9726179774749928, 1.984093453501462],
+        [0.6463505956027077, 5.261374441723223, 0.9490402488418904, 1.040261887979978],
+        [0.934177011354032, 5.12473984852482, 0.9487532121838307, 1.034122447794605],
+        [0.4412513749195269, 3.844797011116321, 0.9461134190882384, 0.9807265410096259],
+        [0.8574738820681053, 4.668749464315688, 0.9477947737257116, 1.014111440257277],
+        [0.5975189470643483, 5.286558532766763, 0.9490847397917002, 1.041219703270891],
+        [0.2780586783224702, 5.415237576679921, 0.9344921576657065, 0.7968337509506412],
+        [1.868611962790975, 3.066222361160087, 0.9430413417068844, 0.9248181329265704],
+        [0.3669723503127471, 1.024761962578748, 0.9227668273625216, 0.6673804079779572],
+        [1.838897694182412, 3.611543540243219, 0.9447852423369676, 0.9557917673767704],
+        [0.4131809200827173, 5.370532275049842, 0.9419460163915243, 0.9063153649161066],
+        [1.121127562332396, 5.082249375185969, 0.9486698656483985, 1.032352608403515],
+        [0.6076845668315757, 5.278498317882421, 0.9457226849740124, 0.973264326990528],
+        [1.186873583408987, 4.653561012758488, 0.9478756334620211, 1.01577126755622],
+        [0.9870341411239967, 5.216736281972951, 0.9466541726651422, 0.9912341444053486],
+        [2.724479942893482, 3.642561836479923, 0.944714560927666, 0.9544983919015255],
+        [0.5624516274928604, 5.311640479907353, 0.9491266626166656, 1.042123764194527],
+        [1.101925296452852, 4.670103959133639, 0.9479450766878323, 1.017200861305256],
+        [0.3007907194643737, 5.409962953436535, 0.9362017030518331, 0.8196825621645444],
+        [0.7130363631921631, 5.221025528419482, 0.9489549296323907, 1.038429779974406],
+        [0.6693321562169371, 5.249359210799492, 0.9490532157214391, 1.040540870347853],
+        [0.9870341411239967, 5.216736281972951, 0.9466541726651422, 0.9912341444053486],
+        [0.7599788406277569, 4.065247259492337, 0.945905626410405, 0.9767447095811758],
+        [0.3764194298389176, 5.385682772354992, 0.9405207418257278, 0.8832592397711994],
+        [2.86276175517897, 4.916255808519709, 0.9481151537612509, 1.0207183182003],
+        [1.772494852985838, 4.133650094611073, 0.9462344192559424, 0.9830593885516585],
+        [0.4733824331092547, 5.341907031717864, 0.9437243414022048, 0.9367202859059135],
+        [0.4965866553221996, 5.348321252802317, 0.9491670877179224, 1.042996939109435],
+        [0.5912038177700688, 5.293176623061107, 0.9490963040753327, 1.041468936994637],
+        [0.8415690742252988, 5.788796745764806, 0.9710608773098813, 1.874331703854937],
+        [0.4765122321315424, 4.04471607484856, 0.9460839288171261, 0.9801595642553302],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.7607835006573295, 2.774416080807064, 0.9430637448946481, 0.9252040078216353],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.9611729165987729, 3.996366203448538, 0.9463280565009302, 0.9848719065148478],
+        [1.060382243206794, 5.031994951023435, 0.948528352217794, 1.029360739625978],
+        [0.7820753721501444, 5.16943231189255, 0.9488747122178243, 1.036712803111628],
+        [2.721775555659274, 4.558103305933403, 0.9467174273692082, 0.9924772056960494],
+        [2.947181391193983, 4.627945457332921, 0.947534517080234, 1.008803823879965],
+        [1.566262976557277, 5.005679311856055, 0.9484540324365875, 1.027796054300499],
+        [3.185068081169218, 4.83083261981051, 0.947908186507437, 1.016440946604899],
+        [1.056241323123923, 3.156763221083123, 0.9440193999633176, 0.9419518968501143],
+        [1.886222474324422, 11.15043750472134, 0.9662809829564493, 1.600714509198054],
+        [5.537611848021599, 4.998432555062112, 0.9482796374788983, 1.02414210074842],
+        [1.3929095388709, 3.169246118833857, 0.9415969692946367, 0.9005649130222906],
+        [0.8362685583149909, 5.114938119599874, 0.9487654364227066, 1.034382510150786],
+        [0.5196373117448578, 3.045894283880684, 0.9438267152179285, 0.9385292245601903],
+        [1.96650554468118, 3.808334150809912, 0.9455243021336524, 0.969516596945402],
+        [0.7835550125962487, 5.180742534378174, 0.9488982023130887, 1.037215027951634],
+        [0.9153902276363459, 5.154899627424147, 0.9488312097100797, 1.035783924992667],
+        [1.404358655737429, 4.950813396123076, 0.9482930633666518, 1.024422526567937],
+        [0.8516843378919751, 3.327861688718122, 0.9447304224165569, 0.9547883481004333],
+        [1.326674203867935, 3.798496826330342, 0.9457741275383122, 0.9742406264744852],
+        [1.707687301255865, 4.975602902179754, 0.9483560804829837, 1.025740710083701],
+        [0.6886356512947073, 5.2341962578938, 0.949026032111182, 1.039956178185978],
+        [1.165167697144443, 4.078118438223213, 0.9463359011401447, 0.9850240408240548],
+        [0.9519268197630153, 5.117964669500107, 0.9487340314592881, 1.033714640915013],
+        [3.850363027411658, 5.154562290386028, 0.9487503353690485, 1.034061263553163],
+        [0.9406030250856343, 5.083670271640094, 0.9487360213501344, 1.033756934366959],
+        [4.158254098224353, 2.325950691287797, 0.9405620690720903, 0.8839122088228313],
+        [0.6609150186888799, 1.338481225359019, 0.9375755796381685, 0.8389520190059535],
+        [0.5406543640612009, 2.930428269714909, 0.9435448951174499, 0.9335653101869471],
+        [0.9870341411239967, 5.216736281972951, 0.9466541726651422, 0.9912341444053486],
+        [0.9132611213272179, 5.674542444595921, 0.949528625012969, 1.050868272933627],
+        [0.3617592247581735, 5.3921846151278, 0.9399175146841678, 0.8738305185210541],
+        [6.94396916295631, 4.739353148767554, 0.9477376505028513, 1.012941953941011],
+        [0.352779250164021, 5.394412531225864, 0.9394414638929092, 0.8665222349713396],
+        [2.364105988130342, 5.262069970081058, 0.9510532045092845, 1.085340237064901],
+        [0.6041813984838815, 5.286891630706981, 0.9490864391594174, 1.041256320989148],
+        [0.4849474908857468, 5.357451312334008, 0.9491830539554579, 1.043342189666297],
+        [1.352637623875839, 3.945667873965617, 0.945163138899535, 0.9627633365118393],
+        [0.6029823161354232, 3.840365406370378, 0.9459530896754319, 0.9776515272996085],
+        [0.6695967512827278, 5.246592089971211, 0.9490512589347044, 1.040498760990217],
+        [1.125289865528177, 5.546484642612992, 0.9493059144989903, 1.046006175632222],
+        [1.036768153910729, 5.10428852089632, 0.9486989000317178, 1.032968492348616],
+        [0.7808442431552783, 3.716681438586838, 0.9455462894372512, 0.9699306224040314],
+        [3.020490403165913, 4.631079692690113, 0.9479252899845768, 1.016793133692564],
+        [0.8730412135983117, 5.133817838926308, 0.9487818295585599, 1.034731457811064],
+        [1.310553435096555, 5.019956720702808, 0.948489927941401, 1.028551213585742],
+        [0.9870341411239967, 5.216736281972951, 0.9466541726651422, 0.9912341444053486],
+        [0.9102504306750826, 0.671561433888755, 0.9280983504362645, 0.7210086941853341],
+        [0.6293223600641747, 3.588914971467877, 0.9456869336544867, 0.9725869120792439],
+        [0.6903581462731357, 3.092275386001072, 0.9437527723367037, 0.9372219982445662],
+        [0.4733824331092547, 5.341907031717864, 0.9437243414022048, 0.9367202859059135],
+        [0.5031310692708215, 5.326416018281724, 0.9443283173472677, 0.9474886582207576],
+        [0.7787143959332516, 5.3761202983674, 0.9496662165804003, 1.053893600890141] 
+        ]
+      },
+     "Q":{
+       "0":        [
+[11.18034723752446, 4.480898368641861, 0.9456929129175703, 0.9989895293207498],
+        [1.024586544586682, 4.121636308287393, 0.9438864518071527, 0.96498226575515],
+        [1.506512568001045, 4.77680742478995, 0.9454514504650254, 0.9943135002520497],
+        [1.626476592149106, 4.393868359868479, 0.9462549291134185, 1.010035935106487],
+        [1.16967300558308, 6.015636818168915, 0.9484921748392373, 1.056398680478904],
+        [4.274563509668755, 2.931401209998859, 0.9414492042800693, 0.9224257154284132],
+        [16.05762582015441, 2.709406429304551, 0.9428948680618985, 0.9472299980190141],
+        [1.200864617424153, 3.589219231734243, 0.9439796723163913, 0.9666835050515912],
+        [1.006490249922131, 4.426170193928499, 0.9463473149059479, 1.011873921948085],
+        [0.9824757080727208, 4.199420490553976, 0.9465641927014968, 1.016213610519128],
+        [0.4599829931136977, 3.235693476529985, 0.9388386412032924, 0.8806049887562166],
+        [0.9033059602273215, 4.498644320454332, 0.9466430462678276, 1.017800202478161],
+        [0.7308184062578754, 1.078948671054502, 0.9349988389890127, 0.8251962931819881],
+        [0.8910797576083184, 3.355321343635638, 0.9436843664730716, 0.9613136231770866],
+        [0.6503063979016621, 1.092591622749322, 0.9405817598611719, 0.9081217523143389],
+        [0.6019654792658632, 4.382545437311649, 0.9470780844509117, 1.026638489577387],
+        [0.6517733914619304, 4.031947409229087, 0.9461287120067216, 1.007535074232546],
+        [0.7215339936303534, 2.016880395708331, 0.9410507284324146, 0.9158026648862522],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.5778885246447599, 4.240916223651386, 0.9468413511865525, 1.021811047090084],
+        [0.4100612110552109, 5.159787567495476, 0.9416196354161283, 0.9252860487478274],
+        [0.3753410715070542, 2.354572944054202, 0.9329067625305916, 0.7976765104508676],
+        [2.155684497252057, 2.473205206677667, 0.9397017906393068, 0.8940317652942986],
+        [0.9192970797971731, 3.756152986664107, 0.9449530884028948, 0.9847922030884853],
+        [0.6148146287755125, 0.5393875131472567, 0.916501358145382, 0.6296816131531847],
+        [0.6202109486780722, 3.866081115990571, 0.9459257835761758, 1.003538732546503],
+        [0.7988452790478646, 3.341698982316551, 0.9439642990700272, 0.9664025593162103],
+        [0.7689940437574975, 3.941653508090705, 0.9456444882086613, 0.9980484326622724],
+        [1.4084184735911, 2.535775986564123, 0.9403663633163568, 0.9046344069164277],
+        [0.8093598454528972, 4.60166817630149, 0.9470851513992831, 1.026783262091328],
+        [0.7485865172037481, 3.942359063012666, 0.9457003271630887, 0.9991337676065267],
+        [0.7083657343372454, 2.018244894139074, 0.9403775958819267, 0.9048156433444889],
+        [0.6162764972704361, 4.857457349696243, 0.9479963269329017, 1.045779070613496],
+        [0.9896271528120112, 4.514743695071559, 0.9524078651913934, 1.14803491873685],
+        [0.6015838468389902, 4.915702625675562, 0.9447509159436158, 0.9809786371125679],
+        [1.153206633658747, 2.426093612304335, 0.9522045745418415, 1.142907920168359],
+        [0.6105563992999468, 1.686165607953389, 0.9394930859751753, 0.8907501320208503],
+        [1.172852422789065, 4.781702044853539, 0.9453695483871211, 0.9927368178035501],
+        [1.097666651468955, 4.783042693577086, 0.9453499682708452, 0.9923605843855723],
+        [1.587246280430617, 3.109291974600319, 0.9423743092063978, 0.9381550140676916],
+        [1.303863002775856, 3.039909542057963, 0.9409321065181677, 0.9138483150226493],
+        [0.9861444197679454, 2.273307436313239, 0.9402719031251937, 0.9031129972938303],
+        [0.5528571684144721, 15.30254473969144, 0.9799290863320984, 2.80088202467189],
+        [0.793544804188038, 4.61691283496864, 0.9471493247017982, 1.028099679453775],
+        [0.3592170528634933, 5.234291135623095, 0.9397910458267926, 0.8954421424933181],
+        [0.9926426964492968, 2.375162398566572, 0.9541967897982142, 1.19511402882759],
+        [0.7159083146172229, 4.709609388681634, 0.9474845186174704, 1.035027961286466],
+        [0.6631566082078283, 3.096740585842855, 0.9527228834046847, 1.156066791263807],
+        [0.9512041036454115, 2.328213180625792, 0.9401430674124506, 0.9010456642767738],
+        [1.877363314380985, 3.023482863254146, 0.9401778801244842, 0.9016034005780245],
+        [2.138155084548583, 1.959608243082646, 0.9374638148511683, 0.8599841347049556],
+        [2.201494275789227, 13.05607409146588, 0.9596918151124859, 1.365858971376024],
+        [0.9682701522169277, 3.101964548959778, 0.9435704870807057, 0.9592578406233309],
+        [0.7641224148376127, 1.434814228739605, 0.9367987021964758, 0.8503301825860979],
+        [4.030567261490781, 21.75746836834579, 0.9747226074945722, 2.212157668992304],
+        [7.118946204664821, 3.714283177279753, 0.9426993721065675, 0.9438025524460951],
+        [2.713740961826583, 4.040369856683023, 0.943201994616142, 0.9526622068109606],
+        [1.864865054581175, 4.516256671300267, 0.9436100135065263, 0.9599704418465372],
+        [1.770578777837438, 3.324289595305627, 0.9431237932957606, 0.9512734772244656],
+        [1.020952080333013, 4.533826915593336, 0.9467403317217707, 1.01976413126701],
+        [1.565270983967975, 2.880114794107719, 0.9394424124422555, 0.8899567635718185],
+        [0.9145281377288473, 3.462828664623168, 0.94442532422102, 0.9748953453556853],
+        [1.892074146942659, 1.077098699904906, 0.9331997892574924, 0.8014272591178935],
+        [1.817460523592719, 2.405434072977119, 0.939437651354402, 0.8898822899918256],
+        [0.3413631790363634, 3.31289451160136, 0.93441967391943, 0.8174020314376672],
+        [0.4599829931136977, 3.235693476529985, 0.9388386412032924, 0.8806049887562166],
+        [0.6646304569451936, 4.778158163782865, 0.9477847154757133, 1.041308377900082],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.5161185261150263, 1.630802970411598, 0.9388856160684552, 0.8813259506141885],
+        [0.4107118712793129, 5.158843880464037, 0.9416393411325179, 0.9256178458201242],
+        [0.3202152735122998, 2.195279750392113, 0.9280012508089948, 0.7394195356949614],
+        [0.9964895179276659, 0.9119356398826372, 0.9317546870665382, 0.7832421794505501],
+        [3.567592063080699, 4.803100312990966, 0.9457448113442454, 0.9999999999999827],
+        [0.7285328461419631, 1.088138927140522, 0.9349635569930435, 0.8247175059480153],
+        [1.097354188720597, 2.835012300149759, 0.9415866963020375, 0.9247319327958643],
+        [0.6816364012572853, 12.0228860446398, 0.9638996528517801, 1.531749532034541],
+        [3.844790275195291, 1.992827349161048, 0.9384611303891108, 0.8748509859725861],
+        [0.5664091006755878, 3.628373536232189, 0.9453180798423345, 0.9917484225463821],
+        [0.9599119361138201, 1.551281928486535, 0.9496243043993567, 1.081429160123304],
+        [0.9085165751458254, 2.29992923123413, 0.9415250297987622, 0.9236962307001889],
+        [2.647176718565623, 4.090964000294405, 0.9448375447434316, 0.9826092877987473],
+        [0.6109199809772303, 4.905035757647541, 0.9447820152616556, 0.9815634440844555],
+        [0.701132038896582, 2.885668203238078, 0.9414549359432611, 0.9225216388994792],
+        [0.3736775882077429, 5.211312242859895, 0.9403333052307695, 0.9041014136351543],
+        [5.378472764867893, 4.090208942607757, 0.9444223190389492, 0.9748395290947],
+        [1.024824848604932, 4.400765885427544, 0.9462424615778129, 1.009788381126033],
+        [0.6109199809772303, 4.905035757647541, 0.9447820152616556, 0.9815634440844555],
+        [1.026498454604715, 4.169467124922167, 0.9456942036016457, 0.9990146357278457],
+        [0.8184196576258738, 4.17243626463105, 0.9459941984090228, 1.004882694360906],
+        [1.081442766485227, 4.134711348632256, 0.9447259619177247, 0.9805098651201798],
+        [0.4599829931136977, 3.235693476529985, 0.9388386412032924, 0.8806049887562166],
+        [1.43617952736879, 1.667816247261035, 0.937083938223117, 0.8544453182969873],
+        [0.8695598304857831, 2.906459988793807, 0.9425464779944156, 0.9411382591366975],
+        [1.457761362291272, 3.724495868795127, 0.9439897160279038, 0.9668671369487833],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.785959947903881, 0.980941434415155, 0.9344050694226624, 0.8172072668216167],
+        [0.6756892667862804, 1.894311382256109, 0.9390681747581767, 0.8841383836759835],
+        [5.217793170980558, 3.071032067525714, 0.9422703056799426, 0.9363615198807955],
+        [0.680188451409658, 3.032389026555154, 0.9437439633351642, 0.9623927999717432],
+        [0.8261953400229329, 5.734480471456659, 0.9596838667156256, 1.365578379728198],
+        [0.7330804517257469, 1.055079577664665, 0.9347482025948962, 0.8218063075969815],
+        [0.9677649785747895, 4.27584000495203, 0.9455144629318486, 0.9955297684443463],
+        [0.6399295405791078, 4.197784045587644, 0.9465580465294048, 1.01609014169067],
+        [0.7263969968202656, 5.862920722541313, 0.9692310030241026, 1.807096185210337],
+        [0.4346815071301248, 1.367341567280346, 0.9372070932599228, 0.8562336471000347],
+        [0.854349184365703, 4.024441937576039, 0.9455070873376792, 0.9953872591908417],
+        [0.5908659542438868, 4.091340644515466, 0.9463785196213048, 1.012496161015311],
+        [0.2763997235221043, 5.350809727805669, 0.9346991313225075, 0.8211456397184428],
+        [1.742071853910974, 4.029748958014479, 0.9428656254485037, 0.9467158231140183],
+        [0.3753410715070542, 2.354572944054202, 0.9329067625305916, 0.7976765104508676],
+        [1.740315731699128, 5.263399257772582, 0.9452904771778006, 0.991219110674733],
+        [0.4100612110552109, 5.159787567495476, 0.9416196354161283, 0.9252860487478274],
+        [1.102667596151467, 1.530139589132512, 0.937787348019226, 0.8647547678542754],
+        [0.6015838468389902, 4.915702625675562, 0.9447509159436158, 0.9809786371125679],
+        [1.183512923413298, 2.440592034536856, 0.941139059727966, 0.9172630798445405],
+        [0.9728213952364438, 4.78389921590168, 0.9453254506674981, 0.991889856750881],
+        [2.705500191061348, 3.679744174128383, 0.9437131821622012, 0.9618351307870774],
+        [0.5513983853717244, 2.542952711172847, 0.9428451348719993, 0.9463558493855283],
+        [1.095612031468902, 2.982688674702043, 0.9425638805814276, 0.9414407967509747],
+        [0.2988893191355315, 5.320521281117458, 0.9363182492651516, 0.8434819710450221],
+        [0.6941344145989141, 1.338960393163626, 0.937179542215531, 0.8558329707647583],
+        [0.6660282700782365, 4.786326035856157, 0.9478014447520632, 1.041660495987577],
+        [0.9728213952364438, 4.78389921590168, 0.9453254506674981, 0.991889856750881],
+        [0.7512102343104491, 1.634806503086148, 0.9370668840461048, 0.8541982270781187],
+        [0.3736775882077429, 5.211312242859895, 0.9403333052307695, 0.9041014136351543],
+        [2.773835025129558, 2.726346605743826, 0.9410557125692682, 0.9158849529994495],
+        [1.171195449066722, 17.44914977714484, 0.9768673097748157, 2.422572287887803],
+        [0.4599829931136977, 3.235693476529985, 0.9388386412032924, 0.8806049887562166],
+        [0.4936413180171479, 5.036207203904503, 0.948565346718086, 1.057983144886135],
+        [0.5859726399525992, 4.606832752228319, 0.9475351319091921, 1.036081804390208],
+        [0.9979969262570079, 1.25168156845218, 0.9369347331611352, 0.8522880751390252],
+        [0.4663498761346522, 2.024362401976754, 0.9390971624480318, 0.8845865087052619],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.6962476794832798, 4.170234591672971, 0.9553425190460892, 1.227247613149004],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.9637909641134341, 4.548883366376633, 0.9468174230304195, 1.021325497900414],
+        [0.9812167362957556, 0.7279236080154146, 0.9332652796787023, 0.8022700414391467],
+        [0.7691405845516391, 2.632051053115994, 0.9424872404135458, 0.9401098077647049],
+        [2.278992686994938, 9.641520788730748, 0.953287379902655, 1.17073048407064],
+        [2.893084577671012, 3.133139792795012, 0.9418221634245273, 0.9287068514963831],
+        [1.481452848648521, 4.153026213396486, 0.9467826199087227, 1.020620053739346],
+        [3.011692221115954, 1.117274793915017, 0.9335018315164944, 0.805328003608914],
+        [0.998390662458681, 2.864935567009112, 0.9507346781787609, 1.107096102062729],
+        [1.784826749853981, 11.5776663295085, 0.9655177370885039, 1.606319043982122],
+        [4.881981482850223, 2.775734439928332, 0.9420805551181363, 0.9331059521705277],
+        [1.388559608212704, 3.09044012388562, 0.9435431983918184, 0.9587664493853898],
+        [0.7874028701717534, 0.5290104360684484, 0.9186509089350945, 0.6478360551765273],
+        [0.5157026052743695, 1.645555607781727, 0.9388736587890286, 0.8811423272882662],
+        [1.931398634644963, 3.20575215303063, 0.9423164531262832, 0.9371565137318711],
+        [0.779002777601885, 4.650758141684486, 0.9472476672085742, 1.030123240798099],
+        [0.9123024863483612, 5.193732797307014, 0.9478569472991508, 1.042830332813432],
+        [1.354247222431119, 2.067401741516767, 0.9400028789467189, 0.8988062485456431],
+        [0.8122673857731774, 1.163754266730968, 0.9419653962433382, 0.9311405415021577],
+        [1.327869851578231, 4.347326007896513, 0.9459362277226204, 1.003743680545921],
+        [1.712695880173681, 3.090970049485787, 0.9429877548904771, 0.9488667322402298],
+        [0.6850855190999199, 4.723657899812343, 0.9475511763329636, 1.036416297439314],
+        [1.1322146981929, 3.602199721273066, 0.9435019380433559, 0.9580243699769974],
+        [0.8850732768084528, 1.727416843347459, 0.9427254834735582, 0.9442589844690374],
+        [3.852450515161157, 4.478450990068924, 0.9454737225069532, 0.9947430745506767],
+        [0.9350706493082093, 4.095006839802279, 0.9455128890355485, 0.9954993548038716],
+        [2.825239024625954, 14.22931184462674, 0.9686405145699554, 1.77198896414692],
+        [0.6715004793659455, 4.771909357064413, 0.9477037374054386, 1.039607134582395],
+        [0.5339366501149243, 2.050470309833906, 0.9397249553846982, 0.8943974046086928],
+        [0.9728213952364438, 4.78389921590168, 0.9453254506674981, 0.991889856750881],
+        [0.8968498629380459, 6.410357916925489, 0.9495352434426259, 1.079419394431348],
+        [0.3592170528634933, 5.234291135623095, 0.9397910458267926, 0.8954421424933181],
+        [6.640345170588127, 4.072977967770276, 0.9443503744655314, 0.9735050779308534],
+        [0.3413631790363634, 3.31289451160136, 0.93441967391943, 0.8174020314376672],
+        [2.293274650349565, 4.003092630444993, 0.9452036426966727, 0.9895574401798629],
+        [0.6003407232578406, 4.876629007686027, 0.948064685392074, 1.04723105781904],
+        [0.4815004786106712, 4.987365778425269, 0.9484722190135716, 1.055967337871887],
+        [1.103761621439964, 7.804743168908827, 0.9654366745902302, 1.602417145051817],
+        [0.5205814558260593, 5.299111299140398, 0.9619243613102335, 1.449309160667181],
+        [0.6662173622921826, 4.766059901218911, 0.947761649445235, 1.040823253556754],
+        [1.101714923750533, 5.891537522810236, 0.9485087894353634, 1.056758057897054],
+        [1.029986185377614, 4.471778232026018, 0.9463974552306665, 1.012874100605867],
+        [0.7759860956682996, 1.251852193974322, 0.9356338958220312, 0.8339039552486709],
+        [3.115681376548528, 4.105076190875265, 0.9448028235154468, 0.9819551007586438],
+        [0.866560529809375, 4.558722018747822, 0.9468912912481058, 1.022825838326409],
+        [1.290592662284292, 3.545359676927204, 0.9441905199290472, 0.9705523593750909],
+        [0.9728213952364438, 4.78389921590168, 0.9453254506674981, 0.991889856750881],
+        [0.9221452182637817, 1.335139873248158, 0.9375482610558209, 0.8612245626042702],
+        [0.6234875336282705, 1.235307574659216, 0.9362643116850444, 0.8427196093027859],
+        [0.5996308923476745, 5.730613514262066, 0.9622172228284549, 1.460987700493384],
+        [0.4599829931136977, 3.235693476529985, 0.9388386412032924, 0.8806049887562166],
+        [0.4826887430374357, 1.545742803249764, 0.9321098687641374, 0.7876400091877097],
+        [0.7749618699270725, 5.3075858596946, 0.9484287425616035, 1.055028755821165] 
+        ]
+      },
+     "R":{
+       "0":        [
+[10.78812969482567, 2.809056056503381, 0.9419611392688183, 0.9196306453372952],
+        [1.062348686942483, 4.838512359896976, 0.9459974229853807, 0.992601200382485],
+        [1.437229690932255, 4.622576132730147, 0.9456841307401731, 0.9865490772744564],
+        [1.671526396443642, 0.7381519403629774, 0.9177482817467059, 0.6322341180834317],
+        [1.171177829345666, 4.204699065467365, 0.946781926855781, 1.008068723977678],
+        [4.356577710057558, 2.849842803135944, 0.9417428528142341, 0.9159725247112704],
+        [16.39515689413529, 5.614935431531214, 0.9497590505136507, 1.071161439087951],
+        [1.204619440989354, 4.229500311824549, 0.9465770012658768, 1.003984513516486],
+        [0.9919361176671901, 3.827946750465048, 0.9457958219545018, 0.9886986831621544],
+        [0.9809813098953741, 4.478465434801602, 0.9473524869014837, 1.019607604500666],
+        [0.455268793750417, 2.56061415610313, 0.9369509918619215, 0.8420501240047037],
+        [0.8969489543808654, 4.176684513161019, 0.9467129471439848, 1.006690436356316],
+        [0.7342595343938364, 3.220533385761938, 0.9448649366234526, 0.9710490829230627],
+        [0.8899381294371396, 2.035605391650497, 0.9411463021147817, 0.9061137324007125],
+        [0.6632643741481226, 2.259835326618682, 0.9487916518839724, 1.049855229706849],
+        [0.5981734721502145, 4.029768810585892, 0.9468650869344161, 1.009735108021897],
+        [0.6423639951574788, 2.879687144325329, 0.94388527532138, 0.9531070947403042],
+        [0.7178802396558052, 1.241778783960867, 0.9377370591234542, 0.8533963426392949],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.5733867692906637, 3.529318433530652, 0.9457491412414741, 0.9877991909067845],
+        [0.3992465963458673, 3.386867472167345, 0.9376794963781095, 0.8525557603370516],
+        [0.3707787115749734, 1.492368952438654, 0.9280944221485791, 0.7313561361471781],
+        [2.153108944120619, 2.15746368091272, 0.940186104119378, 0.8906581890823354],
+        [0.9166588799683928, 4.325617968702606, 0.9470324806127317, 1.013105254457805],
+        [0.6406464824953947, 1.151042979852633, 0.9365020601660727, 0.8356962045856756],
+        [0.5513331327144843, 3.447042150144749, 0.9540350615355545, 1.176080313373179],
+        [0.7958648583922165, 3.711343683150279, 0.9459645054312542, 0.9919620055279118],
+        [0.7685595867225977, 4.792184486940148, 0.9480849058280705, 1.03479164588253],
+        [1.353412531920147, 4.659526384757196, 0.9462167363072977, 0.9968798103957682],
+        [0.7987474109681688, 2.768739130820243, 0.943640603538231, 0.9487234026213979],
+        [0.7471503557975098, 4.674500628408364, 0.9479810267955616, 1.032612070961118],
+        [0.7077576118501474, 3.431682102052048, 0.9452145066409746, 0.9776066093413569],
+        [0.6064320599891384, 2.795910429779241, 0.9439428966040285, 0.9541450407406329],
+        [0.6900206524937263, 17.76174313711376, 0.9840799454647632, 3.502556567277507],
+        [0.5977757284587885, 4.978559795014977, 0.9453970264960302, 0.98106383376405],
+        [1.218286195637439, 7.171732850713179, 0.9536488883475218, 1.165809741935833],
+        [0.5297221307506765, 2.327985953799557, 0.9534308488655906, 1.160086053397365],
+        [1.16498515676872, 4.835089830064028, 0.9460318781430443, 0.9932710877372261],
+        [1.090818293259634, 4.837117363057494, 0.9460146754875324, 0.9929365217407531],
+        [1.329701928062039, 7.709160929210804, 0.9626618912686662, 1.460901017047486],
+        [1.305025574702056, 1.685988770819348, 0.9383448781580761, 0.8623680445157729],
+        [0.9631871227847536, 2.70985840978464, 0.9443198652215542, 0.9609884670286279],
+        [0.6959428171061627, 5.483453313875422, 0.9521740287418401, 1.128111069579433],
+        [0.7832575514988106, 2.461333694133597, 0.9428444996187471, 0.9347196405022324],
+        [0.3580913049570609, 5.349187216066898, 0.9404545475126884, 0.8949289116252104],
+        [0.9721559416511754, 4.322021438990691, 0.959819466439252, 1.35354650549048],
+        [0.7125180104500219, 4.772244696839757, 0.9481606995993229, 1.036387451782354],
+        [0.6193622198918943, 3.716356620049144, 0.9573253510046252, 1.271126959003525],
+        [0.8260440157033787, 4.859952859718534, 0.951799846873027, 1.11891356842721],
+        [1.943163967872359, 2.779611702708339, 0.9410211988285854, 0.9040715320364882],
+        [1.587556297847334, 10.71345319368204, 0.9627679368906459, 1.465223394143128],
+        [1.953232162563963, 15.81013005251928, 0.9736693320803563, 2.095313171220568],
+        [0.9534424394421694, 2.174454531832357, 0.9418044157499398, 0.917001439484506],
+        [0.7595084506402277, 1.704719387127464, 0.9394525352717449, 0.879180825108772],
+        [5.175070997723267, 15.03182752558308, 0.9671764046238479, 1.669624735591866],
+        [5.795452234979228, 12.73191191397749, 0.9647665984522433, 1.551554422138117],
+        [2.457915623192201, 6.396885838098155, 0.9515802223630538, 1.113581337805848],
+        [1.839608131624617, 5.378292001149108, 0.948362214722452, 1.040653052814059],
+        [1.729785770425569, 3.92777063252648, 0.9467980494955189, 1.008391386687271],
+        [1.013941763974621, 4.558008488556447, 0.9474573892940754, 1.021756400625036],
+        [1.503216784084986, 4.927410880954657, 0.9473937894200301, 1.020452612815044],
+        [0.9203520219888118, 1.200690690350446, 0.9366201079127292, 0.8373582615282689],
+        [1.914238179089059, 2.786244296682587, 0.9427103196939723, 0.9323976927575113],
+        [1.653142240224418, 4.381859033618521, 0.9500530602967844, 1.07780031249323],
+        [0.3371874364141617, 2.281146625549799, 0.9307503486475239, 0.7615789716775316],
+        [0.455268793750417, 2.56061415610313, 0.9369509918619215, 0.8420501240047037],
+        [0.6622186812287426, 4.824060160470142, 0.9484514405470378, 1.042552406121455],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.4682054367729327, 2.695535455802287, 0.9514240825098456, 1.1098197665635],
+        [0.3998959069634645, 3.388218323274748, 0.9377076060069056, 0.8529660480036706],
+        [0.3165938509317678, 1.325650294727929, 0.9207438431839184, 0.6582716353129201],
+        [0.9644974103471431, 2.328264752820937, 0.944574936669456, 0.9656717963688283],
+        [3.559502626336459, 4.85532520277283, 0.9463755513553873, 1],
+        [0.726666489652987, 4.444519689784793, 0.9469395462073302, 1.011231575160521],
+        [1.087595799971901, 1.881075640092456, 0.9386338590969051, 0.8666958780934703],
+        [0.7350052726723504, 0.5145552746200253, 0.8967754465248152, 0.4922662072677074],
+        [3.898681934534021, 2.251582365319378, 0.9403033905862176, 0.8925193995044903],
+        [0.5647420153812099, 3.911495851918431, 0.9465747358526817, 1.003939538450084],
+        [1.011371817944537, 3.076222883191512, 0.9442105273649957, 0.9589940436814058],
+        [0.9012996932912762, 1.604377598860643, 0.9394628678875506, 0.8793405570624103],
+        [2.591392529667965, 4.529000522041071, 0.9466073595722773, 1.004587582797249],
+        [0.607002330525559, 4.967939427032064, 0.9454315865914945, 0.9817210626467218],
+        [0.7037003114358871, 1.651141029085077, 0.9358475311540515, 0.8265917230459587],
+        [0.3723816983378845, 5.319964269869418, 0.9409864879564976, 0.9035064422591603],
+        [5.386130107451474, 3.965813318008204, 0.9454759601746305, 0.9825661361282246],
+        [1.008627390884129, 2.959446145096251, 0.9437118920409518, 0.949996717566532],
+        [0.607002330525559, 4.967939427032064, 0.9454315865914945, 0.9817210626467218],
+        [1.022766362546044, 4.131163187227438, 0.946469522137099, 1.001854932912584],
+        [0.8126825749443749, 4.583348112041213, 0.9484507984123067, 1.042538713487086],
+        [1.06607259403516, 3.100300022452532, 0.9431843848086146, 0.9406503386979406],
+        [0.455268793750417, 2.56061415610313, 0.9369509918619215, 0.8420501240047037],
+        [1.406879353823353, 1.60422269434185, 0.9365099620830217, 0.8358072668611232],
+        [0.8416862948804683, 2.193302134458883, 0.944623567731583, 0.9665696011471165],
+        [1.295536353389614, 7.487579982981458, 0.9613835750765939, 1.410665226969185],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.7859129400837045, 4.738606651032792, 0.9481584769144025, 1.036340587675297],
+        [0.6452224185245733, 1.558129915040147, 0.9458632343250006, 0.9900003920125148],
+        [5.143640652237352, 3.180036112566043, 0.9434491994167244, 0.9453205313397637],
+        [0.6817698413489646, 4.481138111943139, 0.9476944695589752, 1.026644448747233],
+        [0.8623582687949437, 4.317025703493056, 0.9461562112188341, 0.9956955369377887],
+        [0.736747913813338, 3.174718540989671, 0.9447513269904017, 0.9689357653942481],
+        [0.8925985941423565, 2.553863335993529, 0.9474381020413203, 1.021360681524925],
+        [0.6305760553621533, 2.816719779666157, 0.9437659719650705, 0.9509648160892918],
+        [0.9155639962504687, 1.145725210284089, 0.9330054558540155, 0.7891218607422094],
+        [0.4434890617960738, 5.205616949910879, 0.9493592492491028, 1.062257431585997],
+        [0.6961172632086209, 6.022228349529719, 0.9686623915651078, 1.751482960076114],
+        [0.5907090249451873, 4.801900861580092, 0.9484558034479188, 1.042645447977762],
+        [0.275810429568468, 5.485588028078577, 0.935397527830919, 0.8204392100955589],
+        [1.718990537130479, 2.536239796089128, 0.9433659342258874, 0.9438473835754077],
+        [0.3707787115749734, 1.492368952438654, 0.9280944221485791, 0.7313561361471781],
+        [1.564298527623994, 5.684181872463287, 0.9516589644475331, 1.115487533546679],
+        [0.3992465963458673, 3.386867472167345, 0.9376794963781095, 0.8525557603370516],
+        [1.096567940351098, 1.904579076374502, 0.9406464135668814, 0.8980050219385582],
+        [0.5977757284587885, 4.978559795014977, 0.9453970264960302, 0.98106383376405],
+        [1.176669512106334, 4.26860239703078, 0.9469992175593681, 1.012433872718347],
+        [0.9664729243438007, 4.838526247387152, 0.9459937234736412, 0.9925293241976673],
+        [2.630994156085968, 2.836064186541127, 0.9425939630023541, 0.9303929588924854],
+        [0.5475866579183402, 1.560978793304814, 0.9391939663608935, 0.8752012839987964],
+        [1.070808747245606, 2.937363757923829, 0.9452558645137685, 0.9783879750398156],
+        [0.2981159526696194, 5.448053338416522, 0.9369987386443129, 0.8427312319312191],
+        [0.6973061321570007, 3.590449551138784, 0.9457852254756961, 0.9884943633491521],
+        [0.6631544600103254, 4.77427410234771, 0.9483105584649529, 1.03955644125658],
+        [0.9664729243438007, 4.838526247387152, 0.9459937234736412, 0.9925293241976673],
+        [0.7578513888729826, 2.955280737581775, 0.9427049427325956, 0.9323048725173056],
+        [0.3723816983378845, 5.319964269869418, 0.9409864879564976, 0.9035064422591603],
+        [2.716485073850907, 2.308454051899826, 0.940880811908352, 0.9017901313249205],
+        [1.622345814734327, 4.582904527012678, 0.9472010951742247, 1.016521584787256],
+        [0.455268793750417, 2.56061415610313, 0.9369509918619215, 0.8420501240047037],
+        [0.4916996634044551, 5.101135824649106, 0.9491208716583158, 1.057015094342875],
+        [0.5824389768996299, 4.242761368444927, 0.9472702365043086, 1.017928786385817],
+        [0.9841801771842177, 0.7757302937766273, 0.9317321126412332, 0.7733461510454602],
+        [0.4746581680065838, 2.845566828492903, 0.9425596700101924, 0.9298036673405634],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.70499459979051, 5.541062632030494, 0.949165027459142, 1.057982447019525],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.9571225470352358, 4.572670443221615, 0.9475287531693878, 1.02322311220682],
+        [1.028569489882275, 0.9272601592021383, 0.9334773148121318, 0.7951211848447073],
+        [0.7632346168884292, 1.718817681707636, 0.9394880966801656, 0.8797307982803113],
+        [2.180034677990095, 7.471495536830001, 0.9567525929902383, 1.253542035991037],
+        [2.949491045435495, 1.886406811754135, 0.9379322691927816, 0.8562585826314876],
+        [1.467502419261697, 3.08476294030229, 0.9434250064792868, 0.9448920571565307],
+        [3.133147798786227, 1.946184640035267, 0.9395743436010999, 0.8810673345139832],
+        [0.7418610806822339, 11.19855073922444, 0.9775267923707504, 2.4646935749527],
+        [1.971024031868751, 8.283522739865431, 0.9608976514923785, 1.392430788285121],
+        [5.257190658101468, 4.454281325510522, 0.9464732609608392, 1.001928870012668],
+        [1.230652957388346, 5.216627544994283, 0.9589940969245271, 1.325161716413176],
+        [0.776826695192664, 2.171477270539769, 0.9508454246635091, 1.096087690088422],
+        [0.4692884634971173, 2.506950058396198, 0.9513521644342521, 1.108095307652062],
+        [1.91734542010392, 4.783541182627685, 0.9476116618505159, 1.024932117186443],
+        [0.7606379801293787, 2.500654600124592, 0.942158307318912, 0.9229585892365738],
+        [0.9041244964864794, 4.864440063781036, 0.948221788554929, 1.03767705423818],
+        [1.348241832042906, 2.525828722932645, 0.9422429559480801, 0.9243943209880806],
+        [0.7838092626672207, 2.737501906090051, 0.9521877276444564, 1.12845052435493],
+        [1.326057993501812, 2.267903522726342, 0.9370163414796127, 0.8429825969418042],
+        [1.71869221954006, 2.755890628834477, 0.9424888034148426, 0.9285881208712999],
+        [0.6821555153916218, 5.448366802368738, 0.9500032342274846, 1.076669722439764],
+        [1.002042754701993, 6.591219510542063, 0.9589609086488918, 1.324044236054004],
+        [0.930520210658244, 1.258220815154341, 0.935944762128087, 0.8279324364191983],
+        [3.240114987517526, 9.022546114235903, 0.9604575750964944, 1.376303503233327],
+        [0.9271278079492026, 4.190091516263217, 0.9472116596323888, 1.016736359740271],
+        [3.745596228628473, 3.949851064495512, 0.9462222753095828, 0.9969883232772029],
+        [0.6685424746784605, 4.822407016428468, 0.948380943066745, 1.041051179271187],
+        [0.5267726490146136, 1.889611959461099, 0.9362594024969818, 0.8322990322094103],
+        [0.9664729243438007, 4.838526247387152, 0.9459937234736412, 0.9925293241976673],
+        [0.9019468315836718, 3.549081944162189, 0.9453841803518995, 0.9808197508561303],
+        [0.3580913049570609, 5.349187216066898, 0.9404545475126884, 0.8949289116252104],
+        [6.258409875162648, 4.867318514180213, 0.9472701864274303, 1.017927765858777],
+        [0.3371874364141617, 2.281146625549799, 0.9307503486475239, 0.7615789716775316],
+        [1.507287821349978, 12.54626915862071, 0.973335710262926, 2.068387789067608],
+        [0.5975361800443494, 4.907100918430845, 0.94865201708262, 1.046846183584533],
+        [0.4801927186261271, 5.103119107540347, 0.9491626675679254, 1.057930704691569],
+        [1.277783637450546, 3.879409874435638, 0.9462182961903314, 0.9969103673210896],
+        [0.5867622781980986, 5.97861384283904, 0.9516700667944784, 1.115756799831353],
+        [0.6624915280929036, 4.299741235656552, 0.9474416389630292, 1.021433227266031],
+        [1.072435825259393, 2.072918578500243, 0.9410178153413334, 0.9040164199216018],
+        [1.018838771613678, 0.8117024024606706, 0.9322899331052207, 0.780184071812033],
+        [0.7793764600458787, 3.912179174124886, 0.945667672577911, 0.986233071059592],
+        [3.163850312660106, 2.680601353009786, 0.9416240755114283, 0.9139935064501841],
+        [0.8545017511774331, 2.675389120269593, 0.9433147643452582, 0.9429442207901686],
+        [1.308343128906831, 2.014088625684839, 0.9371943893170919, 0.845533005190268],
+        [0.9664729243438007, 4.838526247387152, 0.9459937234736412, 0.9925293241976673],
+        [0.9124152543803302, 0.8866714346173662, 0.9340667112743068, 0.802735526197732],
+        [0.627995217432276, 4.604570579884744, 0.9479683737678493, 1.032347181541612],
+        [0.6780679909219569, 1.623627630049479, 0.9364884812677792, 0.8355054162892691],
+        [0.455268793750417, 2.56061415610313, 0.9369509918619215, 0.8420501240047037],
+        [0.4891507724798315, 3.855632850974779, 0.9415037639254387, 0.9119971178299242],
+        [0.7718445301010164, 5.272635775366789, 0.9493073548034985, 1.061111984280081] 
+        ]
+      },
+     "S":{
+       "0":        [
+[11.06068354553148, 3.816573110401264, 0.944862052846131, 0.9979007402164507],
+        [0.9905918651134733, 3.516125600478785, 0.9424425855865139, 0.9535053977402546],
+        [1.353702155678046, 3.809362140332378, 0.9432650651718507, 0.96817244936752],
+        [1.593313307174389, 1.398766015478182, 0.9377027878886969, 0.8765286695943493],
+        [1.135667015806876, 2.693358588821605, 0.9410088345787139, 0.9289155967527435],
+        [3.612069376099438, 4.028308758160527, 0.9533399272064462, 1.189794345114796],
+        [9.363704082208974, 19.35603812574177, 0.9710367575052189, 1.952351541772616],
+        [1.142836432946535, 3.977487995967616, 0.9477154758204196, 1.055539142124724],
+        [0.9770874721966993, 2.604184567065243, 0.942278377297801, 0.9506271723682576],
+        [0.9667146326095906, 3.872206504912435, 0.9455422811420016, 1.011092847832352],
+        [0.4545888896235202, 1.584493542598139, 0.931897766459426, 0.7968497585521587],
+        [0.8901860081230748, 3.212311499220675, 0.9442093110581753, 0.9855441504160992],
+        [0.7299162307251069, 2.057060291487292, 0.9412113987661486, 0.9323169527829884],
+        [0.870603507092227, 1.650288958872983, 0.9365563002521792, 0.8596366415791528],
+        [0.6977552847894317, 1.115881395633205, 0.9342322017557844, 0.8272010176894663],
+        [0.5895287759611544, 1.323149875757928, 0.9360872505470972, 0.8529004815581304],
+        [0.6374468091777974, 1.341378814257141, 0.9365006752770174, 0.8588325939933508],
+        [0.715008686492682, 0.821295787709961, 0.9325231805975894, 0.8047751599258098],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.5657354949139467, 1.351858462614449, 0.9359641276880344, 0.8511486296472009],
+        [0.3959972179607451, 1.56669095841149, 0.9294325903893369, 0.7669786085850357],
+        [0.3696489740203301, 1.065358563048868, 0.9235135371878166, 0.7031180047012714],
+        [1.746844388612353, 2.508970095420962, 0.9490560496080497, 1.084847701696702],
+        [0.8346352478639628, 4.025415273265618, 0.9570955683525717, 1.299040473150563],
+        [0.5535594689866441, 7.801622764581482, 0.9675634960615596, 1.737060585885086],
+        [0.6138235675290045, 1.511487418984302, 0.9381292639870522, 0.8829719989670667],
+        [0.7401666874910552, 0.9526335053276247, 0.9416699980651634, 0.940104806741781],
+        [0.733516567753279, 2.97953767694025, 0.9423255437373543, 0.9514522229666564],
+        [1.129368811968888, 7.826141632047073, 0.9567677631335687, 1.288749047667074],
+        [0.7936949481250314, 1.171175394241417, 0.9367680986749666, 0.8627110921132678],
+        [0.7353806029217653, 1.135694483430806, 0.935043168603033, 0.838255400394353],
+        [0.6956261762082447, 1.431498101918337, 0.9352398430548079, 0.8409780061234936],
+        [0.6043094929532038, 1.172024493430479, 0.9363948732065202, 0.8573071282218251],
+        [1.040641535497749, 0.914147660251977, 0.9316526361006243, 0.7937829723079391],
+        [0.5952822405761029, 4.558022586117254, 0.943968000038748, 0.9810489523108232],
+        [1.1102693642929, 2.915266500103108, 0.9530946529849152, 1.183268245916398],
+        [0.6076253273199975, 1.376856957306921, 0.937431905452479, 0.8724817103020196],
+        [1.145383535355845, 4.405081042312656, 0.9445530078477438, 0.9920141654441427],
+        [0.9607149000413434, 2.123973608030842, 0.9378453575921186, 0.8786728167704214],
+        [1.358512020445711, 6.715606939722814, 0.9490821345772309, 1.08543329627942],
+        [0.9873989988548008, 12.00474242084451, 0.9748491360822686, 2.257116803376011],
+        [0.977350052724122, 1.883839772962584, 0.9395834190717803, 0.9056256825309754],
+        [0.7277055409447957, 8.425311334685189, 0.9542623439417944, 1.214964007353179],
+        [0.7788527760728459, 0.9918052362324909, 0.9353346259074308, 0.8422960188948783],
+        [0.3588030498908227, 4.969027096053083, 0.9388811333072228, 0.8945504728147384],
+        [1.044961144407358, 1.930014226678619, 0.9375287209023458, 0.8739240942171072],
+        [0.6841949521631869, 3.676806341044756, 0.9450485789346614, 1.001485661240503],
+        [0.6991383311320762, 1.944688668666185, 0.939953726097461, 0.9115698258870029],
+        [0.9156382224400964, 3.675316700727334, 0.9454155892691428, 1.00861091391093],
+        [1.417504351855854, 9.438355012051282, 0.9633532320000207, 1.530803371848489],
+        [1.827577544796393, 4.994059117759004, 0.9547654250940646, 1.229124004292236],
+        [2.496456043795336, 5.207776707436012, 0.9469532519106589, 1.039535450574808],
+        [0.9421523931080382, 1.594791383927175, 0.9401129391057188, 0.9141480995713646],
+        [0.7492439942162573, 1.490767658837613, 0.9355983338972654, 0.8459834500541806],
+        [6.837524968313912, 6.993374027888541, 0.9505749312850451, 1.119975713711505],
+        [6.604982186721204, 4.562954939074499, 0.9465588564424878, 1.031433922565938],
+        [2.452997565936865, 5.00879609970829, 0.9447242964497653, 0.9952686762978314],
+        [1.699703577964441, 4.11045575651221, 0.94010875998414, 0.9140802482622252],
+        [1.713244852557661, 3.611620972985155, 0.9448097142695896, 0.9968991773791416],
+        [0.9932290270518612, 3.874126450781257, 0.9455181817304175, 1.010619843705007],
+        [1.409170956370602, 5.381126165193419, 0.9480895215306807, 1.063564529726713],
+        [0.9073549692919931, 1.603533533137748, 0.939427579752838, 0.9031458891254128],
+        [1.678838532372776, 3.617068515147376, 0.9504174968726684, 1.11623466409673],
+        [1.778696531154808, 2.88288947138859, 0.9414779694617853, 0.9368289562221376],
+        [0.3361344301665941, 1.358629222065568, 0.9245901741340248, 0.7139879233637462],
+        [0.4545888896235202, 1.584493542598139, 0.931897766459426, 0.7968497585521587],
+        [0.6143377639273044, 10.32223054199844, 0.9680695799358637, 1.765515243119847],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.5159176940966257, 2.768690029087924, 0.9428609559251435, 0.9609133158012932],
+        [0.3966446736747346, 1.568220623013896, 0.9294710314481601, 0.7674283813596063],
+        [0.3261312971010301, 3.982091039753542, 0.9343243569755242, 0.8284434474127059],
+        [0.968338874130528, 1.049790588611517, 0.9368805467177735, 0.8643517648508229],
+        [3.521682120801988, 4.455037791579503, 0.9449714322263242, 0.9999999999999744],
+        [0.7246591467753455, 2.497738797923661, 0.9420051440256146, 0.9458740925502586],
+        [1.095565430585632, 1.620622155196183, 0.9382859831440676, 0.8853621344536272],
+        [0.7031250242367075, 1.098896879585567, 0.9333270940734036, 0.8151809449939792],
+        [3.301705769511526, 7.211957154263627, 0.9463667628959558, 1.027531156213937],
+        [0.5559763715530031, 1.312820264593896, 0.9356669179426539, 0.8469474148361102],
+        [0.9190156793783695, 1.494524476771883, 0.9532392137891987, 1.187106342754886],
+        [0.8841892637410582, 1.336962363816522, 0.9357152534376494, 0.8476280171270484],
+        [1.642149610475968, 13.06966822201914, 0.9719919153646868, 2.020918375208916],
+        [0.6040548044939038, 4.544889446100512, 0.9439947501678958, 0.9815453509134717],
+        [0.7043020100177031, 2.108349022360673, 0.9401942692885643, 0.9154704467055439],
+        [0.3730235106607017, 4.935853122642845, 0.9394261183489765, 0.903122694922659],
+        [4.538431428498892, 1.121302950896116, 0.9330262439426618, 0.8112575169264518],
+        [0.994864632435898, 1.483181822662749, 0.9378419905211528, 0.878622065007857],
+        [0.6040548044939038, 4.544889446100512, 0.9439947501678958, 0.9815453509134717],
+        [0.9105246228776706, 2.874283953906465, 0.9587981228719364, 1.355126077262049],
+        [0.806862814609323, 1.526658681687112, 0.93476901522762, 0.8344876305945487],
+        [1.052038096084133, 1.956639434689168, 0.9358102749823825, 0.8489689843581599],
+        [0.4545888896235202, 1.584493542598139, 0.931897766459426, 0.7968497585521587],
+        [1.39917716819155, 2.465292658523523, 0.9412776758110798, 0.9334349386237329],
+        [0.8516688663297138, 1.512380169853212, 0.9373411428736805, 0.8711335517884474],
+        [1.306929772349115, 8.933280573135454, 0.9565808370347638, 1.282950084920996],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.7333919063216033, 2.718069382516002, 0.9499684883448706, 1.105694386551932],
+        [0.6745317971176323, 2.176062658996394, 0.9407110767832025, 0.9239579893503528],
+        [4.779269930088894, 3.18704547368737, 0.9438534192039582, 0.9789280431190097],
+        [0.6727101196698074, 1.784627648881428, 0.9399603030870997, 0.9116760619905819],
+        [0.8348972083577191, 2.173382144091015, 0.9381873375652483, 0.8838562699691918],
+        [0.7323702823897656, 2.005678407267879, 0.9410316760649092, 0.9292979705538189],
+        [0.9164852538318055, 3.148383647092637, 0.9527937587089141, 1.175354872110527],
+        [0.6263866384736811, 1.276802290131041, 0.9361713127069592, 0.8541004412589287],
+        [0.9056656205373974, 1.633213870591462, 0.9388589943414706, 0.894205472899659],
+        [0.4303239962857336, 1.288175100197175, 0.9343619595520624, 0.8289514046977757],
+        [0.836287467390373, 1.979590063782468, 0.9381505041253332, 0.8832952243238485],
+        [0.5899338955775361, 4.308173698034554, 0.9469620320281638, 1.039717179566103],
+        [0.2424999250158407, 0.574117994303465, 0.8953612507458759, 0.4982820992536341],
+        [1.628143025698217, 5.469433949525095, 0.948103407346282, 1.063864685739361],
+        [0.3696489740203301, 1.065358563048868, 0.9235135371878166, 0.7031180047012714],
+        [1.667845224215208, 4.350893395998101, 0.9452553872379355, 1.005488952475343],
+        [0.3959972179607451, 1.56669095841149, 0.9294325903893369, 0.7669786085850357],
+        [0.9474329872076606, 1.232788531328558, 0.9510213670692131, 1.130714979416718],
+        [0.5952822405761029, 4.558022586117254, 0.943968000038748, 0.9810489523108232],
+        [1.008221125405056, 2.628881695480063, 0.9547867066084683, 1.229729952357917],
+        [0.9525915466530176, 4.407381339094592, 0.9445170246641148, 0.9913330332924051],
+        [2.132294466053377, 3.752451745226573, 0.9558069432081413, 1.259463740614761],
+        [0.5443829316780486, 1.167917715057708, 0.934439107389248, 0.8299953862402252],
+        [1.083511027954356, 2.374929469027111, 0.9412349879474945, 0.9327145748170795],
+        [0.2987019173062623, 5.065618973415831, 0.9352964031208246, 0.8417640433624921],
+        [0.693351303705059, 2.448950914586029, 0.9424918434050501, 0.9543719883557314],
+        [0.6598906542984316, 2.588251482312283, 0.9404286059795762, 0.9193007155615378],
+        [0.9525915466530176, 4.407381339094592, 0.9445170246641148, 0.9913330332924051],
+        [0.7524779338837169, 0.7446427133808859, 0.9303469013295366, 0.7778108624397466],
+        [0.3730235106607017, 4.935853122642845, 0.9394261183489765, 0.903122694922659],
+        [2.658582811489595, 2.872360360338345, 0.941070775445263, 0.9299531947017483],
+        [1.552767101436889, 3.923217785617128, 0.943190922429187, 0.9668328655898445],
+        [0.4545888896235202, 1.584493542598139, 0.931897766459426, 0.7968497585521587],
+        [0.4806103505090467, 1.117152930343539, 0.9297167892038015, 0.7703154535033095],
+        [0.5720173078686628, 1.415198466538758, 0.9363540747179329, 0.8567202461031581],
+        [0.9681182614475441, 0.6957069539125786, 0.9281619202216876, 0.7523822853174527],
+        [0.4678658386812885, 1.076911893394447, 0.9344094476985675, 0.8295937341772338],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.7440369547903271, 2.808162340448181, 0.9425707734203395, 0.9557637001346545],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.9369490895832873, 3.524165363715859, 0.9448201860351009, 0.9970994154094056],
+        [1.022964548177091, 1.488810687396624, 0.9385021268576315, 0.8886785445446486],
+        [0.7489845833854439, 1.720530748492622, 0.9365637071155469, 0.8597438126491955],
+        [2.472303070467769, 2.131851335927968, 0.9381002223413112, 0.8825304118627446],
+        [2.933056706597099, 2.54871738513811, 0.9423692400847216, 0.9522177786949331],
+        [1.32324341343766, 2.638854752625421, 0.950010770972076, 1.10667887682736],
+        [3.104513343237929, 1.06768475527531, 0.9321075348887297, 0.7994917215031799],
+        [1.029096455183013, 2.580615831848855, 0.9391114537037448, 0.8981545246751699],
+        [2.175601799074316, 2.990777045261312, 0.9459138862550084, 1.018439779294826],
+        [3.207569943691294, 14.84476100700312, 0.970309134569753, 1.903078897112881],
+        [0.9668162821564855, 6.299025260277215, 0.9683895379211405, 1.783975043794768],
+        [0.7388042484178509, 8.153783348654642, 0.9643953083602476, 1.577311211504095],
+        [0.5142249919551841, 2.565613876843372, 0.9424267765000998, 0.9532275835140969],
+        [1.857712499583662, 4.262815666672706, 0.9468783274089358, 1.037987122861642],
+        [0.7041312293613737, 3.854843921400437, 0.9550861887537909, 1.238317999376383],
+        [0.8929894395821947, 1.021754784898392, 0.9303644979510063, 0.7780221274957863],
+        [1.32051539721137, 1.679443556735321, 0.9386841428218748, 0.8914894491734887],
+        [0.8376375974051539, 1.808370229453197, 0.939435759646052, 0.9032757343444167],
+        [1.28550163233984, 2.240701033437775, 0.940697470756403, 0.9237326411609692],
+        [1.688797814270611, 2.171174001124542, 0.9402113341395875, 0.9157483606689489],
+        [0.6769600366063248, 3.166213544690184, 0.9441300491814095, 0.9840633590686275],
+        [1.04033408393951, 1.890076303311351, 0.9501364607187474, 1.109615240490466],
+        [0.9183613650007935, 1.788032346830897, 0.9399174234066839, 0.910983858109319],
+        [2.169229774422556, 7.653511893168131, 0.9635890692236883, 1.541095718949313],
+        [0.9215905947472344, 3.144693366274475, 0.9440610376582832, 0.9827774849718809],
+        [3.785157971868437, 3.913351090011297, 0.9448564591356162, 0.9977936069676694],
+        [0.6593753178538507, 1.709521014898612, 0.9399095754696737, 0.910857276323682],
+        [0.5365538629258889, 3.849592202652734, 0.945436464981334, 1.009019082617674],
+        [0.9525915466530176, 4.407381339094592, 0.9445170246641148, 0.9913330332924051],
+        [0.8904726457826453, 4.057127539006651, 0.9464974641552557, 1.030183567855583],
+        [0.3588030498908227, 4.969027096053083, 0.9388811333072228, 0.8945504728147384],
+        [4.989920580866467, 6.74535222101009, 0.9550106411808363, 1.236140789309557],
+        [0.3361344301665941, 1.358629222065568, 0.9245901741340248, 0.7139879233637462],
+        [2.261371453194074, 4.963790565591463, 0.9461400189291395, 1.02296022102168],
+        [0.5966091977564068, 4.459566135672513, 0.9472612624901938, 1.045946758993121],
+        [0.4268459110933016, 0.7136282161749273, 0.9278675147304972, 0.7490737953244572],
+        [1.24288674747901, 2.439090554532662, 0.9483462950310055, 1.069141049187109],
+        [0.5948534706874467, 0.8902567247833811, 0.9322101584521291, 0.8007901870307772],
+        [0.6220202524265277, 0.5789842931499822, 0.921704093929096, 0.6855229400180477],
+        [0.9786596897238061, 2.636426793195747, 0.9516961550569416, 1.147324171678652],
+        [0.9362535537683131, 3.346390388576862, 0.954380903156924, 1.218272912047916],
+        [0.7720406926623847, 0.7646454894439597, 0.9308797849801826, 0.7842563593400814],
+        [3.047881350340019, 2.480389189070034, 0.9408215421932721, 0.9257913952863275],
+        [0.8477870112922012, 1.132759216131059, 0.9363874986664721, 0.857200990472775],
+        [1.140854534954223, 1.088330595276648, 0.9420907341534394, 0.9473581669439473],
+        [0.9525915466530176, 4.407381339094592, 0.9445170246641148, 0.9913330332924051],
+        [0.8792244582560594, 0.9373507466338445, 0.9418641056659083, 0.9434381168790426],
+        [0.6125548708955219, 1.460985924069533, 0.9345153840308384, 0.8310299969042295],
+        [0.680623371580323, 2.947382892371735, 0.9426696350921854, 0.9575122571869766],
+        [0.4545888896235202, 1.584493542598139, 0.931897766459426, 0.7968497585521587],
+        [0.4869226584954957, 2.695429436956491, 0.9377505116208015, 0.8772453070961865],
+        [0.590624259329866, 8.356720002032832, 0.9749811974188558, 2.269338339366311] 
+        ]
+      },
+     "T":{
+       "0":        [
+[10.80840095443188, 2.947526458533005, 0.941824578042855, 0.9323649425975788],
+        [1.008151724255912, 4.637754754671719, 0.9447235308508455, 0.9842828007017564],
+        [1.337320101613619, 4.171378490575203, 0.9437506110063628, 0.9662619862107817],
+        [0.6971806347532077, 15.88827856191629, 0.9884380399351733, 4.923494346910758],
+        [1.153393695486172, 3.010257619840885, 0.9407472179317516, 0.9143651267776282],
+        [2.823136394054174, 7.229179746576412, 0.9581312191820464, 1.317923294108899],
+        [16.16071562593232, 3.892218862714052, 0.9455283894213953, 0.9996772628532372],
+        [1.090922885280825, 2.450107489040728, 0.9400421377135449, 0.9029353144029292],
+        [0.9601787524402912, 1.211432600123507, 0.9362550578100325, 0.8458705466265807],
+        [0.9459785441278149, 4.036138976356831, 0.9455480162694428, 1.00005834806447],
+        [0.4624116143125557, 5.251958417435707, 0.9431523842368533, 0.9554876323058493],
+        [0.8377479170203965, 0.7135893858653376, 0.9327912815535299, 0.7993082982875647],
+        [0.7179436638458857, 1.552497967060302, 0.9383427965778341, 0.876462137283693],
+        [0.8781816544769152, 4.097468451320567, 0.9457160323557858, 1.003331913549291],
+        [0.6975288678556538, 2.495945022513482, 0.9418217491707676, 0.9323168067562921],
+        [0.5947672499530842, 4.934152412867804, 0.9479852966680727, 1.049617186824044],
+        [0.6282337973603143, 1.573492602826086, 0.9367320140629506, 0.8526814428573366],
+        [0.6612087224079782, 3.904050939150324, 0.9592592526983945, 1.356008662054164],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.5680366854481015, 3.510808571998405, 0.9449525225898058, 0.9886168870227963],
+        [0.3915861840358776, 1.613484173456935, 0.9290330575291494, 0.7539291423751954],
+        [0.3655504988110999, 1.049654318457793, 0.9225625650296666, 0.6861203917935683],
+        [1.990874518454894, 2.207735013497621, 0.9389753798671193, 0.8861445650476391],
+        [0.8961100362337393, 3.541490677734525, 0.9434074036758857, 0.9600528014203916],
+        [0.6316301529167554, 7.680120459720781, 0.9528625334972838, 1.16417822476515],
+        [0.6010764859519881, 1.240564050297198, 0.9326561968581145, 0.7975894468071845],
+        [0.7589650717411663, 0.7465643238877078, 0.9347897184326263, 0.8255688716254939],
+        [0.7563624899396589, 4.678343291850169, 0.946792999734885, 1.024806145955522],
+        [1.285901667653268, 6.034645819894502, 0.9505468982424639, 1.106969029650072],
+        [0.7844767858710826, 1.228908503440493, 0.9363499078787706, 0.8472168667572525],
+        [0.7362070309964938, 3.171013124600213, 0.9425917158798083, 0.9455935690473314],
+        [0.7000016210193835, 3.568534902369307, 0.9449695165208594, 0.9889399658958962],
+        [0.5981213908963097, 1.20784919688082, 0.9359808189768699, 0.8420003897942866],
+        [1.029272696471099, 0.7678353226880468, 0.9268203472273896, 0.7293914579640421],
+        [0.5857777686081304, 5.024222409765639, 0.9446536670730161, 0.9829676413469437],
+        [1.242286570316487, 3.182908235304885, 0.9415897197717761, 0.9283844897334972],
+        [0.5977889251293661, 1.104989514195427, 0.9322276340431664, 0.7921816588093666],
+        [0.9968437904341365, 2.251270760768641, 0.9375376576449895, 0.8644222007826562],
+        [0.986082338372835, 3.504833761359529, 0.9419383972502793, 0.9343055713106302],
+        [1.574022347939227, 1.837793952927539, 0.9376835674199351, 0.8665810335217959],
+        [1.252512331633946, 1.577109637538539, 0.9364884440490066, 0.8491905017939114],
+        [0.8134653939436665, 4.05517765919716, 0.9608620951831138, 1.413900820141699],
+        [0.6580082619616157, 6.438631511528582, 0.954446209968392, 1.206653007852589],
+        [0.7702651236499033, 1.02518384260078, 0.9348197581325879, 0.825975894676352],
+        [0.3319420217955247, 0.7792180708439435, 0.9149998328924682, 0.6199500408933606],
+        [1.052152991112576, 2.015201790385512, 0.9350432763835517, 0.8290162781925645],
+        [0.7009721098110482, 4.792155781551645, 0.9472126099078756, 1.033410187555308],
+        [0.6917520494340479, 0.9467372470609469, 0.9317770950719513, 0.7865698228732404],
+        [0.8499710402407563, 5.280397027137441, 0.9499288409334056, 1.092594189517064],
+        [1.88018493768605, 1.693931670394067, 0.9346555214527192, 0.8237551391557053],
+        [1.564218744747156, 11.4280938120589, 0.9592824286573223, 1.356813266287757],
+        [2.092718347126335, 15.12794802854428, 0.9636640262348911, 1.527370159407693],
+        [0.7895971332954329, 3.207633158110885, 0.956714120990261, 1.272891541928881],
+        [0.7491224261014795, 3.818739550249, 0.9451781455117383, 0.9929226243550942],
+        [7.548393093027906, 5.680490549934322, 0.9468729034083968, 1.026434082029394],
+        [4.426786418719244, 18.23991542392465, 0.9740162390535132, 2.15883595898276],
+        [2.663832249478994, 2.665895161415197, 0.9370526696448481, 0.8573183984492946],
+        [1.822378482521972, 3.698595333411069, 0.9430016164939738, 0.9528079142837901],
+        [0.934081339509748, 12.01915386194756, 0.9794197065887914, 2.740770894430637],
+        [0.9813869535808237, 4.499634439328004, 0.9465182888823169, 1.019246371088536],
+        [1.456299317814731, 4.302895209971355, 0.9431437716435064, 0.9553341709261904],
+        [0.9014688245603328, 1.050218486461681, 0.9341044062723859, 0.8163840348041961],
+        [1.776108432170527, 2.389746331744126, 0.9409927879411674, 0.9184101120289306],
+        [0.9741751402738332, 12.49542442831725, 0.9805754248175782, 2.907267095774359],
+        [0.3356938035067066, 2.191362313331218, 0.929341074931083, 0.757466733130533],
+        [0.4624116143125557, 5.251958417435707, 0.9431523842368533, 0.9554876323058493],
+        [0.6097140264190474, 0.5340042632143802, 0.9148720426842434, 0.6189329470075201],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.5058829341520034, 1.313629500943425, 0.9346347394471906, 0.8234749269681986],
+        [0.3922202323199375, 1.615237425346651, 0.9290722093400061, 0.7543770977841621],
+        [0.3155626841499814, 1.581674704959087, 0.9236105039419719, 0.6963228968980251],
+        [0.8908328745306149, 9.026258022498052, 0.9641329090466072, 1.548090019235852],
+        [3.513371008766224, 4.845605971868364, 0.9455450121142229, 1.000000000000002],
+        [0.7055996751415592, 2.625788167256555, 0.9409732799560374, 0.9180875493431789],
+        [0.9930227429973235, 3.532606329861644, 0.9522767276523628, 1.149180937636387],
+        [0.4090295881406837, 14.95256181562124, 0.9837323910811495, 3.482640980296047],
+        [4.103635991873718, 2.475663604766429, 0.9395387523870847, 0.8949382100197392],
+        [0.5616830703514373, 4.749564858970151, 0.9476749129697095, 1.043049411672837],
+        [1.00963888281062, 1.549145475819713, 0.9351617923877743, 0.8306368838349513],
+        [0.8911603689338183, 4.384867646911118, 0.946299864391337, 1.014866350884505],
+        [2.299925037539964, 5.418022669913439, 0.9430106222379619, 0.9529675825466519],
+        [0.594396927346709, 5.013114869611615, 0.9446860185412221, 0.9835762325658354],
+        [0.695624032119029, 1.311529365754079, 0.9346305048157794, 0.8234178515707243],
+        [0.3698111352524125, 5.448076576246256, 0.9403493089839474, 0.9078815458273306],
+        [3.95110744273148, 4.041158467900254, 0.9556492037289108, 1.240945014192929],
+        [0.9714354201688598, 1.957558079460152, 0.9388339295150847, 0.8839621174493735],
+        [0.594396927346709, 5.013114869611615, 0.9446860185412221, 0.9835762325658354],
+        [0.99973554082403, 2.185670508381576, 0.9386085162351148, 0.8805049831938033],
+        [0.7043655112302247, 1.740281978828846, 0.9494002341629569, 1.080578407879679],
+        [1.048146688418911, 2.307185331992442, 0.93930161110052, 0.8912167928156379],
+        [0.4624116143125557, 5.251958417435707, 0.9431523842368533, 0.9554876323058493],
+        [1.121332622399752, 5.056093749043404, 0.9630767238787823, 1.502159734268786],
+        [0.7745882896235469, 4.862949720761006, 0.9619967859542946, 1.457836270240486],
+        [1.264905195065813, 10.69454614421334, 0.9610206179901774, 1.419885138504165],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.7693624385534996, 2.386100761398825, 0.9406423495927617, 0.912647952402588],
+        [0.6655880353045904, 1.060187139516389, 0.9326705811475126, 0.7977721479925328],
+        [3.443189291588161, 4.090812540779129, 0.956502264441865, 1.266411400860289],
+        [0.6687937344925873, 3.58990367655667, 0.9450144600883394, 0.9897953697012709],
+        [0.8566698066292835, 3.754215526772672, 0.9448743206210539, 0.9871327234514363],
+        [0.720202955233607, 1.500530618251472, 0.9380424673117436, 0.8719344630136129],
+        [0.8286348561725201, 7.765498015720618, 0.9550653447419025, 1.224072469330194],
+        [0.6179743745228936, 1.462156636263625, 0.9362067179642127, 0.8451859416674525],
+        [0.8871006399037147, 2.400211054317147, 0.9408541513701586, 0.9161223865838519],
+        [0.4340164436789694, 2.884726087362778, 0.9434088973158528, 0.9600796606535207],
+        [0.8321721908282758, 0.8999646063647454, 0.9278701483553877, 0.7408454561344073],
+        [0.5837642929366245, 4.693403583372052, 0.9475600377280869, 1.040638343080859],
+        [0.2588160062507585, 0.9797197009451161, 0.9129432976589695, 0.6039445270863373],
+        [1.660421312620718, 1.47851467634138, 0.9430312210129483, 0.9533329804279482],
+        [0.3655504988110999, 1.049654318457793, 0.9225625650296666, 0.6861203917935683],
+        [1.620295377979641, 3.730279809909891, 0.9427424373747617, 0.9482342943555792],
+        [0.3915861840358776, 1.613484173456935, 0.9290330575291494, 0.7539291423751954],
+        [1.075951014192445, 0.7655055860885014, 0.9261404025950527, 0.7221465691153397],
+        [0.5857777686081304, 5.024222409765639, 0.9446536670730161, 0.9829676413469437],
+        [0.9719784866212154, 4.728078456045701, 0.9566393119330144, 1.270596095122188],
+        [0.9362958748854441, 4.845818186908989, 0.9451491918685347, 0.9923680983432766],
+        [1.338557261162872, 15.75803685203353, 0.9781569921392145, 2.579001409105687],
+        [0.5440105991352522, 1.495242956852464, 0.9380152170905679, 0.8715258179188758],
+        [0.8483151725937743, 3.82849805661408, 0.9630949431140485, 1.502929749816984],
+        [0.2576858940242121, 0.5481491055241765, 0.8935534793195531, 0.4834421774710517],
+        [0.6825573357180791, 1.929642324069177, 0.9401168697340876, 0.9041340172804689],
+        [0.6127533551364345, 0.5501272911085585, 0.9176334832366321, 0.6416142626957571],
+        [0.9362958748854441, 4.845818186908989, 0.9451491918685347, 0.9923680983432766],
+        [0.7333796042202813, 4.789765408551433, 0.9456741557886779, 1.002514110993527],
+        [0.3698111352524125, 5.448076576246256, 0.9403493089839474, 0.9078815458273306],
+        [1.264305842726892, 16.36082756809632, 0.9828806987456933, 3.306512965885502],
+        [1.658402123476139, 2.325206707800739, 0.9367692910321451, 0.8532180840322986],
+        [0.4624116143125557, 5.251958417435707, 0.9431523842368533, 0.9554876323058493],
+        [0.4368390527785345, 0.7922951343138185, 0.9305143273969567, 0.7712288309818353],
+        [0.5765460073858111, 4.268502073262613, 0.9465878987689804, 1.020649770942982],
+        [0.9552857393758107, 0.6369925305368269, 0.9264231447107997, 0.7251429554188591],
+        [0.4672491188943227, 2.288164683049092, 0.9406793734265561, 0.913253508545612],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.7377537337693165, 1.111200285756099, 0.9330997070359588, 0.8032587983831252],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.9277887753361992, 4.524952167322899, 0.9466267697465151, 1.021435038705595],
+        [1.008281962305719, 1.948012181536849, 0.9396525300403333, 0.8967340856527211],
+        [0.756885054672696, 1.329833029058879, 0.9372467960641683, 0.8601486620208759],
+        [2.440282364848406, 4.717361535001106, 0.9508117778857318, 1.113240211274433],
+        [1.596121653206893, 11.58499811490663, 0.9765193618923192, 2.395115279601876],
+        [1.221880224387309, 9.267927316075497, 0.9645011251967078, 1.564745130908953],
+        [3.062270117011274, 1.4081304071611, 0.9320839172646197, 0.7903834602078587],
+        [1.017465290096347, 1.282747484590266, 0.9304065449919502, 0.7699452015562014],
+        [2.184877342268213, 4.844548039949717, 0.9483228939796945, 1.056850381048444],
+        [5.056991245293612, 3.46055307476221, 0.9437275338506624, 0.9658421073791111],
+        [1.182963320633529, 5.996293393855261, 0.9467454083419781, 1.0238388529665],
+        [0.8152176198205823, 3.622285507719393, 0.943392606921079, 0.9597867968115266],
+        [0.5054790300355518, 1.226835281631794, 0.9342292849121415, 0.8180434485305125],
+        [1.648774519118023, 8.419773025837477, 0.9608351261510378, 1.412887547042761],
+        [0.7190372928595299, 3.614757531063784, 0.9441168428759285, 0.9729718367865619],
+        [0.8210637645495434, 0.8625387507355943, 0.9337472237289124, 0.8116722523984952],
+        [1.320795312577595, 3.65823669219206, 0.9442537661652683, 0.9755030942186069],
+        [0.7922417055572685, 2.281517048920395, 0.9493807347635665, 1.080139965679426],
+        [1.273015682108224, 2.614934589170593, 0.9411746562830352, 0.9214275822705629],
+        [1.100468856975567, 6.543308069934695, 0.9648955874359659, 1.582975043906444],
+        [0.6097441400908794, 0.8615105917644515, 0.933599937128171, 0.8097440788331697],
+        [1.02236198032998, 5.594807199854355, 0.9453575843092369, 0.9963723788923163],
+        [0.9000696117409239, 2.299587836533894, 0.9410820333339186, 0.9198884999879307],
+        [1.991796688025991, 18.44249688409701, 0.9735554278718891, 2.120213500951618],
+        [0.8142391118694509, 1.868256156193806, 0.9502406877743338, 1.099802521715609],
+        [1.536005810873765, 21.49590834539853, 0.9847383266272803, 3.715986643996325],
+        [0.6590821645881727, 4.829408462565685, 0.9476891554101178, 1.043349078160351],
+        [0.525558238164371, 1.465216067917641, 0.9356994460640622, 0.8380638656827105],
+        [0.9362958748854441, 4.845818186908989, 0.9451491918685347, 0.9923680983432766],
+        [0.8465861298408964, 0.6909402655398699, 0.925279208436077, 0.7131597058645744],
+        [0.3319420217955247, 0.7792180708439435, 0.9149998328924682, 0.6199500408933606],
+        [7.499598838163299, 2.833807890285676, 0.9380009728959106, 0.8713123545305745],
+        [0.3356938035067066, 2.191362313331218, 0.929341074931083, 0.757466733130533],
+        [1.754369826975128, 10.3720481329619, 0.9624698771210998, 1.476939200182435],
+        [0.5892142264173699, 4.696342745778963, 0.9477065513864228, 1.043715317717202],
+        [0.461799491161905, 0.7457539241277872, 0.9279324598299766, 0.7415358052118913],
+        [1.285116449887214, 1.55644725968393, 0.9352170109079578, 0.8313939751046783],
+        [0.5928156546915102, 2.315560283340675, 0.941203031219166, 0.9219000486829068],
+        [0.6467882515305842, 0.8480191326174569, 0.9296976837444104, 0.7616011176874202],
+        [1.12312080781928, 0.9954251549499809, 0.9259304181727545, 0.719936042711726],
+        [0.9801555437101244, 1.347321064236524, 0.9370772342946406, 0.8576755733357302],
+        [0.7672892837346516, 2.485603288706678, 0.9418041132256985, 0.932016820578037],
+        [2.166369742914278, 8.435800143571081, 0.967451944964286, 1.711826787476756],
+        [0.8259932889366519, 1.737441869116738, 0.9375868641090329, 0.8651491153052684],
+        [1.085204052684624, 4.385008883447195, 0.9557876794739997, 1.245012110317759],
+        [0.9362958748854441, 4.845818186908989, 0.9451491918685347, 0.9923680983432766],
+        [0.7579015415900724, 4.310520363745366, 0.9643422929977651, 1.55751866419493],
+        [0.6189858276100264, 2.413187790507267, 0.9421401017204722, 0.9377634065431503],
+        [0.6752667230114308, 1.002492755437754, 0.9335583937711398, 0.8092017678098795],
+        [0.4624116143125557, 5.251958417435707, 0.9431523842368533, 0.9554876323058493],
+        [0.4781593286622869, 2.158210797601897, 0.9350451727495996, 0.8290421628299688],
+        [0.7355369282661423, 10.81056027584947, 0.9576767154988188, 1.303151842155466] 
+        ]
+      },
+     "V":{
+       "0":        [
+[11.34490530739584, 4.493328305259942, 0.9469298288264902, 1.00706911204585],
+        [1.011075853408858, 4.461854349232941, 0.9451862742209933, 0.9732402250606814],
+        [1.332982645171171, 3.750251954852803, 0.9434648304884147, 0.9418873929145212],
+        [1.568337187454557, 4.683141449943494, 0.9464622121036204, 0.9977800665548613],
+        [1.213505832973334, 3.536130777679098, 0.9447156783364773, 0.9644752883632456],
+        [4.052319198458141, 2.096297717585702, 0.937613592113967, 0.8482539313521297],
+        [13.9087001551591, 5.962245478582052, 0.9502116653501345, 1.077171178884483],
+        [0.8292853301804677, 13.640004248307, 0.9753836373344018, 2.236369451006763],
+        [0.8263068831780837, 3.562282369894616, 0.9580313831760038, 1.288389114009471],
+        [0.9667102230597724, 3.820245147779833, 0.9458788214011939, 0.9864162607905073],
+        [0.4644152691641344, 5.320980268209737, 0.9440368666818799, 0.9520919639720785],
+        [0.7887733761975879, 6.848089693669831, 0.9647204356885967, 1.543370632433514],
+        [0.6607006558212225, 3.178454705504686, 0.9557164011458504, 1.218086410391996],
+        [0.892648086058983, 3.829626788340339, 0.9462149796330364, 0.992934152409224],
+        [0.7033354708988033, 4.902520191947294, 0.9488720046249306, 1.04746817123215],
+        [0.5984983176597236, 5.093760180221556, 0.9491891804555108, 1.054359089323263],
+        [0.6215593782443439, 1.717615533481374, 0.9373898023226368, 0.8450202502916174],
+        [0.7199538916245189, 4.407699638191055, 0.9477660561383767, 1.024095126920853],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.5754093141404395, 5.145682020185849, 0.9493026940965928, 1.056846221925109],
+        [0.3852029058336677, 1.005016934860114, 0.9229731471286625, 0.6762992080634993],
+        [0.3838820993299955, 5.447775588011845, 0.9416636921706123, 0.9110639323725893],
+        [2.134692987876281, 2.602036062854836, 0.9402259113214649, 0.8877919832164293],
+        [0.8815664631536767, 1.974213667987953, 0.9387152135720402, 0.8645162211670796],
+        [0.6522799481068189, 4.695930826376077, 0.9484033368126834, 1.037441039673817],
+        [0.6095473035858396, 0.8879479286911043, 0.9338540957434432, 0.7968343307908428],
+        [0.789116457639822, 1.973350874733147, 0.9411125072377285, 0.902008122378946],
+        [0.7632005210792345, 4.124583995927207, 0.9462339326721355, 0.9933040667911091],
+        [1.394406528066391, 5.827959491596007, 0.9487831905796383, 1.045553905023478],
+        [0.6938768863665956, 2.633783323827311, 0.9566432531456349, 1.2453324109716],
+        [0.7410129774902203, 3.49859421872203, 0.9456327467676321, 0.9816961284377774],
+        [0.7042128195099773, 3.004569783829586, 0.9446695200005423, 0.9636236098560864],
+        [0.5595243928700596, 1.539016121091221, 0.9453180351501068, 0.9757213302748282],
+        [1.026986548744669, 4.461979463257549, 0.9474690703485718, 1.017986273113789],
+        [0.5928671201943994, 5.139605542618229, 0.9457292379084985, 0.9835418921191557],
+        [1.137302312957446, 3.870719583339896, 0.9593374084057344, 1.331583153687978],
+        [0.6106011342431207, 5.029175767868921, 0.9491372446018868, 1.053224854027756],
+        [1.096745125749247, 4.348459664305289, 0.944956032787153, 0.9689332099255299],
+        [1.056812637151621, 4.783163093123647, 0.9458985499750675, 0.9867965478159541],
+        [1.58955247899303, 4.123390402731354, 0.9457440137350875, 0.9838251161959746],
+        [1.3212570703634, 3.090871403663882, 0.9434007325342759, 0.9407567990456456],
+        [0.9782490315669837, 2.100362524742755, 0.9407117574119146, 0.8955296342378102],
+        [0.7344808781934069, 10.67097745407388, 0.9594111235273692, 1.334104000580837],
+        [0.680390139182433, 2.564563771109548, 0.9581910888966302, 1.293526224737523],
+        [0.3426493898396734, 2.013329092243704, 0.9297507834789283, 0.7469938650047093],
+        [1.075572473735183, 2.077204699995597, 0.9408161830714221, 0.8972093184721763],
+        [0.6507844090182633, 4.513830379740297, 0.9523129768821059, 1.127123376405562],
+        [0.7038467460382022, 4.822263334834052, 0.948616628765228, 1.041981733574131],
+        [0.9200623589015613, 10.09150808939264, 0.9585236013441378, 1.304348784130465],
+        [1.919502578499987, 1.685215422549477, 0.937787549373021, 0.8507836209427153],
+        [2.187923381977192, 1.865547926776406, 0.9364883983160264, 0.8322260451207248],
+        [2.901668565706613, 1.827370424130158, 0.9366351564240134, 0.8342842691246039],
+        [0.9436295568144238, 3.196599251292586, 0.9458310305056544, 0.985496194082482],
+        [0.7486430664633144, 1.562834475660925, 0.9393314829303742, 0.8738712791820589],
+        [8.399098249314822, 1.840840623785493, 0.9367271729407355, 0.8355796340980085],
+        [6.071435384648527, 6.461072781750125, 0.9566449157107375, 1.245382330894248],
+        [2.903307790924236, 2.098333172086671, 0.9372765050800517, 0.8433919444415146],
+        [1.90133509556273, 1.853116806515916, 0.9388330509385716, 0.8662904331139694],
+        [1.755793150628825, 1.279015237043456, 0.9341265707675139, 0.8003637678071568],
+        [0.9929613473862791, 4.138034096977227, 0.9466945802225477, 1.002375608333998],
+        [1.585568619157029, 1.80128086829825, 0.9382743807046203, 0.857938918895386],
+        [0.6911608586733335, 6.733024165768233, 0.972748561844193, 2.014666374173403],
+        [1.690357157919206, 5.081545477307365, 0.9424646479250338, 0.9245326664743656],
+        [1.805718103637741, 1.895663250268003, 0.9371057260874001, 0.8409485979555275],
+        [0.3473685768266706, 5.502936534638504, 0.9400118371311382, 0.8844223878551958],
+        [0.4644152691641344, 5.320980268209737, 0.9440368666818799, 0.9520919639720785],
+        [0.6526791084870556, 1.182979746094287, 0.9367354304604182, 0.8356960638005153],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.5195382590080464, 5.214830233426276, 0.9494149709125254, 1.059317235718618],
+        [0.3858642026815958, 1.006601751009651, 0.9230263510666056, 0.6768056754871258],
+        [0.3286019600336432, 5.503894541173755, 0.9384233588892104, 0.8601511637495158],
+        [1.00112653400565, 5.032996972781929, 0.9479883254589165, 1.028712743137365],
+        [3.544397461986883, 4.972613594587846, 0.9465747128167549, 0.9999999999999847],
+        [0.7082741593460401, 2.098363656491877, 0.9391612031604111, 0.8712674587805058],
+        [1.127436842081066, 1.371531656833662, 0.9330002887885296, 0.7859606703604222],
+        [0.6765516530195672, 20.24825407050449, 0.9705807194257349, 1.862051029360479],
+        [4.165327095879137, 3.477412458293835, 0.9424324093065953, 0.9239833083389813],
+        [0.5655350013586414, 5.170234178686074, 0.9493531395684454, 1.057955081997042],
+        [1.027714964372443, 1.516767139253979, 0.9382193289811954, 0.8571241305478627],
+        [0.9069407538509957, 4.600902618887567, 0.9478346753826205, 1.025516483896594],
+        [1.494610587921047, 17.76566448339183, 0.97606324877438, 2.301466838540667],
+        [0.6019047837378678, 5.128892808601817, 0.9457642846390585, 0.9842139213810071],
+        [0.7073682558786675, 3.926413030666784, 0.946655051317071, 1.001591019565569],
+        [0.3259872071802817, 0.573477823076504, 0.9026645568609447, 0.5234164249210603],
+        [3.788099122060659, 13.19168529253, 0.9633876139216143, 1.485131781547025],
+        [0.8780549384540373, 1.740181694770951, 0.9509782958024079, 1.094899272171971],
+        [0.6019047837378678, 5.128892808601817, 0.9457642846390585, 0.9842139213810071],
+        [1.015850473026529, 3.54632830455698, 0.9452542967742732, 0.9745196226701243],
+        [0.8068886422885699, 1.197299210980771, 0.9363785120190747, 0.8306911503094996],
+        [1.088123215093146, 4.274405899722836, 0.9467917638232896, 1.004309511492637],
+        [0.4644152691641344, 5.320980268209737, 0.9440368666818799, 0.9520919639720785],
+        [1.15642227775998, 12.37347857850352, 0.9697774519972756, 1.811060561133946],
+        [0.8716765064347753, 3.82054596154577, 0.9461597402947896, 0.9918575088400722],
+        [1.175563693627925, 1.469757828313242, 0.9465439579772637, 0.9993921985011321],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.7784534850200768, 1.220198023060274, 0.9374198561229015, 0.8454531723657818],
+        [0.6759125568516776, 4.209901027554696, 0.9473720577584341, 1.01600571043577],
+        [4.87664859420693, 4.240263722146753, 0.9428174047452993, 0.9305842460594508],
+        [0.6618285975936776, 1.514423410685414, 0.9373579526947926, 0.844561912876714],
+        [0.8691346108326378, 4.457400865119223, 0.9476302116747837, 1.021292274226532],
+        [0.6590330436801833, 3.608305962231896, 0.9576542133994902, 1.276410846977137],
+        [0.9724937761235121, 4.36624285489123, 0.9470208072825261, 1.00889542291806],
+        [0.6126452453944027, 1.486277370913693, 0.9349616264264367, 0.8113646482729642],
+        [0.8958021981241118, 1.50193012111578, 0.9377298373501214, 0.8499428049664268],
+        [0.4316145279989568, 1.675706564397299, 0.9396329919191164, 0.8785178140418247],
+        [0.8473669495401676, 0.7397621703794057, 0.9297350079520136, 0.7468134821089762],
+        [0.5298086971274629, 0.7058300313069859, 0.9272598603975241, 0.7194809460590924],
+        [0.2671564977841037, 3.788621818593558, 0.9304324153204074, 0.754866016193766],
+        [1.776228987825236, 2.995780254608106, 0.9426764811085512, 0.9281577527129719],
+        [0.3838820993299955, 5.447775588011845, 0.9416636921706123, 0.9110639323725893],
+        [1.659939730373746, 2.430784014675475, 0.9510571102975646, 1.09675331623976],
+        [0.3852029058336677, 1.005016934860114, 0.9229731471286625, 0.6762992080634993],
+        [1.09818341016494, 2.259470126477014, 0.942119670858941, 0.9186858908966248],
+        [0.5928671201943994, 5.139605542618229, 0.9457292379084985, 0.9835418921191557],
+        [1.119165528374543, 4.292556520582299, 0.9453396539821036, 0.9761295628960827],
+        [0.9565412076362284, 4.978962490302475, 0.9462703350450452, 0.9940152790885414],
+        [2.297827704662959, 5.43359331769832, 0.9456716443339105, 0.9824394050094615],
+        [0.5540795882182472, 5.192765578359928, 0.9494035459573519, 1.059065291506102],
+        [1.0745553792638, 1.458039387452021, 0.9368249997321668, 0.8369609317855511],
+        [0.2842403908271462, 1.978319394720013, 0.9249726330666196, 0.6958267896907173],
+        [0.6410407740734412, 2.117435387973647, 0.9473836892205418, 1.016242787474414],
+        [0.6107176814923765, 3.501170149897088, 0.9569159416719057, 1.253571620319658],
+        [0.9565412076362284, 4.978962490302475, 0.9462703350450452, 0.9940152790885414],
+        [0.7491628847256172, 1.906717838065312, 0.9398691763945127, 0.8821901847144401],
+        [0.3259872071802817, 0.573477823076504, 0.9026645568609447, 0.5234164249210603],
+        [1.384871913390045, 22.32927723057082, 0.9802103495018749, 2.795587734745054],
+        [1.741417154525151, 2.618606453323843, 0.9414824700021258, 0.9080676801809822],
+        [0.4644152691641344, 5.320980268209737, 0.9440368666818799, 0.9520919639720785],
+        [0.478981527180752, 1.678882959639624, 0.9393095227540423, 0.8735346561264782],
+        [0.5819344700167725, 5.131088337312145, 0.9492710213456156, 1.056151138786582],
+        [0.8909358283006819, 11.10963442474209, 0.9736630120950284, 2.086577571455334],
+        [0.4664316699133372, 1.881658659192559, 0.9406708487090935, 0.8948732306251826],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.7503234932398652, 4.744305044385352, 0.9483629330663248, 1.036585125100197],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.9362307155240156, 3.366390445230913, 0.9449760293392117, 0.9693058464586665],
+        [0.8285611566874372, 8.044638066598795, 0.9751736851032569, 2.216979517493979],
+        [0.7692898633360796, 4.775256956246175, 0.9484559099277348, 1.038556759586072],
+        [2.708757338036931, 2.390771391928278, 0.9389348511236957, 0.8678286950568985],
+        [3.061399777501439, 4.395620025632612, 0.943069008654164, 0.9349463573599404],
+        [1.586566292331031, 3.048786322241039, 0.9421372324624367, 0.9189818460731158],
+        [1.074183791131079, 25.2909475019174, 0.9925243094517771, 7.493449827308158],
+        [1.035144398572572, 4.338817182719605, 0.9470621656376421, 1.009727730244929],
+        [2.47549973905472, 2.634591097873306, 0.9412671209855896, 0.9045312296830613],
+        [4.345330453117717, 4.873649930105374, 0.9500964741981264, 1.074554488985185],
+        [1.378423557836484, 2.647052458759141, 0.9423922646520302, 0.9233000879226583],
+        [0.824273609116592, 4.544634426120256, 0.9477716192103499, 1.02421021948503],
+        [0.5188426317112022, 5.217107811084069, 0.9494119430199673, 1.059250453256812],
+        [1.487678897367807, 1.571967920626506, 0.947059107612494, 1.009666145153403],
+        [0.7403136939187802, 2.108394647603895, 0.9398374567689756, 0.8816953083872068],
+        [0.7391374253536726, 13.29300001791866, 0.9754407898798406, 2.241705124774139],
+        [1.368953062323741, 4.378001450606656, 0.9466389831378386, 1.001272422892999],
+        [0.8404193403087225, 4.020558513084928, 0.9464248841885379, 0.9970455490349789],
+        [1.291852553264538, 3.079642590030988, 0.943668253991743, 0.9454925250345473],
+        [1.526626381738573, 5.588441664157758, 0.9485529447379474, 1.040622045242964],
+        [0.6731742790963321, 1.135156762109216, 0.9364194380014917, 0.8312621855301512],
+        [1.128367332264926, 3.833873039698481, 0.9456917415700723, 0.9828238514695262],
+        [0.912199906036255, 1.514685199608427, 0.9387074035062459, 0.8643988703918029],
+        [3.832559898033294, 3.599323525517743, 0.9432363981025352, 0.937869845614278],
+        [0.9049462663045326, 1.984683008985215, 0.9390577600934659, 0.8696927714763322],
+        [3.260259772560922, 15.14680113202316, 0.9681696555802924, 1.716730392786095],
+        [0.5964134292552378, 3.449575679146615, 0.956412691000454, 1.238446471114877],
+        [0.5398059423437059, 5.172697755692732, 0.9493233183071428, 1.05729930334196],
+        [0.9565412076362284, 4.978962490302475, 0.9462703350450452, 0.9940152790885414],
+        [0.8555205156792959, 2.111369524136636, 0.9452125674972146, 0.9737343837079362],
+        [0.3426493898396734, 2.013329092243704, 0.9297507834789283, 0.7469938650047093],
+        [5.387327899742298, 5.686645217428813, 0.9584450650036959, 1.301776973541104],
+        [0.3473685768266706, 5.502936534638504, 0.9400118371311382, 0.8844223878551958],
+        [2.475384909164982, 3.294216364993349, 0.9425661059997993, 0.9262655746341746],
+        [0.5361529662267626, 0.6979164672557193, 0.9268114102040187, 0.7147266231714005],
+        [0.4708901865820877, 3.014964082093692, 0.9446431251296316, 0.963137230081461],
+        [1.349657129905996, 2.181669574843164, 0.9400595712663173, 0.8851716531530363],
+        [0.5948226813182437, 1.388042581507588, 0.9387560516616738, 0.8651303246020009],
+        [0.5650243465581611, 9.713790503181169, 0.9696185178400545, 1.801291132219361],
+        [1.118721889765003, 2.016787382866004, 0.9409978896388358, 0.900146238190597],
+        [0.6308412912363667, 15.0087059389118, 0.9878960515405804, 4.606553834355743],
+        [0.5941900844052356, 10.85913225527155, 0.9816285484324093, 3.015752351727233],
+        [2.331100712143224, 3.747528733248933, 0.9547533425476679, 1.190958566960616],
+        [0.7926677752094805, 1.383802035226541, 0.943664264662579, 0.9454215746654602],
+        [1.143684618062692, 6.377937232489379, 0.9612608538387333, 1.400500213064136],
+        [0.9565412076362284, 4.978962490302475, 0.9462703350450452, 0.9940152790885414],
+        [0.9180334823919274, 2.683276650330388, 0.9430940628613976, 0.9353828393273919],
+        [0.6204350006391673, 1.357141995356175, 0.9386168383735186, 0.8630402575294476],
+        [0.684516614170236, 3.727616858261745, 0.9461845603413315, 0.9923409910735956],
+        [0.4644152691641344, 5.320980268209737, 0.9440368666818799, 0.9520919639720785],
+        [0.4756727105956942, 1.370626201408699, 0.9309205191865756, 0.7605985711179912],
+        [0.7658588725360684, 4.206757743205659, 0.947286420622501, 1.014263441453232] 
+        ]
+      },
+     "W":{
+       "0":        [
+[11.47599861937334, 5.094390129446166, 0.948660556597464, 1.033638971031029],
+        [1.091220801491017, 5.134778269801489, 0.9466012451330486, 0.9916196589539906],
+        [1.532988268360232, 5.131356051536609, 0.9467486143722826, 0.9945186974708419],
+        [1.653854508018698, 3.539154049018541, 0.9454196205673718, 0.9689408095308558],
+        [1.249123736676609, 4.780616875168361, 0.9480067074563733, 1.01993683520715],
+        [4.169194259578661, 4.647198285939378, 0.9473158785985754, 1.005829252804698],
+        [17.12386129669569, 4.342205406811255, 0.9465329015660189, 0.9902806327302424],
+        [1.234742194628708, 4.828711156389139, 0.9481082855832474, 1.022042862753374],
+        [1.019545224524874, 4.890371648693006, 0.9483219072341674, 1.026498911752386],
+        [0.8629658854185842, 1.957613985765066, 0.9492745142936532, 1.046826707644466],
+        [0.472542996321134, 5.314900987166155, 0.9438248560415902, 0.9398453641757403],
+        [0.9112793898420672, 4.927114777382679, 0.9484453240887895, 1.029090160604624],
+        [0.7435550252989485, 3.295891323628942, 0.9449684769653133, 0.9605389405074404],
+        [0.9190091565002269, 4.957999845390019, 0.9485025832593157, 1.030296586732743],
+        [0.7053294486796088, 2.939524401286529, 0.9435954201777904, 0.9357948334634477],
+        [0.6079301368518717, 5.192103871372851, 0.9490431787415379, 1.041820336695223],
+        [0.6577942953414911, 4.984116007784165, 0.9486224214241572, 1.032830228796823],
+        [0.7315534566970492, 5.061324658858212, 0.9487986358961819, 1.036577331497663],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.5838989191278841, 5.215355823547958, 0.9490895553429366, 1.042820334134085],
+        [0.4122276669628891, 5.370103430687398, 0.9421097444487914, 0.9103433335980327],
+        [0.3893749540624893, 5.39053617423177, 0.9413607032153647, 0.8980003346372052],
+        [2.196840174759392, 4.655689518203686, 0.9474505018726644, 1.008549328695914],
+        [0.9145774603366514, 2.591287998172251, 0.9418178761835566, 0.905496021008755],
+        [0.6540821012386644, 2.492625775240266, 0.9428644541109679, 0.9231070530386266],
+        [0.6239785188094165, 4.628909182575594, 0.9479879194034643, 1.019548202440559],
+        [0.8050272606493037, 4.97385634826999, 0.9485965216451454, 1.03228164988859],
+        [0.7769948459731687, 5.03438858427457, 0.948722477103031, 1.03495469712414],
+        [1.446594937160963, 4.758888614125275, 0.947866178771017, 1.017036773147485],
+        [0.8161252366264887, 5.002082851714928, 0.9486383293325141, 1.033167445822592],
+        [0.7559125105628447, 5.047706338819471, 0.9487588116450886, 1.035728236895529],
+        [0.7179896157240999, 5.074343398643354, 0.9488294159953876, 1.037234500843524],
+        [0.6197806357466323, 5.17907181418018, 0.9490177147220061, 1.041272041400844],
+        [1.053094406164006, 2.996077493915108, 0.9435269994639057, 0.9345932842690478],
+        [0.5701786923613124, 0.9279927150388027, 0.9273153975591819, 0.713664737933158],
+        [1.296163215954057, 4.202658871214794, 0.9468056627075588, 0.9956452614149051],
+        [0.6148725067714845, 3.972004157605217, 0.9466314650342302, 0.9922128380195914],
+        [1.19503737035932, 5.132752530172199, 0.9466461515715437, 0.992501359112394],
+        [1.119042401798697, 5.133522663902954, 0.9466219887015054, 0.9920267571110923],
+        [1.646479268100776, 4.506418368985774, 0.9473496151526871, 1.006509596894685],
+        [1.356941724982884, 4.61059199201181, 0.9476443202551429, 1.01249001420425],
+        [1.001770635140409, 4.747456027661606, 0.9480381979887084, 1.020588850324248],
+        [0.7857378263168862, 7.310547338967099, 0.9519005305004858, 1.107032751216703],
+        [0.7996703235777691, 5.011942189843591, 0.9486659788142887, 1.033754058920521],
+        [0.3608476584423277, 5.416946381768954, 0.9401418904314519, 0.8785765239068374],
+        [1.098926747196935, 3.438301979518029, 0.944736860839441, 0.9562787315910749],
+        [0.7090641179794563, 1.984701269555571, 0.9409992492244473, 0.8921562577656278],
+        [0.7115794322747744, 4.302000162720281, 0.9471435241319603, 1.002367039792448],
+        [0.9636090002957369, 3.678554167732927, 0.9458014782565012, 0.9761616331261274],
+        [1.978517223716714, 4.601962879515462, 0.9474007830417824, 1.007543133490793],
+        [2.181026297910855, 4.252310347956525, 0.9465918580791539, 0.991435539406443],
+        [2.956006643856088, 4.284775102863617, 0.9464886271115865, 0.9894150079195482],
+        [0.9899747366138225, 4.972144205861495, 0.9483592648968502, 1.027281962647817],
+        [0.7620583702241434, 3.433566570114298, 0.9445627644467411, 0.9530999415530672],
+        [8.437346732129361, 4.150574861720763, 0.9452165856157592, 0.9651424650729978],
+        [7.667472789999225, 4.729792631552152, 0.9472922231017247, 1.005352726564243],
+        [2.858512434214612, 4.391676189178236, 0.9467437946855112, 0.9944236311097062],
+        [1.913807765372684, 4.730143257953424, 0.9477584566084177, 1.014824296510546],
+        [1.764459257006312, 4.684523840037988, 0.9477542552895059, 1.014738191601327],
+        [1.034592974808724, 4.826527571619402, 0.9482146367185772, 1.024256702962439],
+        [1.626526584425387, 4.640884595115447, 0.9475878921806167, 1.011339719844962],
+        [0.9299629365408507, 4.715578083908406, 0.9480387907452954, 1.020601130995979],
+        [1.855435009242567, 7.780004163914998, 0.9505459551601271, 1.075178291197036],
+        [1.866588636113398, 4.375764574518259, 0.9468804383035699, 0.9971255595256421],
+        [0.351897921506103, 5.424438226949451, 0.9396786804837152, 0.871400345374248],
+        [0.472542996321134, 5.314900987166155, 0.9438248560415902, 0.9398453641757403],
+        [0.6679440832709804, 5.117914401602381, 0.9489360635314463, 1.039517603023],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.5254667602015076, 4.91392705560822, 0.9484912552349031, 1.030057697292531],
+        [0.4128861299703008, 5.369499976075568, 0.9421312267428125, 0.9107020408036599],
+        [0.3331007273993445, 5.427126231014864, 0.9381216120848074, 0.8480653857367684],
+        [1.023056453359805, 4.758670185209142, 0.9480306647886223, 1.020432802641241],
+        [3.60672655802245, 5.150758400684436, 0.9470250386268549, 1.000000000000033],
+        [0.7411117941749615, 3.277352900375098, 0.9449093686252804, 0.9594483325349951],
+        [1.125841015993233, 4.757409571468651, 0.948015371826496, 1.020116153221326],
+        [0.6939381805909463, 6.623751163516098, 0.9507033107195508, 1.078788827422217],
+        [4.025128954852327, 4.731640918443393, 0.9475697749390766, 1.010970922391303],
+        [0.5736860088783172, 5.225793080979026, 0.9491091899316281, 1.043244254948663],
+        [1.034674065342462, 4.257312866043666, 0.9470552770232759, 1.000603079567133],
+        [0.9304739908199833, 4.949351335910459, 0.9484785051446358, 1.029788944475703],
+        [2.651462201125185, 4.638476505388933, 0.9475056368175913, 1.009667362379558],
+        [0.6178767194059008, 5.205593209405706, 0.9457745999321463, 0.975650044157318],
+        [0.7207555583591916, 5.027752645349342, 0.9487298706599824, 1.03511201249535],
+        [0.3754866005912914, 5.403164096091272, 0.9407273939990627, 0.8878077994407039],
+        [5.29495444017693, 4.646315978406226, 0.947162455090905, 1.002746215902659],
+        [1.038274569507163, 4.876805184094705, 0.9482812790105544, 1.025648591020475],
+        [0.6178767194059008, 5.205593209405706, 0.9457745999321463, 0.975650044157318],
+        [1.046242060873223, 4.890361108181663, 0.9483195338967645, 1.026449202667092],
+        [0.823466981263429, 4.92156088423324, 0.9484817312696311, 1.029856933790095],
+        [1.121973204406251, 4.840839855659237, 0.9481770117178724, 1.023472449897848],
+        [0.472542996321134, 5.314900987166155, 0.9438248560415902, 0.9398453641757403],
+        [1.454834453227551, 4.700231265949039, 0.9477437646309081, 1.014523248803417],
+        [0.888370285034315, 4.379669537962783, 0.9473747656690973, 1.00701735925161],
+        [1.481143645964623, 4.422949687098425, 0.9470665930800602, 1.000828946044095],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.7940654906804058, 5.011218757068478, 0.9486817172138453, 1.034088248075965],
+        [0.6864617027821113, 4.660984061198722, 0.9480209601179385, 1.020231840349273],
+        [4.949991600716805, 4.753819233383375, 0.9478322588492998, 1.01633911537377],
+        [0.6775869413811385, 2.860708069725509, 0.9429695416365478, 0.9249110969740388],
+        [0.8837457381250513, 4.540503402812537, 0.9476629020988308, 1.012869350631737],
+        [0.7461781504227155, 3.250907056940251, 0.944857656393984, 0.9584961077209427],
+        [0.9975027332299012, 3.273469558383984, 0.9447950838243515, 0.9573462868101511],
+        [0.6455950099525963, 5.034911165474855, 0.9487316004272414, 1.035148823925141],
+        [0.9223866636884014, 7.061876875454639, 0.9498235577615194, 1.05889344437608],
+        [0.446748197937492, 5.362365687907344, 0.9493256797095336, 1.04794015977182],
+        [0.8572292693173899, 4.115165372504076, 0.9468376432531367, 0.9962778559377421],
+        [0.5961777626444742, 5.029782852861314, 0.9487263836270643, 1.035037811988546],
+        [0.2774067316222686, 5.484408289434263, 0.9348308509333394, 0.8024170963246904],
+        [1.848072511942991, 4.504554433586712, 0.9473235377442512, 1.005983633564851],
+        [0.3893749540624893, 5.39053617423177, 0.9413607032153647, 0.8980003346372052],
+        [1.850126977238352, 4.590887130519846, 0.9473611366863782, 1.006742144262824],
+        [0.4122276669628891, 5.370103430687398, 0.9421097444487914, 0.9103433335980327],
+        [1.126335953389531, 4.86437971716558, 0.9482595537265857, 1.025194443756153],
+        [0.5701786923613124, 0.9279927150388027, 0.9273153975591819, 0.713664737933158],
+        [1.193275454211718, 4.821356491682462, 0.9481350064085774, 1.022598238240782],
+        [0.9920266502977477, 5.133590804049251, 0.9465928927352365, 0.9914558301834383],
+        [2.717167695115095, 4.68257645643855, 0.9474522372041305, 1.008584482216482],
+        [0.5617341355446974, 5.237078192878242, 0.9491317862619891, 1.043732526308921],
+        [1.108417434772653, 4.095161590191601, 0.9466291941077788, 0.9921682392153904],
+        [0.300048852839157, 5.466694824937819, 0.9365069784293486, 0.8250764851677153],
+        [0.7055663171541295, 3.692001980517392, 0.9459243283225736, 0.9785063759620912],
+        [0.6690088863025545, 5.11352360347233, 0.9489262314150045, 1.039306718841222],
+        [0.9920266502977477, 5.133590804049251, 0.9465928927352365, 0.9914558301834383],
+        [0.7659675605777185, 5.013644732046449, 0.9486985216127897, 1.034445299010633],
+        [0.3754866005912914, 5.403164096091272, 0.9407273939990627, 0.8878077994407039],
+        [2.838258422867463, 4.201763680262206, 0.9461697761988598, 0.9832230988084686],
+        [1.776871856101771, 4.103223487648551, 0.9463847049091952, 0.9873888059406807],
+        [0.472542996321134, 5.314900987166155, 0.9438248560415902, 0.9398453641757403],
+        [0.495741391583534, 5.305088381874847, 0.9492441707583367, 1.04616743778018],
+        [0.5906612758420301, 5.208477611621685, 0.9490761092716327, 1.042530215162491],
+        [1.014743319466516, 3.620866421565436, 0.9454640789389972, 0.9697763039168941],
+        [0.481930401820954, 5.314650645144662, 0.949256605507131, 1.046437510525773],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.7642747106959593, 4.668527486843213, 0.9478909241729008, 1.017546304332422],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.9731089683531421, 4.54824550455232, 0.9477316347918971, 1.014274828442783],
+        [1.054147731569916, 3.294170391762737, 0.9438824107882862, 0.9408666496014467],
+        [0.7832603854123626, 5.024947915716552, 0.9487010869821936, 1.034499827197168],
+        [2.737027560620192, 4.371727222029563, 0.9467142269431692, 0.9938407957885412],
+        [3.056953542667969, 3.968288762444397, 0.9459344277315074, 0.9786996094610435],
+        [1.59398048557019, 4.177238859947281, 0.9464788850595082, 0.9892247300024821],
+        [3.120909122688589, 3.223538024901863, 0.944118917041139, 0.9450854404451244],
+        [1.062235592144689, 3.431192975393653, 0.9449627516623628, 0.960433200481122],
+        [2.450463852547087, 3.904351705408084, 0.9457534580424217, 0.9752479959157589],
+        [5.424844008758524, 3.396413068773863, 0.9438478930546316, 0.9402538952581632],
+        [1.427651381503994, 3.811092080478912, 0.9457719930424439, 0.975600452863876],
+        [0.8302109481517822, 2.594298065809141, 0.942431112722241, 0.9157374322469441],
+        [0.5244401865108124, 4.890996444198121, 0.9484522844329806, 1.029236668968598],
+        [1.968069371584448, 3.914314820968706, 0.9457381331053281, 0.9749567625714251],
+        [0.7844242389144509, 5.017532828319984, 0.9486835801529812, 1.034127819291244],
+        [0.9170675517690607, 4.926855728857224, 0.9483904873358726, 1.027937283276601],
+        [1.388230407527687, 3.675314764896163, 0.9452373684754695, 0.9655299734431683],
+        [0.8517314145228453, 3.562784666520258, 0.945488617026283, 0.9702380253568212],
+        [0.9225737520087116, 6.272929707363156, 0.9717301334062081, 1.922786651727392],
+        [1.715977851043161, 4.816871623398016, 0.9480300292665609, 1.020419640086672],
+        [0.6884358438124922, 5.084269619444835, 0.948861815118293, 1.037927091706763],
+        [1.170163042244886, 4.094144256958641, 0.9465684101248583, 0.9909759091812733],
+        [0.8092903444048082, 10.87292638190375, 0.971597316029879, 1.913533686214302],
+        [3.919892248778788, 4.030746106671268, 0.9459751108536563, 0.9794787373910424],
+        [0.9437707392251861, 4.873549149109856, 0.9483189843478256, 1.026437693123584],
+        [4.264570335886877, 6.799682932912416, 0.9502691527978334, 1.068882485688864],
+        [0.6644746525430685, 2.036893896095602, 0.9412424255585752, 0.8960800779497682],
+        [0.5481643852916523, 5.218353142978255, 0.9490813120963286, 1.042642455664012],
+        [0.9920266502977477, 5.133590804049251, 0.9465928927352365, 0.9914558301834383],
+        [0.9171989011311307, 4.905408265421392, 0.9484053812850364, 1.028250168381526],
+        [0.3608476584423277, 5.416946381768954, 0.9401418904314519, 0.8785765239068374],
+        [6.874664286515414, 4.803754359572013, 0.9476523095401427, 1.012653077333687],
+        [0.351897921506103, 5.424438226949451, 0.9396786804837152, 0.871400345374248],
+        [2.523417655971417, 3.57166688135513, 0.9450073310941465, 0.961257115094364],
+        [0.6036621305593626, 5.194704277785323, 0.9490488488531682, 1.041942501039251],
+        [0.4840735860571969, 5.320774522765936, 0.9492711596668225, 1.046753783346864],
+        [1.363660570285785, 4.303230534124124, 0.9468896326411785, 0.9973078633777648],
+        [0.6064342365111353, 4.690485420592204, 0.9480881514228577, 1.021624764650066],
+        [0.6692876746124625, 5.116703235132136, 0.9489329994540951, 1.039451874439853],
+        [1.125167218059133, 4.73625757706081, 0.9480334131680102, 1.02048972914547],
+        [1.039811717737593, 4.856618979325741, 0.9482557362352104, 1.025114681970269],
+        [0.7856001075640728, 5.026299793975268, 0.9487138760725333, 1.03477174697828],
+        [3.194193399097961, 4.736223981820792, 0.9475872000355029, 1.011325625744663],
+        [0.8755846935248501, 4.973917417574278, 0.9485533548775136, 1.031368569216928],
+        [1.315757767425852, 4.385376937064801, 0.9471594094088532, 1.002685194321286],
+        [0.9920266502977477, 5.133590804049251, 0.9465928927352365, 0.9914558301834383],
+        [0.9401490048131383, 4.882127684998745, 0.9483353636356864, 1.026780839791227],
+        [0.6339881742861017, 5.153788067237204, 0.9490187888655948, 1.041295158965467],
+        [0.6950108656594596, 4.576687967076702, 0.9477923366841775, 1.015519166099647],
+        [0.472542996321134, 5.314900987166155, 0.9438248560415902, 0.9398453641757403],
+        [0.4934730776721108, 3.826724792984248, 0.9411045382447505, 0.893851192199078],
+        [0.7811881640420477, 5.027293486057003, 0.9487061970829014, 1.034608461150556] 
+        ]
+      },
+     "Y":{
+       "0":        [
+[11.53900239351316, 5.240408645603143, 0.948841918276326, 1.037350433753096],
+        [1.091950057454667, 5.19780399020096, 0.9465991056715879, 0.9914331607386492],
+        [1.533420709157393, 5.19620694537047, 0.9467491141444861, 0.9943835974554363],
+        [1.657968247277796, 5.005250400780675, 0.9483165584918437, 1.026237287489023],
+        [1.247506063949152, 4.892140644682707, 0.9479901947090553, 1.019446639990592],
+        [4.16740689546638, 4.637166421416661, 0.9469015510650344, 0.9973988755749824],
+        [17.44354414966491, 5.305474909433253, 0.9486210464904704, 1.032650555387361],
+        [1.235052265915718, 4.954671688570514, 0.948147441604126, 1.022707803266015],
+        [1.019572850168034, 5.00265693696924, 0.948346563962212, 1.026865918323155],
+        [0.965793615454113, 1.458724401495944, 0.9380344162381927, 0.8466698772745018],
+        [0.4727948404541072, 5.340150191153969, 0.9438033585435205, 0.9393275036179892],
+        [0.9111906018980729, 5.033286928617176, 0.9484688296804122, 1.029435020412625],
+        [0.7537373402052471, 5.146641943044198, 0.948773485225602, 1.035889929850616],
+        [0.918363091999247, 5.044702391493748, 0.9484903081995231, 1.029887596140726],
+        [0.7050231030225143, 2.150344562059341, 0.9413971825628624, 0.8984631709185199],
+        [0.6078718003388246, 5.232263605820318, 0.9490089955842164, 1.040932680790299],
+        [0.6587374700913772, 5.205123251007715, 0.9489382672725419, 1.039413357980812],
+        [0.731558093970616, 5.139701670934095, 0.9488071702479155, 1.036608350447497],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.5838025485966881, 5.241002187161214, 0.9490324259999451, 1.041436922012627],
+        [0.4124632700164588, 5.38312956018592, 0.942080211710549, 0.9097180195076279],
+        [0.3896021175267629, 5.399074946998266, 0.9413284019729969, 0.897344337669142],
+        [2.190948055050042, 4.650147701402609, 0.9470637445458839, 1.000626211878374],
+        [0.9140369445399723, 1.256042131746844, 0.9363755250123986, 0.8231362411384339],
+        [0.6606668840387314, 5.166242695410464, 0.948899756584853, 1.038587874021844],
+        [0.6254023696293975, 5.221918588441604, 0.9490390693222147, 1.041579975974214],
+        [0.8016989073329048, 3.880857291652716, 0.9460008162743325, 0.9798287935474774],
+        [0.7763296746369367, 5.100535934028735, 0.948691143684272, 1.034137753840539],
+        [1.431848861028846, 3.399662497406663, 0.9442149560897496, 0.9466707908852743],
+        [0.8161806415811946, 5.094084793432754, 0.9486565150738464, 1.033402557615043],
+        [0.7554260531200225, 5.111684631376432, 0.9487299554063375, 1.034962941576153],
+        [0.713938009281216, 3.951509482775228, 0.9462540649911233, 0.9847092485989182],
+        [0.6199984333980403, 5.23512751072918, 0.9490139837491953, 1.04103999124708],
+        [1.05576438670415, 3.700697175104409, 0.9453633603363658, 0.9677443995492336],
+        [0.5857279180241838, 1.985098483485446, 0.9366681115129175, 0.8271974330810941],
+        [1.292431459393083, 4.923281391802206, 0.9481264717894751, 1.022271765108242],
+        [0.6188588734338799, 5.23007760994397, 0.9490585281632679, 1.041999207576054],
+        [1.195726136717898, 5.196500532559419, 0.9466448581284324, 0.9923312830636778],
+        [1.11894844043065, 5.196259479004703, 0.9466185216204722, 0.9918141084543203],
+        [1.646769059998851, 4.871842219017242, 0.9478225177606535, 1.015990821722419],
+        [1.363158441755285, 4.951624876383869, 0.9481459910322173, 1.022677629284743],
+        [1.004366284528041, 5.009766501218207, 0.9483815979434187, 1.027600823998914],
+        [0.7893565668306789, 5.1125422851695, 0.9487188052959294, 1.034725747838035],
+        [0.799727553364552, 5.102241089268087, 0.948683871979044, 1.033983286761967],
+        [0.361050617942024, 5.419299033198588, 0.9401047192355551, 0.8778685876011595],
+        [1.107141343017551, 4.921181751385992, 0.9481027575103717, 1.021779084194874],
+        [0.7060563634463823, 1.309295611754764, 0.9372039226506375, 0.8347327698079934],
+        [0.7154440544641185, 5.151831808795174, 0.9488402204675506, 1.037314151709591],
+        [0.9674264261766878, 5.028446530186549, 0.948452006164446, 1.029080794055934],
+        [1.980117710381196, 4.732352083674383, 0.9473569396808491, 1.006510694645208],
+        [2.186978759524025, 4.812964882971451, 0.9475598063885134, 1.010620783848062],
+        [2.963521088885732, 4.842334444866866, 0.9475089337737186, 1.009587117777916],
+        [0.9873827689093866, 5.011337015490522, 0.9483806051732755, 1.027579984986936],
+        [0.7605004202722124, 5.090744657812108, 0.9466813035543636, 0.9930478109700243],
+        [8.417209723265529, 4.914551761549022, 0.9474279628885861, 1.00794601958265],
+        [7.634269246627555, 5.010655279908749, 0.9478790251879151, 1.017152954545352],
+        [2.861203456835874, 4.580495257164913, 0.9467548399457333, 0.9944965445793289],
+        [1.906714809144416, 4.789447688916503, 0.9475686677478118, 1.010801040395276],
+        [1.765837137896679, 4.938090037760574, 0.9480571381951802, 1.020832575763729],
+        [0.881153137677512, 1.910855184715242, 0.9474843393885777, 1.009088109645339],
+        [1.631665877942948, 4.81430929138423, 0.9476882984656647, 1.013240529319128],
+        [0.9336455270852345, 5.041400529232171, 0.9484938786943158, 1.029962866933069],
+        [1.933546157515809, 2.427662773600215, 0.9404303732901605, 0.8829734599593398],
+        [1.873663858264583, 4.847562618455467, 0.947650673694145, 1.012472089591895],
+        [0.3520804297563899, 5.424243409593884, 0.9396383797375203, 0.8706542811180502],
+        [0.4727948404541072, 5.340150191153969, 0.9438033585435205, 0.9393275036179892],
+        [0.6680182184916642, 5.174777251399557, 0.9489177650758419, 1.038973734541921],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.5276746524936541, 5.311398213265711, 0.9491772112829731, 1.044563129845822],
+        [0.4131220344142683, 5.382661211220547, 0.9421017863473319, 0.9100778494042254],
+        [0.3334920007192532, 5.435710428748361, 0.9381085748021449, 0.8477513763779899],
+        [1.014386068568772, 0.9804600712115945, 0.9345558379089254, 0.7986936369416232],
+        [3.607541472466997, 5.216038897974642, 0.9470323510750409, 1.000000000000018],
+        [0.7514388434253464, 5.152247770185733, 0.9487865520404676, 1.036168501422059],
+        [1.130501447778387, 4.983350089746001, 0.9482811765471251, 1.025496953787958],
+        [0.7101559597357927, 5.21499009904665, 0.9490363060583658, 1.041520468709652],
+        [3.838974080607144, 3.635585986619069, 0.9445921635004186, 0.9534963326091344],
+        [0.5699822505959115, 4.335033869768405, 0.9471861079621876, 1.003074125473643],
+        [1.043672930571184, 4.978533130084758, 0.9483049196251502, 1.025993643368543],
+        [0.9301167020310283, 5.044268650283922, 0.948482341931202, 1.029719694187639],
+        [2.645928861865819, 4.928441772950587, 0.947960747176542, 1.01883811487004],
+        [0.5747909144592955, 0.8636193395313364, 0.9256649537664815, 0.6964758898292667],
+        [0.7218771114181409, 5.156211682432081, 0.9488462289920279, 1.037442564237887],
+        [0.3757022313973046, 5.408651465907328, 0.9406926471354544, 0.8871255565339062],
+        [5.292021432561833, 4.7630159797639, 0.9471409473171858, 1.002169354897641],
+        [1.038180590486081, 4.99069934793606, 0.9483035248632302, 1.025964453252876],
+        [0.5747909144592955, 0.8636193395313364, 0.9256649537664815, 0.6964758898292667],
+        [1.043053207592015, 4.936496513254889, 0.9481864262001632, 1.023519371765909],
+        [0.8240001303509196, 5.073890015764656, 0.9486157594927238, 1.03253854976833],
+        [1.11840404583823, 4.873426752269936, 0.9479850197332123, 1.019339650642266],
+        [0.4727948404541072, 5.340150191153969, 0.9438033585435205, 0.9393275036179892],
+        [1.46209049079128, 4.935674342157871, 0.9480663603091231, 1.021023781858343],
+        [0.8854730988540617, 3.831070109205736, 0.9458641235391877, 0.9772135090006612],
+        [1.482927697785422, 4.896850115478664, 0.9479105122441635, 1.017801611867803],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.7939342605266507, 5.099951751669191, 0.9486979673678871, 1.034282743776082],
+        [0.6886753528642902, 5.17881265556207, 0.9489138187402277, 1.038889154758604],
+        [4.929452692032936, 4.978698511493792, 0.9481060461218052, 1.021847380530019],
+        [0.6774698093865678, 1.463744377911385, 0.9381060216745338, 0.8477140995008963],
+        [0.8794496891648028, 3.1359852816169, 0.9438821596852978, 0.940725052739367],
+        [0.7567378203720825, 5.148071919047029, 0.9487755072343586, 1.035933027783188],
+        [1.000260885345552, 4.999810184289728, 0.9483618908271043, 1.027187306327253],
+        [0.6463709840447148, 5.215209894936484, 0.9489641405457401, 1.039968656192474],
+        [0.9367548157442577, 5.028596514279566, 0.9484395092573548, 1.028817815938381],
+        [0.4470070162010837, 5.380163362025593, 0.9492952557214995, 1.047125160511962],
+        [0.8609939854824479, 5.047978611609357, 0.9485404638082106, 1.030945900458025],
+        [0.5971799156439767, 5.247719000416708, 0.9490451842903024, 1.041711685592272],
+        [0.2775126793474481, 5.469510668925805, 0.9347790306049257, 0.8016182451756121],
+        [1.857736082305296, 4.931251278134951, 0.9480171438090901, 1.020004139875278],
+        [0.3896021175267629, 5.399074946998266, 0.9413284019729969, 0.897344337669142],
+        [1.854001045254186, 4.835563521342147, 0.9476403646111916, 1.012261731993003],
+        [0.4124632700164588, 5.38312956018592, 0.942080211710549, 0.9097180195076279],
+        [0.9748165585107706, 17.28253669135616, 0.9817962544520776, 3.016521992744536],
+        [0.5857279180241838, 1.985098483485446, 0.9366681115129175, 0.8271974330810941],
+        [1.193514542049556, 4.932676415168796, 0.9481407575241735, 1.022568778824337],
+        [0.9922396556240248, 5.196272068305198, 0.9465894291244804, 0.9912434069105044],
+        [2.716944104389726, 4.83862181949941, 0.94750641073804, 1.009535905085334],
+        [0.5618372766505458, 5.269215753887033, 0.9490951982195874, 1.042790117853357],
+        [1.108872366639437, 4.975604277140503, 0.9482557416560333, 1.024965378282725],
+        [0.3002105469032783, 5.457883331024024, 0.9364631012585753, 0.8243479045189687],
+        [0.7139449293574124, 5.17190775079108, 0.9488439779389174, 1.037394451817876],
+        [0.6692444624205139, 5.188442205941002, 0.9489455965188198, 1.039570602835017],
+        [0.9922396556240248, 5.196272068305198, 0.9465894291244804, 0.9912434069105044],
+        [0.7665814068605211, 5.123329495435135, 0.9487660156459593, 1.035730749629792],
+        [0.3757022313973046, 5.408651465907328, 0.9406926471354544, 0.8871255565339062],
+        [2.863292219354768, 4.812832304166461, 0.9474013507068905, 1.007407753563368],
+        [1.782033339290995, 4.800380978976658, 0.9476072390776088, 1.01158636339248],
+        [0.4727948404541072, 5.340150191153969, 0.9438033585435205, 0.9393275036179892],
+        [0.4960206386600531, 5.335739697933898, 0.949224601097061, 1.045590244795915],
+        [0.5905057170331657, 5.231019218265573, 0.9490096365374195, 1.040946468449155],
+        [1.009893211635555, 2.706333694511486, 0.9429073525099337, 0.9237080343873911],
+        [0.4823182899538285, 5.349833286948606, 0.9492506836905875, 1.046156370814215],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.7670656675243521, 5.132035746842762, 0.9487705897463089, 1.035828220329092],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.8428861707318057, 1.837923269741329, 0.9476001790810852, 1.011442533458562],
+        [1.065001479818607, 4.964490652426365, 0.9482240788461808, 1.024304372386528],
+        [0.7828757332817594, 5.101626356488025, 0.9486928697332621, 1.034174425363033],
+        [2.738127441144048, 4.807534839806759, 0.9473787766280537, 1.006951590216558],
+        [3.037059394631174, 4.867682138179581, 0.9477013615915183, 1.013507586194702],
+        [1.581142376989691, 1.490526907372117, 0.9371881912491459, 0.8345097006740878],
+        [3.183759133246315, 4.8614715001138, 0.9475720935725851, 1.010870744381993],
+        [1.065151968692538, 4.977587243543944, 0.9482880783725925, 1.025641288417188],
+        [2.416432357344385, 4.85173106912627, 0.9477439707155838, 1.014379596663968],
+        [5.518384121765633, 4.854887692006614, 0.9472663112552535, 1.004684777624571],
+        [1.436676110255795, 3.648535819843969, 0.9446728334191827, 0.9549681294914945],
+        [0.8367031464989463, 4.938023407792935, 0.9483012526570143, 1.025916903017351],
+        [0.5271266366672313, 5.31219877083389, 0.9491732898294138, 1.044478223047354],
+        [1.969820936508812, 3.662422649177391, 0.9447731856331782, 0.956805024853051],
+        [0.7845257191009433, 5.111500831453867, 0.9487122505958929, 1.034586359343711],
+        [0.916748473790764, 5.058193102832218, 0.9485461444911624, 1.031065895317776],
+        [0.9841172314103077, 6.777154763874677, 0.9698281641460582, 1.797789903487373],
+        [0.8571499787057562, 5.05714725062111, 0.9485570518973455, 1.031296370196818],
+        [1.252780966614653, 3.607759510650266, 0.9437396178201169, 0.9381999172150272],
+        [1.715060357713852, 4.9338051604209, 0.9480345297020069, 1.020364111179532],
+        [0.6887146642399938, 5.169436341044646, 0.9488949084349297, 1.038484041169821],
+        [1.169860761764175, 4.913159097105921, 0.9480650802887167, 1.020997238580714],
+        [0.9407743384079582, 3.088697556771756, 0.9438056114882987, 0.9393674054758659],
+        [3.893250903536693, 4.699461537623063, 0.947127490018836, 1.001900043670535],
+        [0.9441044040863782, 5.019543698243168, 0.9484181899624659, 1.028369478404914],
+        [4.355146212521056, 4.823487348904832, 0.9472213183097496, 1.003780621106904],
+        [0.6618455528988035, 1.364055424063489, 0.9375735328637452, 0.8400061437759677],
+        [0.548981694699522, 5.294337934077553, 0.9491375845686464, 1.043705739729271],
+        [0.9922396556240248, 5.196272068305198, 0.9465894291244804, 0.9912434069105044],
+        [0.9179044812078977, 5.044394035133944, 0.9485027968639024, 1.030150919436316],
+        [0.361050617942024, 5.419299033198588, 0.9401047192355551, 0.8778685876011595],
+        [6.876295606357473, 4.864815774027293, 0.947535157382009, 1.010119697420125],
+        [0.3520804297563899, 5.424243409593884, 0.9396383797375203, 0.8706542811180502],
+        [2.544837494173256, 3.521920000609445, 0.9441990253231469, 0.9463845557170421],
+        [0.603891841286635, 5.247388121876861, 0.9490427891677147, 1.041660093547123],
+        [0.484008547844867, 5.312471991595352, 0.9491741113319426, 1.04449600902757],
+        [1.373062847721786, 4.919405364816462, 0.9480354383653545, 1.02038293148906],
+        [0.608233509184904, 5.237821884668473, 0.9490799424363097, 1.042460938373021],
+        [0.669408147638378, 5.18380304298671, 0.94893521281611, 1.039347839662472],
+        [1.1314690270324, 4.918935784351252, 0.9481680430690288, 1.023136525679374],
+        [1.039856566432454, 4.983481224771734, 0.9483092515410069, 1.026084313419155],
+        [0.7858251954421919, 5.119211756891519, 0.9487494157681934, 1.035377164640513],
+        [3.194238175062835, 4.857690727275035, 0.9476012905863258, 1.011465175052791],
+        [0.8755801126544244, 5.070276452246964, 0.9485704163897833, 1.031578896894695],
+        [1.3153230993828, 4.881809164796187, 0.9479426671633739, 1.018464837502886],
+        [0.9922396556240248, 5.196272068305198, 0.9465894291244804, 0.9912434069105044],
+        [0.9404773317391132, 5.018308696019317, 0.9484141431498254, 1.028284417156412],
+        [0.6341963490047597, 5.215265451237025, 0.9490203473875555, 1.041176922764438],
+        [0.6972925318517915, 5.171176742053586, 0.9488914514568129, 1.038410015082761],
+        [0.4727948404541072, 5.340150191153969, 0.9438033585435205, 0.9393275036179892],
+        [0.5026959673044284, 5.318601143720054, 0.944382387250396, 0.9496890189012613],
+        [0.780269492334137, 5.063524190169711, 0.9486043868001306, 1.032297696142919] 
+        ]
+      }
+    },
+   "headers":    [
+["rate", "Mean posterior relative rate at a site"],
+    ["bias", "Mean posterior bias parameter at a site"],
+    ["Prob[bias>0]", "Posterior probability of substitution bias"],
+    ["BayesFactor[bias>0]", "Empiricial Bayes Factor for substitution bias"] 
+    ]
+  },
+ "analysis":{
+   "authors":"Sergei L Kosakovsky Pond",
+   "citation":"TBD",
+   "contact":"spond@temple.edu",
+   "info":"FADE (FUBAR Approach to Directional Evolution) is a fast method to test whether or not a subset of sites in a protein alignment\n                            evolve towards a particular residue along a subset of branches at accelerated rates compared to reference model.\n                            FADE uses a random effects model and latent Dirichlet allocation (LDA) - inspired approximation methods to allocate sites to rate classes.",
+   "requirements":"A protein alignment and a **rooted** phylogenetic tree (optionally annotated with {})",
+   "version":"0.2"
+  },
+ "branch attributes":{
+   "0":{
+     "Baboon":{
+       "GTR":0,
+       "original name":"Baboon"
+      },
+     "Cat":{
+       "GTR":0.5479738108231806,
+       "original name":"Cat"
+      },
+     "Chimp":{
+       "GTR":0.005354406956230157,
+       "original name":"Chimp"
+      },
+     "Cow":{
+       "GTR":0.5217716656054335,
+       "original name":"Cow"
+      },
+     "Horse":{
+       "GTR":0.3639593662085931,
+       "original name":"Horse"
+      },
+     "Human":{
+       "GTR":0,
+       "original name":"Human"
+      },
+     "Mouse":{
+       "GTR":0.1538063185305938,
+       "original name":"Mouse"
+      },
+     "Node1":{
+       "GTR":0.03774939091948738
+      },
+     "Node10":{
+       "GTR":0.04065491268006209
+      },
+     "Node13":{
+       "GTR":0.02528485699542644
+      },
+     "Node2":{
+       "GTR":0.4507260725563764
+      },
+     "Node3":{
+       "GTR":0.06938193079176812
+      },
+     "Node4":{
+       "GTR":0.2509978904573531
+      },
+     "Node9":{
+       "GTR":0.2259272621401927
+      },
+     "Pig":{
+       "GTR":0.3705420381298933,
+       "original name":"Pig"
+      },
+     "Rat":{
+       "GTR":0.1225892423633173,
+       "original name":"Rat"
+      },
+     "RhMonkey":{
+       "GTR":0.01051890950002691,
+       "original name":"RhMonkey"
+      }
+    },
+   "attributes":{
+     "GTR":{
+       "attribute type":"branch length",
+       "display order":0
+      },
+     "original name":{
+       "attribute type":"node label",
+       "display order":-1
+      }
+    }
+  },
+ "data partitions":{
+   "0":{
+     "coverage":      [
+[0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186] 
+      ],
+     "name":"fade.filter.default"
+    }
+  },
+ "fits":{
+   "GTR":{
+     "AIC-c":5159.231849035938,
+     "Equilibrium frequencies":      [
+[0.03384696455734124],
+      [0.02379421855942317],
+      [0.07116510014564366],
+      [0.06063513939424073],
+      [0.02621530635466421],
+      [0.05270341130752417],
+      [0.01804981525062285],
+      [0.07446640012659383],
+      [0.1050645690919535],
+      [0.09185268026948845],
+      [0.02464425428149188],
+      [0.07033121952127283],
+      [0.03713290409005404],
+      [0.02697358951223052],
+      [0.03378412161537671],
+      [0.06364460641047323],
+      [0.06994370764087279],
+      [0.07542893941378664],
+      [0.01961100044001494],
+      [0.02071205201693066] 
+      ],
+     "Log Likelihood":-2323.685267583662,
+     "Rate Distributions":null,
+     "display order":0,
+     "estimated parameters":225
+    }
+  },
+ "input":{
+   "file name":"/Users/ryanvelazquez/Documents/galaxy_items/tools-iuc/tools/hyphy/./test-data/fade-in1.fa",
+   "number of sequences":10,
+   "number of sites":187,
+   "partition count":1,
+   "trees":{
+     "0":"(((((Pig:0.147969,Cow:0.21343)Node4:0.08509899999999999,Horse:0.165787,Cat:0.264806)Node3:0.058611,((RhMonkey:0.002015,Baboon:0.003108)Node10:0.022733,(Human:0.004349,Chimp:0.000799)Node13:0.011873)Node9:0.101856)Node2:0.340802,Rat:0.050958)Node1:0.1,Mouse:0.09795)"
+    }
+  },
+ "settings":{
+   "bayes factor":100,
+   "burn-in":1000000,
+   "chain-length":2000000,
+   "chains":1,
+   "concentration":0.5,
+   "grid size":20,
+   "method":"Variational-Bayes",
+   "samples":100
+  },
+ "site annotations":{
+   "headers":{
+     "Composition":"Amino acid composition of site",
+     "Substitutions":"Substitution history on selected branches"
+    },
+   "site annotations":{
+     "0":      [
+["E1,K8", "K->E(1)"],
+      ["E9", ""],
+      ["I9", ""],
+      ["A1,R6,T6", "R->T(1), T->A(1)R(1)"],
+      ["D3,E1,K1,N11", "D->N(1), N->E(1)K(1)"],
+      ["A7,D1,N5,S3,T1", "N->A(1)D(1)S(2), S->T(1)"],
+      ["D1,E3,G1,I5,L7", "E->G(1)I(1), I->D(1)E(1)L(1)"],
+      ["E7,I1,T6,V3", "T->E(1)I(1)V(1)"],
+      ["I2,T7,V8", "V->I(2)T(1)"],
+      ["L1,W16", "W->L(1)"],
+      ["G17", ""],
+      ["A14,I1,T1,V1", "A->I(1)T(1)V(1)"],
+      ["L16,V1", "L->V(1)"],
+      ["D3,E1,G13", "G->D(1)E(1)"],
+      ["H4,Q12,R1", "H->Q(1), Q->H(1)R(1)"],
+      ["D14,G3", "G->D(1)"],
+      ["I16,L1", "I->L(1)"],
+      ["D3,N13,T1", "N->D(1)T(1)"],
+      ["L17", ""],
+      ["D14,N3", "N->D(1)"],
+      ["I17", ""],
+      ["P17", ""],
+      ["A1,D4,E1,G1,N3,S7", "D->A(1)E(1)G(1)S(1), N->D(1)"],
+      ["F15,L1,S1", "F->L(1)S(1)"],
+      ["P2,Q14,S1", "P->S(1), Q->P(1)"],
+      ["K2,M13,R1", "K->R(1), M->K(1)"],
+      ["G1,H1,S12,T3", "S->G(1)H(1), T->S(1)"],
+      ["D15,E1,I1", "D->E(1)I(1)"],
+      ["D13,H1,I1,N2", "D->H(1)I(1)N(2)"],
+      ["I13,V4", "I->V(2)"],
+      ["A1,D15,E1", "D->A(1)E(1)"],
+      ["D13,E3,H1", "D->H(1), E->D(1)"],
+      ["I14,V3", "V->I(1)"],
+      ["H1,K7,Q1,R8", "K->R(1), R->H(1)K(2)Q(1)"],
+      ["W17", ""],
+      ["E13,N1,Q1,S1,V1", "E->N(1)Q(1)S(1)V(1)"],
+      ["K13,R4", "K->R(1), R->K(1)"],
+      ["T9", ""],
+      ["S9", ""],
+      ["D7,G6,N3,R1", "G->D(1)N(1)R(1)"],
+      ["E1,G1,K13,S2", "K->E(1), S->G(1)K(1)"],
+      ["K10,N3,T4", "K->N(1)T(1), T->K(1)"],
+      ["K14,L3", "L->K(1)"],
+      ["I13,V4", "I->V(1), V->I(1)"],
+      ["A17", ""],
+      ["E4,K4,Q7,R2", "E->K(1), K->E(1)Q(1)R(2)"],
+      ["F16,I1", "F->I(1)"],
+      ["K9,Q1,R7", "K->Q(1)R(1)"],
+      ["I1,K12,N1,R3", "K->I(1)N(1), R->K(1)"],
+      ["D2,E9,G1,K3,N1,S1", "D->N(1), E->D(1)G(1)S(1), K->E(1)"],
+      ["K13,M2,N1,S1", "K->M(2)N(1)S(1)"],
+      ["E8,K6,M1,P2", "K->E(2)M(1)P(2)"],
+      ["L1,P4,T12", "P->T(1), T->L(1)P(1)"],
+      ["F13,H3,K1", "F->H(1)K(1)"],
+      ["E3,K4,L3,N2,P1,Q4", "K->E(1), L->Q(1), Q->K(1)N(2)P(1)"],
+      ["E11,I1,K3,P1,V1", "E->K(1)P(1)V(1), K->E(1)I(1)"],
+      ["D2,E2,K9,M1,S3", "E->D(2)K(2), K->M(1), S->E(1)"],
+      ["D10,E5,G1,K1", "E->D(2)G(1)K(1)"],
+      ["A4,K2,T11", "T->A(2)K(2)"],
+      ["F1,Y16", "Y->F(1)"],
+      ["D1,E7,K7,M1,N1", "E->D(1)K(1)M(1)N(1)"],
+      ["I1,L7,M3,V6", "V->I(1)L(1)M(1)"],
+      ["F8,L8,S1", "L->F(2)S(1)"],
+      ["A3,K10,M1,P2,T1", "A->K(1), K->M(1)P(1), P->T(1)"],
+      ["N17", ""],
+      ["G17", ""],
+      ["D1,S2,T14", "S->D(1)T(1)"],
+      ["L17", ""],
+      ["K16,R1", "K->R(1)"],
+      ["I16", ""],
+      ["K17", ""],
+      ["D1,H12,K1,N2,T1", "H->D(1)T(1), N->H(1)K(1)"],
+      ["P1", ""],
+      ["L16,M1", "L->M(1)"],
+      ["E1,K8,M7,T1", "M->E(1)K(2)T(1)"],
+      ["I3,L1,R9,T4", "R->L(1)T(1), T->I(1)"],
+      ["D10,E1,H3,I1,N2", "D->E(1)H(1)I(1)N(2)"],
+      ["D16,H1", "D->H(1)"],
+      ["C1,E5,Q7,S4", "E->C(1)Q(1)S(1), S->E(1)"],
+      ["D8,G9", "G->D(2)"],
+      ["I5,L1,S4,T7", "I->L(1), S->I(1), T->I(1)S(1)"],
+      ["Y17", ""],
+      ["E1,K13,N3", "K->E(1), N->K(1)"],
+      ["V17", ""],
+      ["D1,E1,M1,S10,T3,V1", "S->D(1)E(1)T(1)V(1), T->M(1)S(1)"],
+      ["A1,I10,V6", "I->A(1)V(1), V->I(1)"],
+      ["Y17", ""],
+      ["A1,D13,G2,S1", "D->A(1), G->D(1)S(1)"],
+      ["K1,S2,T14", "T->K(1)S(2)"],
+      ["D5,K7,N5", "D->N(1), N->D(1)K(1)"],
+      ["G17", ""],
+      ["K13,M2,T1,V1", "K->V(1), M->K(1)T(1)"],
+      ["H1,N13,R2,T1", "N->H(1), R->N(1)T(1)"],
+      ["I2,L1,M1,R1,V12", "I->R(1)V(1), V->L(1)M(1)"],
+      ["L17", ""],
+      ["D2,E14,S1", "E->D(2)S(1)"],
+      ["E1,K15,R1", "K->E(1)R(1)"],
+      ["A2,D1,I3,K3,T8", "A->D(1)T(1), T->I(1)K(1)"],
+      ["F14,L3", "L->F(1)"],
+      ["D15,H1,Q1", "D->H(1)Q(1)"],
+      ["L16,V1", "L->V(1)"],
+      ["K12,P1,R3,S1", "K->P(1)S(1), R->K(1)"],
+      ["I16,L1", "I->L(1)"],
+      ["L5,Q12", "L->Q(1), Q->L(2)"],
+      ["D1,E16", "E->D(1)"],
+      ["G1,K1,M7,R8", "M->G(1)K(1)R(2)"],
+      ["L1,V16", "V->L(1)"],
+      ["S17", ""],
+      ["E3,G1,K12,T1", "K->E(1)G(1)T(1)"],
+      ["P17", ""],
+      ["E2,K9,M3,N2,V1", "E->V(1), K->E(1)N(2), M->K(1)"],
+      ["I17", ""],
+      ["D1,H2,N1,S12,Y1", "H->S(1)Y(1), S->D(1)N(1)"],
+      ["W17", ""],
+      ["E3,I1,N1,S5,T7", "E->S(1), S->I(1)N(1)T(1)"],
+      ["C17", ""],
+      ["A2,I10,P1,S2,T2", "A->T(1), I->A(1)T(1), S->I(1)P(1)"],
+      ["D1,N16", "N->D(1)"],
+      ["A1,K3,R1,T12", "K->R(1), T->A(1)K(2)"],
+      ["T17", ""],
+      ["L14,V3", "L->V(1)"],
+      ["S1,T15,V1", "T->S(1)V(1)"],
+      ["C17", ""],
+      ["A1,E14,K2", "E->A(1)K(2)"],
+      ["V17", ""],
+      ["A1,E1,L3,M7,S1,T4", "L->T(1), T->A(1)E(1)M(1)S(1)"],
+      ["E3,K1,N12,Q1", "E->N(1)Q(1), N->E(1)K(1)"],
+      ["G17", ""],
+      ["S3,T14", "T->S(1)"],
+      ["D15,N1", "D->N(1)"],
+      ["F3,P13,V1", "F->P(1)V(1), P->F(1)"],
+      ["E14,K3", "E->K(1)"],
+      ["L17", ""],
+      ["K9,N7,Q1", "K->N(1)Q(1)"],
+      ["L17", ""],
+      ["F1,Y16", "Y->F(1)"],
+      ["L4,Q11,V2", "L->V(2), Q->L(1)"],
+      ["D8,G3,N6", "D->N(1), G->D(1)"],
+      ["E2,G11,K3,T1", "E->G(1)K(1), G->K(1), K->T(1)"],
+      ["E1,K7,R1,S1,T7", "T->E(1)K(1)R(1)S(1)"],
+      ["H11,L1,M1,R2,S1,T1", "H->L(1)M(1)R(1)S(1), R->T(1)"],
+      ["A1,I4,L10,V2", "I->A(1)V(1), L->I(1)V(1)"],
+      ["K12,N1,Q1,R3", "K->Q(1)R(1), R->K(1)N(1)"],
+      ["E4,K1,P1,Q1,S3", "E->K(1)P(1)Q(1), S->E(1)"],
+      ["D1,G2,L12,S1,V1", "G->D(1), L->G(1)S(1)V(1)"],
+      ["H1,P3,R2,S11", "P->R(1)S(1), S->H(1)P(1)R(1)"],
+      ["G1,Q14,R1,S1", "Q->G(1)R(1)S(1)"],
+      ["K10,R7", "K->R(1)"],
+      ["F1,L1,N1,T2,V12", "T->N(1)V(1), V->F(1)L(1)"],
+      ["I13,M3,S1", "I->S(1), M->I(1)"],
+      ["L1,S3,T12,V1", "S->T(1), T->L(1)V(1)"],
+      ["H7,W1,Y9", "Y->H(1)W(1)"],
+      ["K12,Q3,R1,T1", "K->R(1)T(1), Q->K(1)"],
+      ["F1,R1,W15", "W->F(1)R(1)"],
+      ["A4,I1,N3,T7", "A->I(1)N(1)T(1)"],
+      ["N1,S1,T15", "T->N(1)S(1)"],
+      ["K3,N6,R1,S7", "K->R(1), N->K(2)S(1)"],
+      ["L11,Q3,W3", "L->Q(1), Q->W(1)"],
+      ["I1,K1,N2,R2,S11", "R->N(1)S(1), S->I(1)K(1)N(1)"],
+      ["A13,I1,K1,T2", "A->I(1)T(1), T->K(1)"],
+      ["K7,L2,P3,S1,T4", "P->T(1), T->K(1)L(2)S(1)"],
+      ["F16,V1", "F->V(1)"],
+      ["K16,N1", "K->N(1)"],
+      ["C17", ""],
+      ["E1,K2,T11,V3", "K->E(1)T(1), T->V(1)"],
+      ["A17", ""],
+      ["E1,G7,I2,N1,S5,V1", "I->S(1)V(1), S->E(1)G(1)N(1)"],
+      ["N17", ""],
+      ["H1,K10,N2,P1,R2,T1", "K->N(1)T(1), N->H(1), R->K(1)P(1)"],
+      ["A1,V16", "V->A(1)"],
+      ["D1,S16", "S->D(1)"],
+      ["E3,K12,Q1,S1", "E->S(1), K->E(2)Q(1)"],
+      ["E15,K1,Q1", "E->K(1)Q(1)"],
+      ["I2,S14,V1", "I->V(1), S->I(1)"],
+      ["D1,E2,K1,R3,S10", "E->K(1)S(1), S->D(1)R(1)"],
+      ["I1,M11,S1,V4", "M->I(1)S(1)V(2)"],
+      ["E14,K1,V2", "E->K(1)V(2)"],
+      ["I1,M1,P3,T5,V7", "T->P(1), V->I(1)M(1)T(2)"],
+      ["A1,I5,V11", "I->A(1), V->I(1)"],
+      ["N3,R1,S11,T1,V1", "N->S(1), S->R(1)T(1)V(1)"],
+      ["C17", ""],
+      ["P14,S1,T2", "P->S(1)T(2)"],
+      ["D1,E15,G1", "E->D(1)G(1)"],
+      ["E1,K15,Q1", "K->E(1)Q(1)"],
+      ["G17", ""],
+      ["L17", ""],
+      ["D14,P1,S2", "S->D(1)P(1)"] 
+      ]
+    }
+  },
+ "tested":{
+   "0":{
+     "Baboon":"test",
+     "Cat":"test",
+     "Chimp":"test",
+     "Cow":"test",
+     "Horse":"test",
+     "Human":"test",
+     "Mouse":"test",
+     "Node1":"test",
+     "Node10":"test",
+     "Node13":"test",
+     "Node2":"test",
+     "Node3":"test",
+     "Node4":"test",
+     "Node9":"test",
+     "Pig":"test",
+     "Rat":"test",
+     "RhMonkey":"test"
+    }
+  },
+ "timers":{
+   "Baseline Fit":{
+     "order":1,
+     "timer":88
+    },
+   "Overall":{
+     "order":0,
+     "timer":121
+    },
+   "Residue A analysis":{
+     "order":2,
+     "timer":2
+    },
+   "Residue C analysis":{
+     "order":3,
+     "timer":1
+    },
+   "Residue D analysis":{
+     "order":4,
+     "timer":1
+    },
+   "Residue E analysis":{
+     "order":5,
+     "timer":1
+    },
+   "Residue F analysis":{
+     "order":6,
+     "timer":2
+    },
+   "Residue G analysis":{
+     "order":7,
+     "timer":1
+    },
+   "Residue H analysis":{
+     "order":8,
+     "timer":2
+    },
+   "Residue I analysis":{
+     "order":9,
+     "timer":1
+    },
+   "Residue K analysis":{
+     "order":10,
+     "timer":2
+    },
+   "Residue L analysis":{
+     "order":11,
+     "timer":1
+    },
+   "Residue M analysis":{
+     "order":12,
+     "timer":2
+    },
+   "Residue N analysis":{
+     "order":13,
+     "timer":2
+    },
+   "Residue P analysis":{
+     "order":14,
+     "timer":1
+    },
+   "Residue Q analysis":{
+     "order":15,
+     "timer":2
+    },
+   "Residue R analysis":{
+     "order":16,
+     "timer":2
+    },
+   "Residue S analysis":{
+     "order":17,
+     "timer":2
+    },
+   "Residue T analysis":{
+     "order":18,
+     "timer":2
+    },
+   "Residue V analysis":{
+     "order":19,
+     "timer":2
+    },
+   "Residue W analysis":{
+     "order":20,
+     "timer":2
+    },
+   "Residue Y analysis":{
+     "order":21,
+     "timer":2
+    }
+  }
+}
\ No newline at end of file
--- a/test-data/fubar-out1.json	Thu Jan 17 04:22:13 2019 -0500
+++ b/test-data/fubar-out1.json	Wed Aug 21 12:24:13 2019 -0400
@@ -1,3424 +1,1251 @@
 {
- "analysis":{
-   "info":"Perform a Fast Unbiased AppRoximate Bayesian (FUBAR)\n    analysis of a coding sequence alignment to determine whether some\n    sites have been subject to pervasive purifying or diversifying\n    selection.\n\n    Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as\n    directory as the original alignment. HyPhy needs to have write\n    privileges to this directory. For example if the original file is in\n    /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there\n    will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json,\n    /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also\n    provide checkpointing so that a partially completed analysis can be\n    restarted.",
-   "version":"2.0",
-   "citation":"FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205",
-   "authors":"Sergei L Kosakovsky Pond",
-   "contact":"spond@temple.edu",
-   "requirements":"in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition)"
-  },
- "input":{
-   "file name":"/tmp/tmpZU5xzE/job_working_directory/002/2526/working/fubar_input.fa",
-   "number of sequences":163,
-   "number of sites":566,
-   "partition count":1,
-   "trees":{
-     "0":"(KF790010:0.001247,CY147300:0.000623,((CY168239:0.001872,(CY171039:0.001874,KF790389:0.000623)Node7:0.000624)Node5:1e-10,((CY141224:0.001247,(CY147305:1e-10,KF790037:0.000623)Node13:0.000623)Node11:1e-10,(((KF790403:0.000623,KF761507:0.001876)Node18:1e-10,KC526205:0.000623)Node17:1e-10,((CY169303:1e-10,(KF789585:0.000623,CY141202:0.000623)Node25:0.000623)Node23:0.000623,(((KJ667974:0.002501,KJ938675:0.001873)Node30:0.000623,CY134876:1e-10)Node29:0.000623,((KF790414:0.001248,(KF790384:0.001245,KF790408:0.00125)Node37:1e-10)Node35:1e-10,((KF886352:0.001882,(KF790438:0.000623,CY134996:0.001873)Node43:0.000623)Node41:0.001875,(KF789591:0.001879,((KF790049:0.001255,(CY134956:0.000624,CY183153:0.000624)Node51:0.000626)Node49:0.001249,((CY168407:0.004394,CY183065:0.003128)Node55:1e-10,(KF598733:0.002501,((KC892174:1e-10,(KF685747:0.000624,CY168471:0.000625)Node63:0.00375)Node61:0.000624,(((KC892685:0.000624,KC892641:1e-10)Node68:0.001874,KC893110:0.001249)Node67:1e-10,(KC892480:1e-10,(JX913043:0.001249,(KF551075:0.00125,((CY114509:1e-10,(KC892889:1e-10,KC893018:0.002498)Node81:0.005006)Node79:0.001877,(((KC892519:1e-10,KC892498:0.000624)Node86:0.002497,KC892266:0.000623)Node85:0.001026,((KC892156:0.003756,(JX978746:0.001256,KC892407:0.001883)Node93:0.001875)Node91:0.00355,((KC535402:0.000623,(KC882488:0.002498,KC535387:0.001247)Node99:0.001872)Node97:1e-10,(KC535363:0.000623,((KC535396:0.000623,(KC882883:1e-10,KC882867:0.000623)Node107:0.003124)Node105:1e-10,((KC535378:0.001872,KC535375:0.002498)Node111:1e-10,(GQ385891:0.001248,((EU779522:0.001251,(CY037727:1e-10,FJ179354:0.003124)Node119:1e-10)Node117:0.000623,((GQ385889:0.005007,(FJ686933:0.001243,FJ179356:0.003117)Node125:1e-10)Node123:0.000622,(CY173095:0.001245,(((CY173191:1e-10,CY037703:0.001247)Node132:0.000622,CY035062:0.00249)Node131:1e-10,((CY173255:0.001871,(CY044748:1e-10,GQ385846:0.001247)Node139:0.000623)Node137:1e-10,((CY027075:0.000623,(EU199367:1e-10,CY172823:0.000623)Node145:1e-10)Node143:0.000623,(((CY172847:0.000623,CY025643:1e-10)Node150:0.000623,CY172839:0.000623)Node149:0.001247,(((CY026251:0.002497,CY092241:0.00125)Node156:0.000624,CY026019:0.000623)Node155:1e-10,((CY025341:0.002502,(CY172775:0.001247,CY172903:0.000623)Node163:0.001248)Node161:0.000622,(EU199255:0.003134,(CY172431:0.000621,((CY172223:0.003127,(CY172191:0.001254,CY020069:0.000628)Node173:0.000621)Node171:1e-10,((CY092217:0.003119,(CY025485:0.001283,EU516019:0.00059)Node179:0.008843)Node177:0.001868,(CY002080:0.000622,((CY002064:0.001873,(CY002456:0.000626,CY002048:0.002491)Node187:0.001243)Node185:0.003763,(AB434109:0.006307,(((CY088198:0.001245,CY088475:0.000621)Node194:1e-10,CY000257:0.000621)Node193:0.002494,((CY112957:0.003135,CY006859:0.001253)Node199:0.000616,((CY000721:0.001243,(CY114493:1e-10,CY090885:0.002483)Node205:0.002488)Node203:1e-10,((CY001792:0.000621,(CY001600:0.00062,CY002368:0.001865)Node211:1e-10)Node209:1e-10,((CY002304:0.002489,(CY006163:0.001242,CY003632:0.00062)Node217:1e-10)Node215:0.00062,(CY001920:0.003739,(CY001912:0.002498,((CY001504:1e-10,CY006060:0.001241)Node225:0.00062,((CY001744:1e-10,CY002136:0.00124)Node229:0.00062,((CY114309:0.003746,(CY006899:0.001874,CY112901:0.001863)Node235:0.002496)Node233:0.000618,(((CY006579:0.001245,CY006283:0.000621)Node240:0.001244,CY007979:0.001864)Node239:1e-10,((CY006499:0.001241,(CY006491:0.001863,CY006635:0.00124)Node247:1e-10)Node245:0.00062,(((CY036847:0.002495,CY010004:0.001867)Node252:0.000621,CY012200:0.000621)Node251:1e-10,(((CY010028:0.001242,CY009732:0.001242)Node258:1e-10,CY010012:0.002484)Node257:0.001875,(((CY010020:0.002497,CY011416:0.001237)Node264:0.001252,CY009484:0.00062)Node263:0.005658,((CY010036:1e-10,(CY039879:0.002489,CY039880:0.000621)Node271:0.002487)Node269:0.003109,((CY010628:0.000619,(CY010716:0.002485,CY010516:0.001239)Node277:1e-10)Node275:0.000619,((CY012728:1e-10,CY013701:0.000621)Node281:0.001243,(((CY012760:0.001239,CY013200:0.001239)Node286:1e-10,CY011888:0.005614)Node285:1e-10,((CY013693:0.000619,(CY012184:0.002484,CY013669:0.00124)Node293:0.00124)Node291:1e-10,((CY112669:0.004353,(CY112556:0.001861,CY011896:0.000619)Node299:0.00186)Node297:1e-10,(CY112605:0.001243,(CY012224:0.006953,((CY012512:0.000619,(CY012896:0.00062,CY012232:0.00062)Node309:0.000621)Node307:1e-10,(CY011848:1e-10,(((CY011328:1e-10,CY114221:0.000619)Node316:0.001241,CY011560:0.00124)Node315:1e-10,((CY012456:0.000619,CY011824:0.00124)Node321:1e-10,CY017283:0.000619)Node320:1e-10)Node314:1e-10)Node312:1e-10)Node306:0.002439)Node304:0.008263)Node302:0.000618)Node296:1e-10)Node290:1e-10)Node284:0.000617)Node280:0.012609)Node274:0.000619)Node268:0.001215)Node262:0.003782)Node256:0.000613)Node250:0.006878)Node244:1e-10)Node238:0.001862)Node232:1e-10)Node228:1e-10)Node224:0.001863)Node222:0.001862)Node220:0.001245)Node214:1e-10)Node208:0.001241)Node202:0.021084)Node198:0.000623)Node192:0.00065)Node190:0.003713)Node184:0.002495)Node182:1e-10)Node176:0.005637)Node170:0.00313)Node168:0.002515)Node166:0.001876)Node160:1e-10)Node154:0.000623)Node148:1e-10)Node142:0.003749)Node136:1e-10)Node130:1e-10)Node128:0.000623)Node122:0.000623)Node116:0.001872)Node114:0.002503)Node110:1e-10)Node104:1e-10)Node102:0.000623)Node96:0.001468)Node90:0.00189)Node84:0.002721)Node78:0.002524)Node76:1e-10)Node74:0.000624)Node72:1e-10)Node66:1e-10)Node60:1e-10)Node58:0.000623)Node54:0.001248)Node48:0.001255)Node46:0.000619)Node40:1e-10)Node34:1e-10)Node28:1e-10)Node22:0.000623)Node16:1e-10)Node10:1e-10)Node4:1e-10)"
-    }
-  },
- "fits":{
-   "Nucleotide GTR":{
-     "Log Likelihood":-7506.062471677546,
-     "estimated parameters":331,
-     "AIC-c":15676.51582297566,
-     "Equilibrium frequencies":[
-      [0.3365814708028934],
-      [0.1992564330464567],
-      [0.2239119281435395],
-      [0.2402501680071105]
-      ],
-     "Rate Distributions":{
-       "Substitution rate from nucleotide A to nucleotide C":0.2325974237345469,
-       "Substitution rate from nucleotide A to nucleotide G":1,
-       "Substitution rate from nucleotide A to nucleotide T":0.06339329733594212,
-       "Substitution rate from nucleotide C to nucleotide G":0.007769088370903177,
-       "Substitution rate from nucleotide C to nucleotide T":0.9319459934505461,
-       "Substitution rate from nucleotide G to nucleotide T":0.1767739885280695
-      },
-     "display order":0
-    }
-  },
- "timers":{
-   "Overall":{
-     "timer":187,
-     "order":0
+ "MLE":{
+   "content":{
+     "0":      [
+[2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [1.326584461663443, 0.6866899518991865, -0.6398945097642563, 0.6688273802220104, 0.2636275007897265, 0.8574905953981414, 0, 0],
+      [0.7044422164661149, 0.6750500349130593, -0.02939218155305567, 0.4326692199559115, 0.5033349164743647, 2.427334580981709, 0, 0],
+      [1.364044071446117, 0.7245533194421999, -0.6394907520039169, 0.659200973014336, 0.2700465050330634, 0.8860935649345238, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [0.8480568188667065, 0.3001964190676413, -0.5478603997990652, 0.7028888613991836, 0.2417160286876891, 0.7635013130968795, 0, 0],
+      [0.6407145320808335, 0.4049432206602815, -0.235771311420552, 0.5905083476225061, 0.346254278491581, 1.268593561124676, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [0.7426948982295435, 0.7567393857126714, 0.01404448748312792, 0.4171549324334423, 0.5177499183778403, 2.571484691201039, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [1.153196925053012, 0.9485395403166536, -0.2046573847363585, 0.5514252855343962, 0.3645416498468853, 1.374030198668673, 0, 0],
+      [1.657348732074937, 0.6709243865161684, -0.986424345558769, 0.7207273307001831, 0.2178413668084056, 0.6670858427096573, 0, 0],
+      [2.295030716391476, 0.9493945208348539, -1.345636195556623, 0.7893156105877124, 0.1072994329215472, 0.2878908287894031, 0, 0],
+      [1.742722766688323, 0.2655071923940618, -1.477215574294262, 0.8959706797226714, 0.07989792534668461, 0.2079867680564493, 0, 0],
+      [1.858688115011278, 0.2822767833344704, -1.576411331676808, 0.8948712160422522, 0.08060057820826491, 0.2099762353184742, 0, 0],
+      [1.462295776963819, 0.647481858108328, -0.8148139188554907, 0.7073099562386345, 0.2311854144936364, 0.7202363411906459, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [0.7965924808347636, 0.6723946718041862, -0.1241978090305774, 0.4619532406014427, 0.4742157332944405, 2.160252847322258, 0, 0],
+      [1.730611669879955, 0.2828747107364131, -1.447736959143542, 0.887471165266484, 0.08666510332417507, 0.227274348530725, 0, 0],
+      [2.602495274926114, 0.2224813986659689, -2.380013876260145, 0.9661218366567534, 0.02332290977910508, 0.0571963013340083, 0, 0],
+      [0.7155676309890805, 0.6269462570093068, -0.08862137397977365, 0.4574330127122577, 0.4791680668085074, 2.203568105590548, 0, 0],
+      [0.7667345160069771, 1.042311138764371, 0.2755766227573938, 0.3048304006736612, 0.6248180499681256, 3.988851282337214, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [1.605664748242327, 0.6699094415790486, -0.9357553066632779, 0.7154008733146512, 0.2226136777986788, 0.6858847762481378, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [1.274335021760559, 1.059102101214107, -0.2152329205464518, 0.4905281304227055, 0.4069189486928296, 1.643350037181603, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [0.7328609667105022, 0.321420041009705, -0.4114409257007972, 0.6646479981721136, 0.2754211816395606, 0.9104328448537105, 0, 0],
+      [0.5633775374085664, 0.412588968020095, -0.1507885693884715, 0.5594463064147368, 0.3741523105695181, 1.431910890812913, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [1.411229323895937, 0.3216744123664513, -1.089554911529486, 0.8466303440818401, 0.1201667848303901, 0.327129946035382, 0, 0],
+      [3.302941609624, 0.1850492796183848, -3.117892330005616, 0.9917075319934084, 0.004876505472719734, 0.01173729310433115, 0, 0],
+      [4.317381367747235, 0.2278370696733091, -4.089544298073926, 0.9932688400411571, 0.003502634222167776, 0.008418890201244731, 0, 0],
+      [0.9189159469735406, 0.3104615736420396, -0.608454373331501, 0.7085773158466656, 0.2382489657471109, 0.7491248183072722, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [1.650722867405387, 0.2698802705827703, -1.380842596822617, 0.8886769182619103, 0.08578222201781972, 0.2247417939059094, 0, 0],
+      [0.8581251001417857, 0.3151283961951446, -0.542996703946641, 0.6948816886935064, 0.2499169420615032, 0.7980361338527638, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [2.793930527759921, 0.199883177402779, -2.594047350357142, 0.9749913105193949, 0.01722935061386713, 0.0419906836150597, 0, 0],
+      [1.503274560483373, 0.2761358518728879, -1.227138708610485, 0.8762570114052354, 0.09583656628891586, 0.2538753409758923, 0, 0],
+      [1.604984873581414, 1.175504311101693, -0.4294805624797213, 0.5167167927662584, 0.3656119703648802, 1.380389479355224, 0, 0],
+      [1.501210896842389, 0.2781721065083809, -1.223038790334008, 0.8750941025399814, 0.09678775244670083, 0.2566650889970971, 0, 0],
+      [2.032885287425827, 0.2526724534526562, -1.78021283397317, 0.9151476244189045, 0.06457098303138756, 0.1653342290060737, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [1.229621115200008, 0.677939106828324, -0.551682008371684, 0.655250567932195, 0.2767036909439933, 0.916294157065912, 0, 0],
+      [0.7599622995778536, 0.6741928646519043, -0.08576943492594924, 0.4508961198549307, 0.4851391574419421, 2.256901891137146, 0, 0],
+      [1.879376393499176, 0.240065529767887, -1.639310863731289, 0.9140332690812286, 0.06549676873916299, 0.1678708468361843, 0, 0],
+      [1.766261266684407, 1.470153698359369, -0.2961075683250372, 0.473596130773459, 0.385202043891068, 1.500694813940046, 0, 0],
+      [1.608060328949007, 1.146868511991713, -0.4611918169572944, 0.5247621748246661, 0.3601255096864475, 1.348016795309073, 0, 0],
+      [2.041808409056078, 0.2430626548330942, -1.798745754222983, 0.9194171682845654, 0.06123102559392731, 0.1562244554717322, 0, 0],
+      [2.549669646869365, 0.2238937519965936, -2.325775894872772, 0.9644637288289274, 0.02453732793431319, 0.06024941384923261, 0, 0],
+      [1.743548262377597, 0.2635523370111365, -1.479995925366461, 0.8969020923916793, 0.0791542870408911, 0.2058845629526409, 0, 0],
+      [1.662352395428063, 0.6787682792500047, -0.9835841161780587, 0.718010296663618, 0.219704694673268, 0.6743984399677843, 0, 0],
+      [0.8480568188667065, 0.3001964190676413, -0.5478603997990652, 0.7028888613991836, 0.2417160286876891, 0.7635013130968795, 0, 0],
+      [2.713069997963883, 0.2211466969376935, -2.49192330102619, 0.9688919022223788, 0.0212803967087686, 0.05207840163310148, 0, 0],
+      [1.616127962602953, 0.2630711266850397, -1.353056835917914, 0.8898469190008278, 0.08482847118656173, 0.222011439768552, 0, 0],
+      [2.279322074257136, 0.9551648006533801, -1.324157273603756, 0.7861873087106248, 0.1094779719330255, 0.2944545643799232, 0, 0],
+      [1.756566699588696, 0.2649020017157946, -1.491664697872902, 0.8970028040277803, 0.079067126808086, 0.2056383903318181, 0, 0],
+      [0.7657252408667573, 0.3714304271517585, -0.3942948137149988, 0.6419577942236419, 0.2992628614449425, 1.022901705467324, 0, 0],
+      [0.7605506087703136, 4.355741402836008, 3.595190794065695, 0.01275623264308259, 0.9200558978235351, 27.56538090599603, 0, 0],
+      [1.624463408575006, 0.2892898587400246, -1.335173549834982, 0.8779496131269252, 0.0944192891185711, 0.2497294593028015, 0, 0],
+      [0.7176133860078803, 0.7791790563140245, 0.06156567030614424, 0.4027479922343384, 0.5322219361163756, 2.725141970166872, 0, 0],
+      [0.7610129014014071, 3.921361648967036, 3.160348747565629, 0.02519416110572637, 0.9041657044086439, 22.59765057077072, 0, 0],
+      [0.7037658431984266, 0.614469923739475, -0.08929591945895166, 0.4595500514810906, 0.4771307425213592, 2.185649439989767, 0, 0],
+      [0.7821908751413762, 1.488003285652003, 0.7058124105106272, 0.2003154397087835, 0.7220421994271963, 6.22185560380926, 0, 0],
+      [3.126063013843164, 0.2341572400445444, -2.891905773798619, 0.9458662867196799, 0.04056658491594634, 0.1012721015264885, 0, 0],
+      [1.862038107733967, 0.2602783032530522, -1.601759804480915, 0.9044612449236472, 0.07308282877168305, 0.1888472370848815, 0, 0],
+      [0.7363731176970694, 4.438584288229272, 3.702211170532203, 0.01127271243484089, 0.9268922074089908, 30.36699191355995, 0, 0],
+      [0.7578613595293222, 0.6223045817672984, -0.1355567777620238, 0.4731930071767209, 0.4637672637835113, 2.071490662448712, 0, 0],
+      [0.8416960205087416, 0.3160588090845224, -0.5256372114242192, 0.6912295569138541, 0.2530025951566601, 0.8112264396325762, 0, 0],
+      [2.987589768814864, 0.2203177968830249, -2.767271971931839, 0.9739997801741069, 0.01756398094442132, 0.0428208116135846, 0, 0],
+      [2.489223077676904, 1.543726966163925, -0.9454961115129792, 0.5896598739708137, 0.2200236764449403, 0.6756537808311702, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [1.495987125347247, 1.204921665711049, -0.2910654596361983, 0.4921772039825612, 0.3894504339139036, 1.527803424102102, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [2.775520506709386, 0.1998507783200244, -2.575669728389362, 0.9746836490790526, 0.01745485082274304, 0.04255002695172604, 0, 0],
+      [3.64929792298556, 1.057677387759602, -2.591620535225958, 0.796369227739712, 0.1044855319029141, 0.2794600709865418, 0, 0],
+      [4.304261960859849, 0.2266197643475381, -4.07764219651231, 0.9933067793557105, 0.003493985650373299, 0.008398029710083486, 0, 0],
+      [1.864362773820187, 0.2601938610237657, -1.604168912796422, 0.904610552614409, 0.07296324067621339, 0.1885138979680391, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [1.937304816437535, 0.3186403897163921, -1.618664426721143, 0.9110068718554183, 0.06357564346588562, 0.162612631219658, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [2.722096026111186, 0.2076524512494153, -2.514443574861771, 0.972079548446487, 0.01922813805313026, 0.04695755198000576, 0, 0],
+      [0.6278227706254484, 0.4087723771695084, -0.21905039345594, 0.5845018875536464, 0.3517906589477605, 1.299885897931855, 0, 0],
+      [1.285397693129743, 0.3652185651078851, -0.9201791280218574, 0.8142460184043707, 0.1472951582004584, 0.4137385195604344, 0, 0],
+      [0.8685836671371788, 0.2905153607616971, -0.5780683063754817, 0.7130917819405509, 0.232330898543071, 0.7248850204802761, 0, 0],
+      [2.928164496201757, 0.2037139399769213, -2.724450556224836, 0.9763749644671741, 0.0161609332896349, 0.03934400691624722, 0, 0],
+      [0.8416960205087416, 0.3160588090845224, -0.5256372114242192, 0.6912295569138541, 0.2530025951566601, 0.8112264396325762, 0, 0],
+      [2.746907868210185, 1.313755210136653, -1.433152658073532, 0.6688531447725541, 0.1721148351010172, 0.4979484886820624, 0, 0],
+      [0.9208212417490771, 0.3061537738540528, -0.6146674678950244, 0.7116452292091714, 0.2353094738960753, 0.7370380634950205, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [0.6830549229861463, 1.340720760172541, 0.6576658371863947, 0.1948752425902301, 0.7372975141017227, 6.722252186657174, 0, 0],
+      [1.605684552680128, 0.7445825297860948, -0.8611020228940327, 0.6854891397193715, 0.2441217322908456, 0.7735542879812745, 0, 0],
+      [1.822046350213707, 0.8090312551622649, -1.013015095051442, 0.6868527466817657, 0.2378026951869631, 0.7472838174506089, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [0.6619222329991969, 0.6819600717706008, 0.02003783877140386, 0.4144723824760573, 0.5216240278950246, 2.611706948510864, 0, 0],
+      [3.786815628158726, 1.07786287365082, -2.708952754507906, 0.7967122486288651, 0.1021660210921799, 0.2725502949549973, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [1.873267656651293, 0.2397824955158845, -1.633485161135408, 0.9138823238811953, 0.06561380270825315, 0.1681918733673217, 0, 0],
+      [0.8349494012649559, 0.3349262477907671, -0.5000231534741888, 0.6780501219789515, 0.2657648746118689, 0.8669591564108303, 0, 0],
+      [1.902648437455915, 0.285842245542125, -1.61680619191379, 0.8956414405113531, 0.07989902323924686, 0.2079898742216878, 0, 0],
+      [0.8413289269926802, 0.3170918045265821, -0.5242371224660981, 0.6905088046505177, 0.2537005513655062, 0.8142251338010831, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [3.387186234721501, 0.2112473560659068, -3.175938878655594, 0.9895507687489593, 0.005760533958747201, 0.01387739521416457, 0, 0],
+      [2.919946450282179, 0.1948702306933864, -2.725076219588793, 0.9779704514986532, 0.01513694959728189, 0.03681279010439272, 0, 0],
+      [0.8023749268032523, 1.042031745312136, 0.2396568185088837, 0.3144702868268676, 0.6138832511271126, 3.808056274316455, 0, 0],
+      [2.494571626448629, 0.6540193691845984, -1.840552257264031, 0.8628824082358969, 0.09145609303222008, 0.2411031798790284, 0, 0],
+      [0.742695565114325, 0.7567828440366443, 0.01408727892231931, 0.4171425746638713, 0.5177617948476301, 2.571607009000175, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [0.7411180987805507, 0.6631347288734212, -0.07798336990712951, 0.449652191428764, 0.4865267497524576, 2.269473487008929, 0, 0],
+      [1.920847284679098, 0.2526332522821533, -1.668214032396945, 0.9104801188642564, 0.06830183320609921, 0.1755873939537097, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [1.743351239622229, 0.2645110977049235, -1.478840141917306, 0.8964549032739688, 0.07951239613919087, 0.2068964842913939, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [1.501954687380675, 0.278128002801216, -1.223826684579459, 0.8751671988499461, 0.09672840828869606, 0.2564908657849599, 0, 0],
+      [0.7325485324300882, 0.3224277169707178, -0.4101208154593704, 0.6638839138061341, 0.2761739085873867, 0.9138704327384952, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [1.353115821206738, 0.6467441176868775, -0.7063717035198603, 0.6915151456155416, 0.2453358561118626, 0.7786522150582381, 0, 0],
+      [1.624700021251021, 0.2892772440453912, -1.33542277720563, 0.8779711778172872, 0.09440164574470215, 0.2496779299054853, 0, 0],
+      [1.729711623856265, 0.2830532581509971, -1.446658365705268, 0.8873366269921877, 0.08677327894421741, 0.2275849882214268, 0, 0],
+      [1.257800627128203, 0.637714668176253, -0.6200859589519502, 0.6797983976960225, 0.2563484968975349, 0.8256529351010667, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [0.6278227706254484, 0.4087723771695084, -0.21905039345594, 0.5845018875536464, 0.3517906589477605, 1.299885897931855, 0, 0],
+      [0.7113510766468931, 1.078428517088401, 0.367077440441508, 0.2814069990994744, 0.6504841717134379, 4.457651364809978, 0, 0],
+      [0.7996107704455671, 0.302955166084563, -0.4966556043610041, 0.6916812678477128, 0.2511006961520881, 0.803083501313469, 0, 0],
+      [2.798107611050863, 0.2601428561108833, -2.53796475493998, 0.9616160947321236, 0.02537634796824449, 0.06236319948987139, 0, 0],
+      [2.570584204922366, 0.2438763494757367, -2.326707855446629, 0.9600264722827418, 0.02724142776651905, 0.06707505125118332, 0, 0],
+      [1.661073008368179, 0.2390852637271834, -1.421987744640996, 0.9039246178963928, 0.07344356910775592, 0.1898532837300752, 0, 0],
+      [2.701000599821874, 0.2212080324340305, -2.479792567387844, 0.9686008686485179, 0.02149740177669253, 0.05262113412211218, 0, 0],
+      [1.787180720258427, 0.3286986295190493, -1.458482090739378, 0.8982083955161753, 0.07411399902369871, 0.1917250870213767, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [0.9069843602336246, 0.3405577178144697, -0.5664266424191549, 0.6881777645481555, 0.2577911157882818, 0.8319131929320386, 0, 0],
+      [0.7465893429238813, 2.78124223946841, 2.034652896544528, 0.06920883155966301, 0.8558983986595302, 14.22622328385812, 0, 0],
+      [1.663531656470842, 0.6796380646068007, -0.9838935918640414, 0.7177914263030383, 0.2198444779238854, 0.6749484253778161, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [0.7689842149875941, 2.141309247110912, 1.372325032123318, 0.1038693636855952, 0.8147631412485382, 10.53513682034151, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [1.919674046724737, 0.2557463623865781, -1.663927684338159, 0.9091027946337829, 0.06938471489070575, 0.1785787754285515, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [1.506375105164787, 1.063111425897198, -0.4432636792675888, 0.5326910031119408, 0.3610235513155881, 1.353277610372559, 0, 0],
+      [0.8685836671371788, 0.2905153607616971, -0.5780683063754817, 0.7130917819405509, 0.232330898543071, 0.7248850204802761, 0, 0],
+      [3.451824579889786, 0.214560975056878, -3.237263604832908, 0.9897039575649812, 0.005607877654465379, 0.01350756508890382, 0, 0],
+      [2.700779631122101, 0.6746219115862104, -2.026157719535891, 0.8671668195038424, 0.08612341561717247, 0.2257199313333731, 0, 0],
+      [1.779911517956791, 0.3088143225540966, -1.471097195402695, 0.8792019612274415, 0.09300188382950517, 0.2455961613350229, 0, 0],
+      [1.633472785245697, 0.6742902645208331, -0.9591825207248643, 0.7166847785517662, 0.2211860075746735, 0.6802367920237758, 0, 0],
+      [1.753405633773848, 0.2402286058560535, -1.513177027917795, 0.9080473025926977, 0.07021910936090224, 0.1808884821256728, 0, 0],
+      [0.7255803984454627, 0.6752135873212372, -0.05036681112422559, 0.4396650296817604, 0.4963260248244654, 2.36022687093637, 0, 0],
+      [1.895130589358206, 0.2304828235480357, -1.664647765810171, 0.9188644955697192, 0.06165299133776826, 0.1573717930216221, 0, 0],
+      [1.554682240139504, 1.244007765169255, -0.3106744749702488, 0.4920480731306207, 0.385518753175659, 1.502702778118395, 0, 0],
+      [0.6229460658404642, 6.61635765410336, 5.993411588262895, 0.0007870050179914917, 0.9822399729850609, 132.4677610341287, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [0.8709633661866046, 0.659762956568904, -0.2112004096177006, 0.4853549945817344, 0.4514979300969505, 1.971576834631994, 0, 0],
+      [1.541258188038998, 0.2561279089288561, -1.285130279110141, 0.8887901217962132, 0.08560962774865404, 0.2242472768464539, 0, 0],
+      [5.763564244045058, 4.313662900693722, -1.449901343351335, 0.3549832822803987, 0.1521727382798397, 0.4298982650355049, 0, 0],
+      [4.462334854805063, 0.7624322235374025, -3.699902631267661, 0.9354398204449704, 0.02352973492308491, 0.05771573432013137, 0, 0],
+      [0.7631939645826666, 1.739560474282176, 0.9763665096995091, 0.1687151478496795, 0.7545065686651785, 7.361382133003764, 0, 0],
+      [1.818596512727066, 5.925192472261644, 4.106595959534578, 0.02418182571953505, 0.8067395939434024, 9.998312310710213, 0, 0],
+      [0.931145827977152, 0.2846414095958125, -0.6465044183813394, 0.7274662972134441, 0.2201507224201144, 0.6761540514889791, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [1.904035923440845, 0.2858304767112463, -1.618205446729599, 0.8957183720535145, 0.07983579159391586, 0.2078109908927747, 0, 0],
+      [0.931145827977152, 0.2846414095958125, -0.6465044183813394, 0.7274662972134441, 0.2201507224201144, 0.6761540514889791, 0, 0],
+      [0.9187644488124748, 0.2907713162751833, -0.6279931325372914, 0.7213561833669669, 0.2257631426513465, 0.6984179841230589, 0, 0],
+      [1.320888428494519, 0.3633479275627262, -0.9575405009317928, 0.8187508820760789, 0.1434199074784897, 0.4010307504963565, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.6407145320808335, 0.4049432206602815, -0.235771311420552, 0.5905083476225061, 0.346254278491581, 1.268593561124676, 0, 0],
+      [0.7026090593643954, 1.039481091461486, 0.3368720320970906, 0.2859460945596721, 0.6465759437366685, 4.381871618321741, 0, 0],
+      [1.783909762800731, 1.094750076730025, -0.6891596860707065, 0.5631165637485588, 0.3264576267872301, 1.160908818646103, 0, 0],
+      [1.352596444534705, 1.994718123797019, 0.6421216792623141, 0.3426069268149785, 0.5210463692523918, 2.605668231725639, 0, 0],
+      [0.8049599127791895, 1.646004954853845, 0.8410450420746554, 0.1866932864140251, 0.7325562012233916, 6.560616179233343, 0, 0],
+      [0.7425362241635017, 0.7467002349139477, 0.004164010750445923, 0.4200950106804633, 0.5149254231143957, 2.542564827531284, 0, 0],
+      [2.029948337581035, 0.2527699055288971, -1.777178432052138, 0.9149893439076437, 0.0646963347424563, 0.1656773940215658, 0, 0],
+      [4.644220835204568, 0.2696664184292823, -4.374554416775285, 0.9909807795780773, 0.004077019982419818, 0.009805128745292034, 0, 0],
+      [0.8581251001417857, 0.3151283961951446, -0.542996703946641, 0.6948816886935064, 0.2499169420615032, 0.7980361338527638, 0, 0],
+      [1.746330243715225, 0.249559102874969, -1.496771140840256, 0.9034119187705721, 0.07394291603574132, 0.1912471752095722, 0, 0],
+      [2.59888637105331, 1.94032890014777, -0.65855747090554, 0.5462070885792962, 0.1946984920818681, 0.5790822985428166, 0, 0],
+      [1.863147880609128, 0.2535652848077214, -1.609582595801406, 0.9074232209282979, 0.07074130264591792, 0.1823360876977823, 0, 0],
+      [1.229580200911435, 0.6825036197714937, -0.5470765811399411, 0.6531631077972776, 0.2783825680472324, 0.9239984334681454, 0, 0],
+      [0.8421048321324549, 0.3150519454837218, -0.5270528866487331, 0.6919746692008777, 0.2522813155442383, 0.8081334209422766, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [0.8581251001417857, 0.3151283961951446, -0.542996703946641, 0.6948816886935064, 0.2499169420615032, 0.7980361338527638, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [1.710867974270017, 1.001663632478495, -0.7092043417915217, 0.5818727973423219, 0.318200225378749, 1.117840508210538, 0, 0],
+      [0.8212002526189417, 3.291773107509431, 2.47057285489049, 0.06123001922526119, 0.8558381292887211, 14.21927442236512, 0, 0],
+      [1.905037995765493, 0.2858032261353223, -1.61923476963017, 0.8957779150896343, 0.07978752309165862, 0.2076744550790211, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.282034820307396, 0.3655380196431093, -0.9164968006642868, 0.8137532352243888, 0.147719762205785, 0.4151379108074193, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [0.7376055992753445, 0.7022325911002688, -0.03537300817507572, 0.433353970797499, 0.5022568532607289, 2.416889506950157, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [1.524394774906981, 0.2464825766905318, -1.277912198216449, 0.8927165398901694, 0.08235059418597659, 0.2149444140775174, 0, 0],
+      [0.8413289269926802, 0.3170918045265821, -0.5242371224660981, 0.6905088046505177, 0.2537005513655062, 0.8142251338010831, 0, 0],
+      [0.8955032225314258, 0.3075077651260756, -0.5879954574053502, 0.7065167161121573, 0.2396172098458001, 0.754782707870514, 0, 0],
+      [0.8955032225314258, 0.3075077651260756, -0.5879954574053502, 0.7065167161121573, 0.2396172098458001, 0.754782707870514, 0, 0],
+      [2.343326273110414, 0.2266611308773145, -2.1166651422331, 0.957885223829875, 0.02952508968731394, 0.07286905331394156, 0, 0],
+      [1.539563381739466, 0.9141649586716197, -0.6253984230678463, 0.5871833020252178, 0.3226353505137005, 1.140842355219448, 0, 0],
+      [1.507791376288463, 0.2758634510443385, -1.231927925244125, 0.8766999670292559, 0.0954768426828316, 0.2528218313137994, 0, 0],
+      [0.7597222476253296, 1.458943887748978, 0.6992216401236486, 0.198939597802759, 0.725618306933985, 6.334164143965718, 0, 0],
+      [0.7335670368098717, 0.988818057275592, 0.2552510204657203, 0.3063160231488954, 0.6252161065159412, 3.995631726301631, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [0.6147463085734644, 5.936472724302782, 5.321726415729318, 0.002896338593541511, 0.9716589436992783, 82.11718129073202, 0, 0],
+      [1.616042977856794, 1.030258895020972, -0.5857840828358223, 0.5597427269856019, 0.3369155498900426, 1.216993969425436, 0, 0],
+      [1.90588730990473, 0.3206525773190674, -1.585234732585663, 0.9084569887157475, 0.06566636010839269, 0.1683360655406442, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [1.459060448618787, 0.6563639200910173, -0.8026965285277697, 0.7027696831015313, 0.2347053973155902, 0.7345656912892152, 0, 0],
+      [0.7823907673837678, 1.466341652200509, 0.6839508848167417, 0.2477939413838693, 0.6785233544312196, 5.055354162207776, 0, 0],
+      [0.7211684012464409, 1.024593695661622, 0.3034252944151815, 0.2947572285426556, 0.6369855093811445, 4.202829823585563, 0, 0],
+      [0.7250952827988718, 1.397779402542775, 0.6726841197439032, 0.2408336644771779, 0.6896505056846669, 5.322482360712447, 0, 0],
+      [2.566819707412531, 0.1979803487474765, -2.368839358665054, 0.9710569888750116, 0.02016554489785793, 0.04929393278546075, 0, 0],
+      [1.712509458851301, 1.500775538203543, -0.211733920647758, 0.4146640165636826, 0.4252831286207499, 1.772394614055697, 0, 0],
+      [1.381034535848549, 1.138899196258157, -0.242135339590392, 0.489292466957687, 0.3998536663656135, 1.595806167292471, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [1.675143101346285, 0.268646745802301, -1.406496355543984, 0.8906919548345565, 0.08415256213574822, 0.2200799214098297, 0, 0],
+      [1.730773810776718, 0.2841512539823455, -1.446622556794372, 0.8869103661104778, 0.08710857350345313, 0.2285482958095647, 0, 0],
+      [1.638747775755227, 0.268553577251767, -1.37019419850346, 0.8885860056821538, 0.08585407153980482, 0.2249477121875093, 0, 0],
+      [0.7954522972343232, 0.6745393774350319, -0.1209129197992913, 0.4607787000085702, 0.4753406283351182, 2.170019892461425, 0, 0],
+      [0.9187644488124748, 0.2907713162751833, -0.6279931325372914, 0.7213561833669669, 0.2257631426513465, 0.6984179841230589, 0, 0],
+      [1.889506181759104, 0.230067640967214, -1.65943854079189, 0.9188103895004665, 0.0616924057967223, 0.1574790148177592, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [2.014357542873281, 0.2987205102993676, -1.715637032573913, 0.8958395998636448, 0.07941709155351404, 0.2066271019274084, 0, 0],
+      [2.743549194957172, 0.6805855732637562, -2.062963621693416, 0.8673620165577599, 0.08538166791253048, 0.2235944124226713, 0, 0],
+      [2.774877169846422, 0.2231174947621885, -2.551759675084234, 0.9696634131160771, 0.02066069373762795, 0.05052984062537, 0, 0],
+      [0.6728838997947185, 0.7181213201747741, 0.04523742038005563, 0.4056776367834102, 0.5301755871804922, 2.702840141645126, 0, 0],
+      [1.505875661392323, 0.2769241767067402, -1.228951484685582, 0.8760355658981231, 0.09602005474535816, 0.2544130399726064, 0, 0],
+      [1.695453273934973, 1.060171710769558, -0.6352815631654158, 0.5618234750598797, 0.331483617393565, 1.187643863012009, 0, 0],
+      [2.54681613164974, 0.2389113071050493, -2.30790482454469, 0.9606394279041347, 0.02695660249203359, 0.06635431318241294, 0, 0],
+      [5.399996881061978, 0.2330245903086047, -5.166972290753373, 0.9982294850181469, 0.0006471178277486317, 0.001550960399438966, 0, 0],
+      [1.504774521025008, 1.222640114161554, -0.2821344068634544, 0.4892820323397966, 0.3908542532767139, 1.536844191569584, 0, 0],
+      [1.631915412238175, 0.6366317212074204, -0.9952836910307543, 0.7329905167693848, 0.2092440825696612, 0.633792285025174, 0, 0],
+      [1.646393916298464, 0.2691103141528282, -1.377283602145636, 0.8887774219620502, 0.08570005860837805, 0.2245063560402844, 0, 0],
+      [9.500793331259231, 1.294521716152572, -8.20627161510666, 0.923415043445955, 0.01412333948363344, 0.03431239454065865, 0, 0],
+      [0.7735198030716636, 1.040127644119286, 0.2666078410476226, 0.307053406360145, 0.6223566765722969, 3.947242024579916, 0, 0],
+      [1.545430679718085, 0.2558856045157459, -1.289545075202339, 0.8891628780252659, 0.08531126346480987, 0.2233928437310285, 0, 0],
+      [3.705135063839384, 5.322912736305301, 1.617777672465917, 0.1085121783673225, 0.4774157072671093, 2.188147356329147, 0, 0],
+      [2.263404227844521, 12.02549738455911, 9.762093156714592, 0.003769688778279543, 0.9100366661524345, 24.22866937556486, 0, 0],
+      [1.390843489688676, 0.7052494183599154, -0.6855940713287603, 0.671266208567817, 0.2601436178308499, 0.8421742629257648, 0, 0],
+      [2.937472380520142, 0.1953886187691092, -2.742083761751033, 0.9781192854377576, 0.01502302177173476, 0.03653149375351223, 0, 0],
+      [1.770250248637279, 2.240326220815087, 0.4700759721778081, 0.242282876041553, 0.5238175296650828, 2.634770779219897, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [1.3693202037403, 0.7232724661991325, -0.6460477375411671, 0.6605745860212804, 0.2688524377736423, 0.8807347991503898, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [3.244818893100313, 0.2346271545142999, -3.010191738586014, 0.9468632667914513, 0.03982355472076632, 0.09934023646106502, 0, 0],
+      [0.8577468718558526, 0.3161602364843448, -0.5415866353715079, 0.6941640293597584, 0.2506102154382269, 0.800990223099052, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [4.048264650648741, 0.2230099376885046, -3.825254712960236, 0.9958046817256754, 0.001506006657655826, 0.003612581462354708, 0, 0],
+      [1.499333132383459, 0.6298118645993644, -0.8695212677840949, 0.7205048332396786, 0.2205166645919689, 0.6775959382894522, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [0.8349494012649559, 0.3349262477907671, -0.5000231534741888, 0.6780501219789515, 0.2657648746118689, 0.8669591564108303, 0, 0],
+      [0.6407145320808335, 0.4049432206602815, -0.235771311420552, 0.5905083476225061, 0.346254278491581, 1.268593561124676, 0, 0],
+      [1.860810136262162, 0.2698906947309799, -1.590919441531182, 0.9002704685618541, 0.07637758088967682, 0.1980649582396933, 0, 0],
+      [1.599796099257637, 0.6700645033734002, -0.9297315958842366, 0.7146818546435636, 0.2232488623524731, 0.6884042935745529, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [1.527625462240821, 0.246331715542421, -1.2812937466984, 0.8929815889433202, 0.08213990144891682, 0.2143452683031978, 0, 0],
+      [1.919039571581193, 0.255792279082975, -1.663247292498218, 0.9090578169183631, 0.06942004251653258, 0.1786764826784749, 0, 0],
+      [0.6278227706254484, 0.4087723771695084, -0.21905039345594, 0.5845018875536464, 0.3517906589477605, 1.299885897931855, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [0.8480568188667065, 0.3001964190676413, -0.5478603997990652, 0.7028888613991836, 0.2417160286876891, 0.7635013130968795, 0, 0],
+      [0.8416960205087416, 0.3160588090845224, -0.5256372114242192, 0.6912295569138541, 0.2530025951566601, 0.8112264396325762, 0, 0],
+      [1.424646719587872, 0.2723949818440354, -1.152251737743836, 0.8727958956292113, 0.09860518094191038, 0.2620118241407057, 0, 0],
+      [0.8549351707814108, 0.2845536730361729, -0.5703814977452379, 0.7148108218972721, 0.2301796354310114, 0.7161660283028319, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.11106000581478, 1.493915047570458, 0.3828550417556773, 0.2566608904172925, 0.6479362878472523, 4.408057525482493, 0, 0],
+      [1.349660109596105, 2.822481217409307, 1.472821107813201, 0.1901380014885492, 0.6435910839640361, 4.325115134793862, 0, 0],
+      [0.761193029800719, 0.9272115936768615, 0.1660185638761424, 0.3292602922773508, 0.6021469426209632, 3.625066681660522, 0, 0],
+      [1.524404755367687, 0.2464912746279464, -1.277913480739741, 0.892712411181786, 0.08235401337311909, 0.2149541394698072, 0, 0],
+      [0.8044291695791962, 1.042057740044257, 0.2376285704650613, 0.3149975479306061, 0.6132860201631944, 3.79847617487906, 0, 0],
+      [1.879497341776864, 0.2304197098062002, -1.649077631970663, 0.9182303574888929, 0.0621493677045017, 0.1587227768808962, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [1.148115914650473, 2.330437132939804, 1.182321218289331, 0.1384185145804849, 0.741329570251861, 6.864371080406259, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [2.677049205326456, 0.2032112695449108, -2.473837935781545, 0.9721626750556621, 0.01925133496251611, 0.04701531376646965, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [0.7593979394835735, 0.6418425181224112, -0.1175554213611623, 0.4644911830250344, 0.472119666720517, 2.142164527941197, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [0.6713222413056639, 0.6814659861128622, 0.01014374480719837, 0.4181157868311284, 0.5179318615747935, 2.573359216461486, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [1.479217105768024, 2.420709185829176, 0.9414920800611517, 0.1730997649088397, 0.6107278630618306, 3.757773754605215, 0, 0],
+      [0.7813276113179595, 0.6699714012435808, -0.1113562100743787, 0.45875384672468, 0.4774146455078587, 2.188138044206637, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [0.7631604592264036, 1.659748114697486, 0.8965876554710819, 0.1764947714107178, 0.7468659032573302, 7.066887847623881, 0, 0],
+      [0.8344992634882009, 0.336279461081442, -0.4982198024067589, 0.6771363047206318, 0.266649928539918, 0.8708961023578421, 0, 0],
+      [2.046403384629288, 0.2429978890658415, -1.803405495563447, 0.9196178332651755, 0.06107223198524752, 0.1557929579347113, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [1.635185172249105, 0.2860059594120951, -1.34917921283701, 0.8801732496400287, 0.09262154132858452, 0.2444892413669457, 0, 0],
+      [1.743267233394479, 0.2635647852296706, -1.479702448164808, 0.8968810317807132, 0.07917122269495742, 0.2059324008887219, 0, 0],
+      [0.8581251001417857, 0.3151283961951446, -0.542996703946641, 0.6948816886935064, 0.2499169420615032, 0.7980361338527638, 0, 0],
+      [1.918648685215417, 0.2557836804600884, -1.662865004755328, 0.9090430872255116, 0.0694323558844222, 0.178710540073484, 0, 0],
+      [0.8685836671371788, 0.2905153607616971, -0.5780683063754817, 0.7130917819405509, 0.232330898543071, 0.7248850204802761, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [2.543963445541376, 0.2229913006648602, -2.320972144876515, 0.9645575937573806, 0.02449373453158738, 0.06013968615190954, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [0.7406162587166062, 0.6339567407087718, -0.1066595180078344, 0.4623477453494851, 0.4742925455336066, 2.160918449781227, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.789678730029896, 0.2625890747518534, -1.527089655278042, 0.899776791579752, 0.07684335995044228, 0.199373375639439, 0, 0],
+      [3.016306891077287, 0.2482318869972751, -2.768075004080012, 0.9686435445703657, 0.02067222687681745, 0.05055864261507637, 0, 0],
+      [2.014828834059244, 0.2987049706209536, -1.716123863438291, 0.8958673106867471, 0.07939452989703774, 0.2065633386344154, 0, 0],
+      [0.7599495494896811, 0.6734984121770911, -0.08645113731259002, 0.4511727015389331, 0.4848746492866482, 2.254513131268111, 0, 0],
+      [0.8577468718558526, 0.3161602364843448, -0.5415866353715079, 0.6941640293597584, 0.2506102154382269, 0.800990223099052, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [2.39009930360939, 0.2074996492401507, -2.182599654369239, 0.9643644799527623, 0.02503303511184635, 0.06149783427484446, 0, 0],
+      [1.3613908725758, 0.7254443668878756, -0.6359465056879243, 0.6584161228409678, 0.2707229461275741, 0.8891371010259713, 0, 0],
+      [2.836756572021006, 0.2213933756183301, -2.615363196402675, 0.971228333276243, 0.01955154677138728, 0.04776310693582753, 0, 0],
+      [3.006621522843135, 0.2525178497988733, -2.754103673044262, 0.9675435757896462, 0.02131833126228223, 0.05217325908402279, 0, 0],
+      [0.7426742502404002, 0.2908807599543457, -0.4517934902860545, 0.6881071914502156, 0.2523186290915626, 0.8082932839424696, 0, 0],
+      [1.355123662573589, 0.6467129415336679, -0.7084107210399213, 0.6918486853399282, 0.2450380937525276, 0.7774004372262945, 0, 0],
+      [3.02819048055718, 0.2191948899752945, -2.808995590581886, 0.9748115945748822, 0.01700610810969599, 0.04143719320263135, 0, 0],
+      [0.7938763736866599, 0.318825503469175, -0.4750508702174848, 0.6798866729024798, 0.2626009771514984, 0.852962609664904, 0, 0],
+      [0.9187644488124748, 0.2907713162751833, -0.6279931325372914, 0.7213561833669669, 0.2257631426513465, 0.6984179841230589, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [1.467231573835161, 0.6858292910850916, -0.7814022827500693, 0.6908515925963898, 0.2435406652555983, 0.7711202631395361, 0, 0],
+      [0.7794730924231542, 0.3217264288192623, -0.4577466636038919, 0.6749532834511068, 0.2669748696998873, 0.8723439095773948, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [0.7461257307734088, 0.9864515468616342, 0.2403258160882253, 0.3106559107278802, 0.620429454869483, 3.915039228861599, 0, 0],
+      [2.713309603203419, 0.221164857967016, -2.492144745236403, 0.9688831185021024, 0.02128722736007812, 0.05209548151198745, 0, 0],
+      [1.782551716116966, 0.3292557941255456, -1.453295921991421, 0.8977068460471779, 0.07451914810799536, 0.1928575554934972, 0, 0],
+      [2.033449761945727, 0.2526666485324053, -1.780783113413322, 0.915170372659046, 0.06455255987088605, 0.1652838011945321, 0, 0],
+      [1.283466722327959, 0.3653480180729037, -0.9181187042550556, 0.8139840369294271, 0.147519883115256, 0.4144789844167172, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [1.595095531037791, 0.2442703151019138, -1.350825215935877, 0.8978419915939192, 0.07829164559890804, 0.2034501954739845, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [1.450565948121167, 0.3037215553133337, -1.146844392807833, 0.8586513855064742, 0.1102581603504687, 0.2968130163282013, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [0.8577468718558526, 0.3161602364843448, -0.5415866353715079, 0.6941640293597584, 0.2506102154382269, 0.800990223099052, 0, 0],
+      [0.8581251001417857, 0.3151283961951446, -0.542996703946641, 0.6948816886935064, 0.2499169420615032, 0.7980361338527638, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [1.840809997144066, 1.066992123198376, -0.7738178739456905, 0.5778129386409814, 0.3149063953433394, 1.100950469979945, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [0.8421048321324549, 0.3150519454837218, -0.5270528866487331, 0.6919746692008777, 0.2522813155442383, 0.8081334209422766, 0, 0],
+      [0.9187644488124748, 0.2907713162751833, -0.6279931325372914, 0.7213561833669669, 0.2257631426513465, 0.6984179841230589, 0, 0],
+      [0.8058157084892437, 0.2872999792537891, -0.5185157292354545, 0.7037566196103622, 0.2393333602451838, 0.7536072749428248, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [3.008543327703649, 0.2482003544936188, -2.76034297321003, 0.9685459506341333, 0.02074068919894374, 0.05072962920812815, 0, 0],
+      [4.648460181972603, 0.2111601513848831, -4.43730003058772, 0.9979290139371165, 0.0008258733797870198, 0.001979741569082922, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [2.878141651344707, 0.228271816899492, -2.649869834445215, 0.9705204272937051, 0.01989153196772931, 0.04861052421287712, 0, 0],
+      [5.997077308658938, 0.2621943447973205, -5.734882963861617, 0.9989472760371664, 0.000183140059341332, 0.0004387317945000403, 0, 0],
+      [0.8549351707814108, 0.2845536730361729, -0.5703814977452379, 0.7148108218972721, 0.2301796354310114, 0.7161660283028319, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [3.364973008961018, 0.2159344351627683, -3.14903857379825, 0.9793874284636945, 0.01383760993085766, 0.03360847932244514, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [1.764692986830437, 0.2342443319017772, -1.53044865492866, 0.9113555479507366, 0.06756440130595094, 0.173554269107531, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [0.8685836671371788, 0.2905153607616971, -0.5780683063754817, 0.7130917819405509, 0.232330898543071, 0.7248850204802761, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [3.916636306549726, 1.806116883745845, -2.110519422803882, 0.6505279248412388, 0.08546809905269551, 0.2238419081437341, 0, 0],
+      [1.908044759007945, 0.2403907925166467, -1.667653966491299, 0.9151430438287902, 0.06461877983515565, 0.1654650675149149, 0, 0],
+      [0.8549351707814108, 0.2845536730361729, -0.5703814977452379, 0.7148108218972721, 0.2301796354310114, 0.7161660283028319, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [0.8549351707814108, 0.2845536730361729, -0.5703814977452379, 0.7148108218972721, 0.2301796354310114, 0.7161660283028319, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [0.7500683724828974, 0.3017148752263036, -0.4483534972565938, 0.6820624372804222, 0.2587064437390674, 0.8358979015097968, 0, 0],
+      [1.917815619192051, 0.2567353160102571, -1.661080303181794, 0.9086016588915193, 0.06978079444626893, 0.1796746558211892, 0, 0],
+      [4.01381740849718, 1.54956804064196, -2.46424936785522, 0.700464171321448, 0.1287694085275715, 0.3540102187344728, 0, 0],
+      [1.918989932453715, 0.2557918040797863, -1.663198128373928, 0.909055520344714, 0.06942200066238981, 0.1786818986301009, 0, 0],
+      [1.729928521143199, 0.2841873143629005, -1.445741206780299, 0.8868453847938093, 0.08716142230026667, 0.2287001959600992, 0, 0],
+      [3.363844986812155, 0.2044844793025897, -3.159360507509565, 0.9901153076620239, 0.005547891310495649, 0.0133622712966472, 0, 0],
+      [2.660528392016846, 0.1969680295703011, -2.463560362446545, 0.9732049000020435, 0.01858799682719803, 0.04536463681006517, 0, 0],
+      [0.7615989773937626, 0.9945867311200003, 0.2329877537262377, 0.3133350717599659, 0.6170995224066164, 3.860161866700854, 0, 0],
+      [1.795938223156992, 0.2393268905160736, -1.556611332640919, 0.9105001912081671, 0.06828068439487379, 0.1755290411356283, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [2.84154381327077, 0.2078621794721266, -2.633681633798643, 0.9741830865069284, 0.01768067163936413, 0.04311042289427185, 0, 0],
+      [1.794919329765208, 0.2475307830313819, -1.547388546733826, 0.906762657260622, 0.07127440118034403, 0.1838156036482752, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [2.600699503791311, 0.2403198074035898, -2.360379696387722, 0.9617383304252268, 0.02606455077894426, 0.06409974246621772, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [0.9072661993050892, 0.2823144256251368, -0.6249517736799524, 0.7252370978512809, 0.2216244205662104, 0.6819689866280161, 0, 0],
+      [3.780523584867678, 0.2201921415223868, -3.560331443345292, 0.9913869567103912, 0.004577421864594494, 0.0110141165159658, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [1.791855636724728, 0.2476550765965071, -1.544200560128221, 0.9065556544902664, 0.07143916622241288, 0.184273222081389, 0, 0],
+      [0.8646868533194048, 0.2992685634705276, -0.5654182898488771, 0.7064937253088767, 0.2387018853652207, 0.7509954553907997, 0, 0],
+      [0.6729127232300738, 0.718768386558986, 0.04585566332891222, 0.4054742861246961, 0.5303757811481821, 2.705013348847035, 0, 0],
+      [1.697744056087541, 1.590820013608738, -0.1069240424788023, 0.3920856667613055, 0.4402712672747254, 1.883991575098134, 0, 0],
+      [0.7986497865124697, 0.8010755463668797, 0.00242575985441007, 0.4207455086896824, 0.5130908088833485, 2.523960049805355, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [1.629994225806394, 0.6744640979119799, -0.9555301278944136, 0.7163293363790502, 0.2215002345542783, 0.6814781226005917, 0, 0],
+      [1.230345725435448, 0.6153993421895216, -0.6149463832459268, 0.6863747243462858, 0.251408157003192, 0.8043970843202427, 0, 0],
+      [1.793210132627844, 0.2622645717828392, -1.530945560845005, 0.9001063994392862, 0.07657761843376304, 0.1986267208954103, 0, 0],
+      [1.781743711193817, 0.3293365287236039, -1.452407182470213, 0.8976273097996972, 0.07458670224060961, 0.1930464785496808, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [3.684446643277298, 1.074720730732103, -2.609725912545195, 0.8406750409524695, 0.05317175441607172, 0.1345073445403018, 0, 0],
+      [1.409320273245886, 0.3587836135861038, -1.050536659659783, 0.8294114396282019, 0.1342675244990327, 0.3714697783213121, 0, 0],
+      [0.6728393236272698, 0.7173315373876299, 0.04449221376036006, 0.4059207123206657, 0.5299364003904465, 2.70024607456232, 0, 0],
+      [0.9086170654780148, 1.233994540020373, 0.3253774745423581, 0.3188465608309436, 0.6047202383833021, 3.664258791167908, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [4.436681324379426, 0.2333181726126735, -4.203363151766752, 0.9964565508977454, 0.001206059791026225, 0.002892205541109714, 0, 0],
+      [2.931604063796998, 0.2167577469888415, -2.714846316808156, 0.9738208405422166, 0.01776657446100761, 0.04332366661158637, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.848278411277505, 0.2827031394510892, -1.565575271826416, 0.8941384863733011, 0.08119539586186711, 0.2116627598952801, 0, 0],
+      [0.9189159469735406, 0.3104615736420396, -0.608454373331501, 0.7085773158466656, 0.2382489657471109, 0.7491248183072722, 0, 0],
+      [1.72759079763505, 0.311623662451674, -1.415967135183376, 0.8747611697807033, 0.09666056830676167, 0.2562917284834451, 0, 0],
+      [1.779038274966851, 0.2746340428389433, -1.504404232127908, 0.8938912242248644, 0.08151252441900408, 0.2125628275688491, 0, 0],
+      [2.060415554532093, 0.2426742753399805, -1.817741279192112, 0.9202857086806762, 0.06054400436420723, 0.1543586292129521, 0, 0],
+      [2.029860635154503, 0.252761991112254, -1.777098644042249, 0.9149907467882393, 0.06469552805881146, 0.1656751853363777, 0, 0],
+      [2.044066872424964, 0.2430334296360374, -1.801033442788927, 0.9195155651866898, 0.0611531822075583, 0.1560129096422987, 0, 0],
+      [2.932654967555506, 0.2447034338240228, -2.687951533731483, 0.9679292098152011, 0.02130039422174927, 0.05212840560480774, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [2.041601627114819, 0.243073697913684, -1.798527929201135, 0.9194048598364485, 0.06124084706578473, 0.1562511486248682, 0, 0],
+      [2.716917718413318, 0.2230696984637036, -2.493848019949614, 0.9685058492122303, 0.02151926428787296, 0.05267582589423364, 0, 0],
+      [2.03898560790891, 0.2431663146408302, -1.795819293268079, 0.919261775269185, 0.06135410270845372, 0.1565589992870326, 0, 0],
+      [1.52524281705736, 0.2464648920057386, -1.278777925051622, 0.892775418595675, 0.0823040820402232, 0.2148121240820347, 0, 0],
+      [0.9187644488124748, 0.2907713162751833, -0.6279931325372914, 0.7213561833669669, 0.2257631426513465, 0.6984179841230589, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [2.491956772536414, 0.271507593221879, -2.220449179314536, 0.9504304070204672, 0.03342942528720622, 0.08283837185247463, 0, 0],
+      [2.926614251937662, 0.2037096426395015, -2.722904609298161, 0.9763544138710529, 0.01617577727993461, 0.0393807389775921, 0, 0],
+      [1.671033683139294, 0.2856545987278753, -1.385379084411419, 0.8825986222705468, 0.09063340684021631, 0.238718195679934, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [0.8413289269926802, 0.3170918045265821, -0.5242371224660981, 0.6905088046505177, 0.2537005513655062, 0.8142251338010831, 0, 0],
+      [1.703643212093958, 0.2576264022407949, -1.446016809853162, 0.8974235144912529, 0.07874192169124931, 0.2047203023561474, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [8.151007661267593, 0.3156093262227645, -7.835398335044829, 0.9991727895963031, 0.0001024977956449634, 0.0002455247377349749, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [0.9261500825515703, 0.2947344435346505, -0.6314156390169198, 0.7199557699893286, 0.2273466638356701, 0.7047581637976709, 0, 0],
+      [1.626369877043544, 0.2879101493532068, -1.338459727690337, 0.8787158587933237, 0.0938023983836096, 0.247928954062165, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [3.70890889978043, 0.252781177403041, -3.456127722377389, 0.9871894766562183, 0.00617804593055877, 0.01488945358725246, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [2.991358017235093, 0.2174044009545995, -2.773953616280493, 0.9746319668773081, 0.0171670257000349, 0.04183613468450814, 0, 0],
+      [4.007708398336827, 0.2076949486679058, -3.800013449668921, 0.9966011713704359, 0.001336532988189384, 0.003205507028651629, 0, 0],
+      [1.324499347685866, 0.6627685778610264, -0.6617307698248391, 0.6792777745635602, 0.2555021364815658, 0.8219914384491384, 0, 0],
+      [0.8349494012649559, 0.3349262477907671, -0.5000231534741888, 0.6780501219789515, 0.2657648746118689, 0.8669591564108303, 0, 0],
+      [0.8349494012649559, 0.3349262477907671, -0.5000231534741888, 0.6780501219789515, 0.2657648746118689, 0.8669591564108303, 0, 0],
+      [1.461440820532206, 0.6878926557218743, -0.7735481648103315, 0.6891585034197582, 0.24493881979632, 0.7769833140103137, 0, 0],
+      [2.557591494158234, 0.2084837828605622, -2.349107711297672, 0.9683994882116597, 0.0219536489558523, 0.05376299971270462, 0, 0],
+      [1.781435945799227, 0.3293378838445027, -1.452098061954724, 0.8976048412549762, 0.07460340984559208, 0.1930932075813849, 0, 0],
+      [1.62457923773034, 0.2625306833335551, -1.362048554396785, 0.8906088542439587, 0.08421535556878605, 0.2202592435648457, 0, 0],
+      [1.86566631882804, 0.2535575028352471, -1.612108815992793, 0.9075450094627835, 0.07064468054682502, 0.1820681127108239, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [1.918006722716801, 0.2567566910237272, -1.661250031693074, 0.9086005498984576, 0.06978230077681079, 0.1796788253463154, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [1.928319303334107, 0.2416100798993904, -1.686709223434717, 0.9154943219160621, 0.0643423472549827, 0.1647085485476532, 0, 0],
+      [0.6278227706254484, 0.4087723771695084, -0.21905039345594, 0.5845018875536464, 0.3517906589477605, 1.299885897931855, 0, 0],
+      [0.8421048321324549, 0.3150519454837218, -0.5270528866487331, 0.6919746692008777, 0.2522813155442383, 0.8081334209422766, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [0.7411196269116846, 0.6632281966588833, -0.07789143025280132, 0.4496138869175124, 0.486563613889351, 2.269808402948638, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [2.464929494966578, 0.2799340945019008, -2.184995400464677, 0.9590711400712393, 0.02389046163769991, 0.05862221163631379, 0, 0],
+      [1.902085569076888, 0.2858805814030558, -1.616204987673832, 0.8955985155380237, 0.07993388970197014, 0.2080885225153263, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [1.733147538137353, 0.9998358093576224, -0.7333117287797305, 0.585266878856566, 0.3151344766462267, 1.102114785486795, 0, 0],
+      [0.85854717210063, 0.3141209575464823, -0.5444262145541476, 0.6956241172981312, 0.2491998827330459, 0.7949864303682007, 0, 0],
+      [2.353548071191077, 1.068543612750244, -1.285004458440832, 0.7045477877366241, 0.1751735916873185, 0.5086772225810314, 0, 0],
+      [0.7794730924231542, 0.3217264288192623, -0.4577466636038919, 0.6749532834511068, 0.2669748696998873, 0.8723439095773948, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [0.5633775374085664, 0.412588968020095, -0.1507885693884715, 0.5594463064147368, 0.3741523105695181, 1.431910890812913, 0, 0],
+      [1.542075066639678, 0.256078626613539, -1.285996440026139, 0.8888643533911346, 0.08555037551234949, 0.2240775503957086, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [0.7040491790863075, 0.6451715642421477, -0.05887761484415976, 0.4450916534337995, 0.4912353973456519, 2.31264504189047, 0, 0],
+      [0.782922355241261, 0.3114939944144466, -0.4714283608268143, 0.6824618276351816, 0.2596358470173036, 0.8399539655750071, 0, 0],
+      [3.006467758625698, 0.2068779903151349, -2.799589768310564, 0.9768816012576751, 0.01574574660367392, 0.03831705935423143, 0, 0],
+      [2.358303696561651, 0.2466171873692551, -2.111686509192396, 0.8210197338138971, 0.142087457564682, 0.3966878876600468, 0, 0],
+      [0.8058157084892437, 0.2872999792537891, -0.5185157292354545, 0.7037566196103622, 0.2393333602451838, 0.7536072749428248, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [7.800133774028403, 0.278416914042506, -7.521716859985897, 0.9995270829552317, 8.423101071666684e-05, 0.0002017645246099237, 0, 0],
+      [3.025708744698949, 0.2195539051963912, -2.806154839502558, 0.9747020111065384, 0.01707743246379555, 0.04161400202669262, 0, 0],
+      [1.846696646078146, 0.2826722732049264, -1.564024372873219, 0.8940674472464226, 0.08125365928177922, 0.2118280753293527, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.065060696678877, 0.6400079434533584, -0.4250527532255189, 0.5268058699668322, 0.4121122727991419, 1.679025794275032, 0, 0],
+      [1.843101459793547, 0.2901108395858197, -1.552990620207727, 0.8907310268294499, 0.08385361231687052, 0.2192265334716954, 0, 0],
+      [0.8955032225314258, 0.3075077651260756, -0.5879954574053502, 0.7065167161121573, 0.2396172098458001, 0.754782707870514, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [0.9208212417490771, 0.3061537738540528, -0.6146674678950244, 0.7116452292091714, 0.2353094738960753, 0.7370380634950205, 0, 0],
+      [0.9024614595972034, 0.2921792245177261, -0.6102822350794772, 0.7177884830002524, 0.2287828460835491, 0.7105309357727365, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [2.551867850324459, 0.208551210181541, -2.343316640142918, 0.9682457863642878, 0.02206806318956242, 0.05404951526691413, 0, 0],
+      [2.932823994594438, 0.2231941970740151, -2.709629797520423, 0.9725226527190306, 0.0185665788897068, 0.04531137674995791, 0, 0],
+      [1.273124622065827, 0.2791176849985397, -0.994006937067287, 0.7709695282679619, 0.1848847991710035, 0.5432733826268024, 0, 0],
+      [3.817743195530064, 0.9634054438657396, -2.854337751664324, 0.8785177178781028, 0.04409910580516799, 0.1104976722974639, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [1.90822407407398, 0.2381559329398516, -1.670068141134128, 0.9160773958980536, 0.06387790702345914, 0.163438510950021, 0, 0],
+      [0.9193813653325348, 0.3094620027299841, -0.6099193626025506, 0.7093051019596405, 0.2375516031621566, 0.7462489344135063, 0, 0],
+      [1.501908713082351, 0.630017413460086, -0.8718912996222647, 0.720731802075239, 0.2203071567743989, 0.6767702691280683, 0, 0],
+      [1.743548025534873, 0.2635523472349623, -1.479995678299911, 0.896902074973271, 0.07915430103979224, 0.20588460249444, 0, 0],
+      [0.9061652390953931, 0.3429572112461189, -0.5632080278492743, 0.6866654583258394, 0.259239442378775, 0.8382227477747868, 0, 0],
+      [0.7450190927888064, 0.9459226199709758, 0.2009035271821694, 0.3197383383911671, 0.6118774086362755, 3.775997606035898, 0, 0],
+      [1.900773879651682, 0.2556398425947733, -1.645134037056909, 0.9082884107765962, 0.07003963907733914, 0.1803913364004237, 0, 0],
+      [0.7593992260224496, 0.6419246373496778, -0.1174745886727718, 0.4644539709576912, 0.4721553779262808, 2.142471500210432, 0, 0],
+      [1.504001223407957, 0.6850298478546623, -0.8189713755532949, 0.6961138731638632, 0.2388442813551424, 0.7515840356665617, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [1.868068391974582, 0.2396192644497559, -1.628449127524826, 0.913688585777669, 0.06576718215727059, 0.1686127180590475, 0, 0],
+      [2.986144226827936, 0.206160279305687, -2.779983947522249, 0.9767597335274215, 0.01584351903723814, 0.03855881753660691, 0, 0],
+      [0.9721967338505133, 0.296806427794735, -0.6753903060557783, 0.7256799619420946, 0.2229741594316998, 0.6873141539364003, 0, 0],
+      [2.832993559965124, 0.2078621826850826, -2.625131377280041, 0.9740212004914397, 0.01779997842045609, 0.04340659811016915, 0, 0],
+      [2.460118969847115, 0.3006336098205502, -2.159485360026565, 0.9413336485517142, 0.03899994231497014, 0.09720235002445385, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [1.344576610869024, 0.2850706287995377, -1.059505982069487, 0.8602018912699909, 0.1089083705215539, 0.2927353096021801, 0, 0],
+      [0.88402622415244, 0.3366342468784767, -0.5473919772739634, 0.6863634131119336, 0.2589895544635303, 0.837132364232551, 0, 0],
+      [2.495665948948673, 0.2714029812085338, -2.224262967740139, 0.9505800003689884, 0.03331637669723927, 0.08254858182720519, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [4.140380934392337, 0.228522606068183, -3.911858328324154, 0.9924479368498134, 0.003912363449729383, 0.009407578636469311, 0, 0],
+      [2.718784723608267, 0.1957955882198232, -2.522989135388444, 0.9745576179880365, 0.01760901094230993, 0.04293256211838522, 0, 0],
+      [0.7046252594326289, 0.6801269012738056, -0.02449835815882329, 0.43073433271502, 0.5052171701120004, 2.445680357951797, 0, 0],
+      [2.506065019141274, 0.216065725180011, -2.289999293961263, 0.9652821880874709, 0.02412944880285897, 0.05922313629086279, 0, 0],
+      [2.965494055704177, 0.2623820429062181, -2.703112012797959, 0.9813496460330142, 0.006803750046375924, 0.01640776748811891, 0, 0],
+      [1.607235189118538, 0.2731181744499033, -1.334117014668635, 0.8844742846060156, 0.08917795140355884, 0.2345093539414571, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [2.603246035778334, 0.1981683744644224, -2.405077661313911, 0.9717733251744499, 0.01963009708347998, 0.0479588423427383, 0, 0],
+      [0.8813846244740635, 0.3443385935131678, -0.5370460309608958, 0.6813768312813469, 0.2637826134498947, 0.8581758939743659, 0, 0],
+      [0.9674194389241432, 0.3067213577331393, -0.6606980811910039, 0.7186330593502954, 0.2296881082870895, 0.7141807210822442, 0, 0],
+      [1.660985403709068, 0.6461012544962521, -1.014884149212816, 0.7319667795447448, 0.2095740903564734, 0.6350568955245651, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [0.5696338257631686, 0.9388598152971394, 0.3692259895339708, 0.3139795860845665, 0.6256092917714091, 4.002343347806542, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [0.787391838996906, 0.3390531577276394, -0.4483386812692666, 0.6656503441313927, 0.276490710366588, 0.9153193563187444, 0, 0],
+      [0.9069843602336246, 0.3405577178144697, -0.5664266424191549, 0.6881777645481555, 0.2577911157882818, 0.8319131929320386, 0, 0],
+      [0.7996107704455671, 0.302955166084563, -0.4966556043610041, 0.6916812678477128, 0.2511006961520881, 0.803083501313469, 0, 0],
+      [1.070973975556618, 0.6390617682650038, -0.4319122072916145, 0.5279346464234154, 0.4110627304432997, 1.671765190262457, 0, 0],
+      [0.8440821263743008, 0.3561489856894676, -0.4879331406848332, 0.6673901517122818, 0.2764778757108541, 0.9152606311179442, 0, 0],
+      [4.507605919243817, 0.2329821844371539, -4.274623734806663, 0.9935509212277598, 0.003311889812428658, 0.007958895742396234, 0, 0],
+      [1.902384330807077, 0.2858829368184636, -1.616501393988613, 0.8956129536042093, 0.0799212185310739, 0.208052670884748, 0, 0],
+      [1.284144303586946, 0.3653094211567701, -0.9188348824301759, 0.8140743597902077, 0.1474430451765298, 0.4142257607694202, 0, 0],
+      [1.466059544480496, 0.729087727571527, -0.7369718169089688, 0.6729433009828302, 0.2568854753586408, 0.8279803181656188, 0, 0],
+      [0.9208212417490771, 0.3061537738540528, -0.6146674678950244, 0.7116452292091714, 0.2353094738960753, 0.7370380634950205, 0, 0],
+      [1.536892833248504, 1.763035364406954, 0.2261425311584497, 0.3340469226065382, 0.4945828990098176, 2.34382605310999, 0, 0],
+      [0.7213786437339283, 1.600243195643433, 0.8788645519095043, 0.1730604227683512, 0.7549104251179646, 7.377458892895807, 0, 0],
+      [1.285595827909368, 0.3651907585782845, -0.9204050693310837, 0.8142769806371583, 0.1472683416167431, 0.4136501854279201, 0, 0],
+      [2.651088476339612, 0.2710789755714622, -2.38000950076815, 0.9670392498832862, 0.0182103187943204, 0.04442580432006697, 0, 0],
+      [0.7426742502404002, 0.2908807599543457, -0.4517934902860545, 0.6881071914502156, 0.2523186290915626, 0.8082932839424696, 0, 0],
+      [0.7422267005359383, 0.735115991431424, -0.007110709104514279, 0.4235556389141013, 0.5116043054692068, 2.508987963372446, 0, 0],
+      [0.7899278846796552, 0.3361546719324189, -0.4537732127472363, 0.6680146021263834, 0.2742338857190695, 0.9050251413976522, 0, 0],
+      [2.42164058636424, 0.5896211959395046, -1.832019390424735, 0.6041397823830699, 0.3417559102571809, 1.243555805881935, 0, 0],
+      [2.415326029658809, 0.378299994265217, -2.037026035393592, 0.749700666080814, 0.2070488804997073, 0.625406922363391, 0, 0],
+      [0.7996107704455671, 0.302955166084563, -0.4966556043610041, 0.6916812678477128, 0.2511006961520881, 0.803083501313469, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [0.948336987809952, 0.3543640669540117, -0.5939729208559403, 0.6875029499512698, 0.2593241204028092, 0.8385924064282853, 0, 0],
+      [4.696808470065814, 0.2390742832027399, -4.457734186863074, 0.9936773925850734, 0.003193986055502074, 0.007674650024557629, 0, 0],
+      [0.8058157084892437, 0.2872999792537891, -0.5185157292354545, 0.7037566196103622, 0.2393333602451838, 0.7536072749428248, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0],
+      [1.540611196207525, 0.2561663636736001, -1.284444832533925, 0.888732171556209, 0.08565586605339655, 0.2243797405182536, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [0.8959511333186598, 0.3065322364483938, -0.5894188968702661, 0.707238242772754, 0.2389236643381091, 0.7519122532889121, 0, 0],
+      [0.7376056754838773, 0.7022311510232826, -0.03537452446059475, 0.4333543233253262, 0.5022565137800238, 2.416886224936114, 0, 0],
+      [0.8929030199683131, 0.3136401944507611, -0.579262825517552, 0.7021301424385117, 0.243833847254588, 0.7723479021920997, 0, 0],
+      [0.8832572277883376, 0.324055205187422, -0.5592020226009156, 0.6938860968986269, 0.2516249096259696, 0.8053237779146634, 0, 0] 
+      ]
     },
-   "Nucleotide Fit":{
-     "timer":2,
-     "order":1
-    },
-   "Grid Calculations":{
-     "timer":28,
-     "order":2
-    },
-   "MCMC on grid weight allocations":{
-     "timer":156,
-     "order":3
-    }
-  },
- "MLE":{
-   "headers":[
-    ["alpha", "Mean posterior synonymous substitution rate at a site"],
+   "headers":    [
+["alpha", "Mean posterior synonymous substitution rate at a site"],
     ["beta", "Mean posterior non-synonymous substitution rate at a site"],
     ["beta-alpha", "Mean posterior beta-alpha"],
     ["Prob[alpha>beta]", "Posterior probability of negative selection at a site"],
     ["Prob[alpha<beta]", "Posterior probability of positive selection at a site"],
-    ["BayesFactor[alpha<beta]", "Empiricial Bayes Factor for positive selection at a site"],
-    ["PSRF", "Potential scale reduction factor - an MCMC mixing measure"],
-    ["Neff", "Estimated effective sample site for Prob [alpha<beta]"]
-    ],
-   "content":{
-     "0":[
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [1.330868651262584, 0.6698950759748372, -0.6609735752877464, 0.6727232693065792, 0.2604216688174373, 0.8714710774972212, 1.01552312750036, 124.8918140212773],
-      [0.7117548260646998, 0.6698836896886068, -0.04187113637609297, 0.4373663333548886, 0.4976550288082452, 2.451807543650687, 1.010670575721036, 162.3676049186483],
-      [1.364901417852806, 0.7059449976774221, -0.6589564201753839, 0.663065765102583, 0.2674153232324857, 0.9034174976034853, 1.014065756006747, 134.1438292250315],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [0.8437686548673489, 0.3038621440195365, -0.5399065108478124, 0.7015052801269281, 0.2415000393962996, 0.7879917713483965, 1.001784988231137, 369.6902442245855],
-      [0.6408805179020273, 0.4070759323743263, -0.2338045855277009, 0.5903493842543279, 0.3448417540889444, 1.302667784641027, 1.002621590350805, 329.5890265409098],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [0.747375221662401, 0.7506326579210557, 0.003257436258654711, 0.4214520602107312, 0.5128670143554441, 2.605657134553097, 1.008380794056198, 189.4824140163673],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [1.146791153256969, 0.9292050882968201, -0.2175860649601489, 0.5556515010298497, 0.362847854199738, 1.409423304041523, 1.004609008811675, 262.286395076501],
-      [1.661806722745329, 0.6511350807557146, -1.010671641989614, 0.7244295992220325, 0.2151091001194141, 0.6782808076258131, 1.02086599883773, 99.88686762641869],
-      [2.275127276347966, 0.8967101316063741, -1.378417144741592, 0.7975819651104823, 0.1106507975429907, 0.3079230980667819, 1.021417611952663, 97.88110777894498],
-      [1.727784307866187, 0.2729525103443952, -1.454831797521792, 0.8939276251524977, 0.08102540293062209, 0.2182115488598922, 1.014703982336367, 129.9237467680591],
-      [1.845532345024739, 0.289034108065027, -1.556498236959712, 0.8930254022812326, 0.08166555024006614, 0.2200888570746531, 1.014445708235636, 131.5981580186659],
-      [1.46905222428635, 0.6300889727614578, -0.8389632515248917, 0.7111517487782333, 0.2278246311539174, 0.7302049465391781, 1.020261753737928, 102.1845037866413],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [0.8054321836138222, 0.665914298173697, -0.1395178854401252, 0.4669576984485326, 0.4684481196298084, 2.181101518943698, 1.010916372347724, 159.9203070690993],
-      [1.716371884208716, 0.2895629757921966, -1.426808908416519, 0.8855199951889517, 0.08774910372601753, 0.2380610964542449, 1.013228744792253, 140.125952349898],
-      [2.599787403768866, 0.2328866814601011, -2.366900722308765, 0.965183198827288, 0.02390355482607629, 0.06060797863418626, 1.025869058489618, 84.317611943847],
-      [0.7254615271913989, 0.6219275206301165, -0.1035340065612824, 0.4625441775108931, 0.4730002875301002, 2.221319686019841, 1.012123409134349, 148.9213077321349],
-      [0.7582928661187955, 1.037410921737955, 0.2791180556191599, 0.3057753253171794, 0.6242023712526328, 4.110847989108807, 0.9994957386091985, 555.5057620025786],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [1.610174543834446, 0.6506099557530386, -0.9595645880814075, 0.7190777760010177, 0.2198332398553266, 0.6973743292566328, 1.020444663772872, 101.4774770723108],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [1.248690570078649, 1.040489369148725, -0.2082012009299234, 0.490333250559121, 0.4108269628407503, 1.725742975331943, 0.9989380874585089, 633.3876939733356],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [0.731068775704817, 0.3244176675508255, -0.4066511081539915, 0.6637258725613833, 0.2747326605184377, 0.9375020159960894, 1.001564425468852, 381.9619623667288],
-      [0.564806099957197, 0.4146369877854267, -0.1501691121717703, 0.5595327187522922, 0.3724462711940186, 1.46883412970608, 1.00277378579811, 323.220219714781],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [1.398752516224379, 0.3266596896425376, -1.072092826581842, 0.8447394197459255, 0.1210989511988889, 0.3410047575674728, 1.007457693069664, 203.229920341033],
-      [3.330384550306216, 0.198220202360691, -3.132164347945525, 0.9914890212468939, 0.005017656612692305, 0.01248089132680519, 1.026424082240162, 82.89584090753532],
-      [4.34855081578978, 0.2385830331486189, -4.109967782641161, 0.993289379805681, 0.003578203287971071, 0.008887545360117457, 1.013634358567416, 137.1599563021884],
-      [0.9139051127103903, 0.3142478474187145, -0.5996572652916758, 0.7071646828556413, 0.2381072007503703, 0.7734614970219971, 1.002531005166252, 333.5016749599022],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [1.636311078229619, 0.277000203646784, -1.359310874582835, 0.886656708577761, 0.08685688326238888, 0.2354102835850044, 1.013074132255221, 141.2915578611352],
-      [0.8545532705256456, 0.3185574369063932, -0.5359958336192524, 0.6937654623349651, 0.2494780908946445, 0.8226764709239547, 1.002098052851177, 353.5790905851457],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [2.799988024778473, 0.211797179008831, -2.588190845769641, 0.9741711880280872, 0.01769751252159501, 0.04458892720248249, 1.030804724353583, 73.22092799037055],
-      [1.489047583366108, 0.2827713141364914, -1.206276269229617, 0.8741779596642395, 0.09689833617050196, 0.265545971017233, 1.010179602421502, 167.4931149984661],
-      [1.576208416040454, 1.150103037218979, -0.426105378821475, 0.5171082014344022, 0.3730987738161031, 1.472938932209509, 1.00214828330284, 351.1252429729947],
-      [1.48705709927087, 0.2847636257587705, -1.2022934735121, 0.8730080111884162, 0.09785598634712848, 0.2684550426678145, 1.010070445858612, 168.6779968419034],
-      [2.022714093883532, 0.2609373413010526, -1.76177675258248, 0.9133433718658122, 0.06559542378281648, 0.1737395228582566, 1.01870696647044, 108.6347891672316],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [1.234646771416405, 0.6627604065396102, -0.5718863648767947, 0.6592281327493912, 0.2731262632248376, 0.9299605477826837, 1.014268050303753, 132.7759721440429],
-      [0.7678559233220421, 0.6682649815070689, -0.09959094181497319, 0.4556699140063921, 0.4795209853671019, 2.280155330207295, 1.010715466007633, 161.9149407965095],
-      [1.864261753295295, 0.2487574053057675, -1.615504347989527, 0.9119661608583532, 0.06666766243254944, 0.1767823706353149, 1.01899313881809, 107.3848069936764],
-      [1.735060885435944, 1.442393200332108, -0.2926676851038366, 0.4760642704293227, 0.396581697916482, 1.626575506750737, 1.006575653204647, 218.4122426955813],
-      [1.579206772620022, 1.121741502434355, -0.4574652701856665, 0.5248733922751141, 0.3673327208439127, 1.436958682443888, 1.001973392101725, 359.8214523869966],
-      [2.031296663492567, 0.2517586171363031, -1.779538046356264, 0.9175811704276262, 0.06226910614303234, 0.1643442244825297, 1.02003551053371, 103.0733194258337],
-      [2.545547606025438, 0.2342407695111815, -2.311306836514257, 0.963480678639183, 0.02514163269096192, 0.06382811114293675, 1.025700635238408, 84.75921658842476],
-      [1.728532392870302, 0.2710492273305821, -1.45748316553972, 0.894864883312364, 0.08027457973179022, 0.2160130004877936, 1.014877438721895, 128.8236266839655],
-      [1.666253134882989, 0.6587471235345317, -1.007506011348457, 0.7216870830201858, 0.2171056389597238, 0.6863220905663464, 1.020385392689962, 101.7054700565073],
-      [0.8437686548673489, 0.3038621440195365, -0.5399065108478124, 0.7015052801269281, 0.2415000393962996, 0.7879917713483965, 1.001784988231137, 369.6902442245855],
-      [2.714414646718411, 0.2316840570636525, -2.482730589654758, 0.968045079382016, 0.02181279056304786, 0.05518858875084329, 1.025768777842703, 84.57996492368565],
-      [1.601047273625993, 0.2704462410455785, -1.330601032580415, 0.8877281886550547, 0.0859615698244004, 0.2327554834169463, 1.012887523508062, 142.7251987638037],
-      [2.258656520881252, 0.9024763792854682, -1.356180141595784, 0.7944942746781457, 0.1129005357805631, 0.3149805412738741, 1.021299071909176, 98.3050440035498],
-      [1.741694191338295, 0.2723882369393481, -1.469305954398947, 0.8949664538993078, 0.08019426954996199, 0.2157780500020973, 1.014935074367698, 128.4623168080227],
-      [0.7639024563024699, 0.3740784304625536, -0.3898240258399163, 0.6413181162421357, 0.2983788177879768, 1.052507831016882, 1.002420227588988, 338.4161220257555],
-      [0.7384128616769685, 4.353870625798552, 3.615457764121584, 0.01251358582918556, 0.9314626447575398, 33.63551952593989, 1.009828018605351, 171.3718626698946],
-      [1.609909789242531, 0.2955877315834022, -1.314322057659129, 0.8759740996191538, 0.09547988341540148, 0.26124842988823, 1.011529869354864, 154.1292811390007],
-      [0.7220371412127122, 0.7731395219740113, 0.05110238076129903, 0.4071255917167266, 0.5272447074249986, 2.760170235783571, 1.007993282291088, 195.0158593242769],
-      [0.7367458101123854, 3.920420752796247, 3.183674942683862, 0.02469551719022282, 0.9154688122513377, 26.80319841186859, 1.010010064114716, 169.3408310466002],
-      [0.7136955779011382, 0.6096842585413942, -0.1040113193597441, 0.464591565122131, 0.4709905181037303, 2.203478141843597, 1.012486768952336, 145.9073859931525],
-      [0.7627156139654115, 1.482603969298073, 0.7198883553326619, 0.1992242678619112, 0.7263427168048413, 6.56892969894005, 0.9973313817264072, 1064.983281197844],
-      [3.12685011917063, 0.2435196200425888, -2.883330499128042, 0.944508254322499, 0.04136529289635905, 0.1067930510428722, 1.02187306933283, 96.28703124301352],
-      [1.847884591630838, 0.2680777748608353, -1.579806816770003, 0.9024732220144125, 0.07420666688180004, 0.1983759022247646, 1.016548640172158, 119.1311998484602],
-      [0.7162392113455963, 4.432296029375165, 3.716056818029568, 0.01102616831313428, 0.9372992036526233, 36.99689102101689, 1.009537709256199, 174.7159164791054],
-      [0.7682687289762392, 0.6166623369271529, -0.1516063920490863, 0.4783519494847079, 0.4576268724420132, 2.088206263341982, 1.012477532947451, 145.9824436700914],
-      [0.8378709714781074, 0.3194529237979746, -0.5184180476801328, 0.6900328748850731, 0.2526202532655927, 0.836540324505715, 1.001993293243286, 358.8100050706929],
-      [2.996998872067214, 0.2310326086889255, -2.765966263378288, 0.9733224407204274, 0.01800487195069578, 0.04537751854136669, 1.024689362712507, 87.51610431578531],
-      [2.472624904784596, 1.500640589405435, -0.971984315379161, 0.5998757565120511, 0.2355220767176777, 0.7624769385044851, 1.017646314091325, 113.5430612618739],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [1.464209212237155, 1.180146058253727, -0.2840631539834286, 0.4924969929574926, 0.3969744222575017, 1.629246628273571, 1.001410702451538, 391.0132208350053],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [2.780882181569706, 0.2117607624941455, -2.569121419075561, 0.9738501722268774, 0.01793009923716021, 0.045185628937245, 1.030907914348205, 73.0214824913912],
-      [3.682661506056562, 1.021960779133022, -2.660700726923539, 0.8009224898166168, 0.1093331355382678, 0.303806139970764, 1.011900866738218, 150.8311552327723],
-      [4.335667378684154, 0.2374557231341473, -4.098211655550007, 0.9933209179682609, 0.003570388001828459, 0.008868064188244502, 1.013807735049472, 135.9311699430306],
-      [1.850240148619735, 0.267998817323069, -1.582241331296666, 0.9026244594958716, 0.07408629704100828, 0.198028371533122, 1.016579840229684, 118.9645177114621],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [1.920102903591671, 0.3235149013231854, -1.596588002268486, 0.9098846565184038, 0.06445764644070756, 0.1705183138149675, 1.011541612852306, 154.0226169595155],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [2.723619291224575, 0.2190288183039217, -2.504590472920654, 0.9711991949093111, 0.01974625922797105, 0.04985472956820568, 1.029035886497996, 76.8277641252977],
-      [0.6283723130404157, 0.4108805621366812, -0.2174917509037345, 0.5844466770929027, 0.3502757458708007, 1.33426172002277, 1.00266779096141, 327.6290230850982],
-      [1.274922858553647, 0.3688121780664225, -0.9061106804872249, 0.8125899392363098, 0.1480548353888764, 0.4301015349181124, 1.005360142238172, 243.5655346330683],
-      [0.8642106624037235, 0.2944364985785053, -0.5697741638252182, 0.7116338562842216, 0.2322009112194613, 0.7484733927102407, 1.001793245221228, 369.2462859577397],
-      [2.936066370792155, 0.2154293032534312, -2.720637067538723, 0.9756109707034988, 0.01661210866350218, 0.04180805327886308, 1.029043123856431, 76.81224283702576],
-      [0.8378709714781074, 0.3194529237979746, -0.5184180476801328, 0.6900328748850731, 0.2526202532655927, 0.836540324505715, 1.001993293243286, 358.8100050706929],
-      [2.747314258907458, 1.268732483232985, -1.478581775674472, 0.6771267786261704, 0.1831342066293048, 0.5548541008449196, 1.01584195438118, 123.040171785261],
-      [0.9156865095807959, 0.3099930453096433, -0.6056934642711526, 0.7102035250013152, 0.2351908633382191, 0.7610749324307075, 1.002485415633677, 335.5065881985654],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [0.6701293208507468, 1.338096461698521, 0.6679671408477741, 0.194430362920736, 0.738748447779335, 6.998383555820617, 0.99785591324812, 870.9260304517827],
-      [1.605220991750736, 0.7223563142873984, -0.8828646774633374, 0.6894620497577028, 0.2421820072999593, 0.7909280921338736, 1.016067239709452, 121.7655638457308],
-      [1.820978780085182, 0.783520562567783, -1.037458217517399, 0.6912755763927005, 0.2368001490188235, 0.7678983483052884, 1.015107934570892, 127.3910952530708],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [0.6687544220430163, 0.6777588576173261, 0.009004435574309855, 0.4189933689535986, 0.5160179488219483, 2.638733868165263, 1.01070133229666, 162.0571831661988],
-      [3.823550312283484, 1.041598184210494, -2.78195212807299, 0.801851735324551, 0.1070254006444712, 0.2966250303772789, 1.012700633487718, 144.1912781663496],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [1.858034160493613, 0.2484765811070608, -1.609557579386552, 0.9118083968245113, 0.06678804683064517, 0.1771244395726993, 1.018943275101948, 107.6004596910005],
-      [0.8315352531217016, 0.3380690963747991, -0.4934661567469025, 0.6770139950760986, 0.2652481983594149, 0.8934532276344349, 1.002244072343871, 346.5399389706319],
-      [1.890308567770103, 0.292449047930735, -1.597859519839369, 0.8938619191007178, 0.08094573214245933, 0.2179780877800734, 1.014418621799243, 131.7763406128415],
-      [0.8375068334189539, 0.3205251509418617, -0.5169816824770922, 0.6892827980623748, 0.2533478012570146, 0.8397670499373485, 1.00200771737243, 358.0805035752871],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [3.414008434733881, 0.2227013249558119, -3.191307109778069, 0.9894551791008457, 0.005908765932091905, 0.01471060658846941, 1.02016116903521, 102.5776865498482],
-      [2.927763078889942, 0.207075747412297, -2.720687331477645, 0.9771908150799288, 0.01558327084952765, 0.03917776642085485, 1.03160815577411, 71.69775899734555],
-      [0.7936769450572915, 1.036446566251155, 0.242769621193864, 0.3154257954174651, 0.6134507078947478, 3.9276685271033, 0.9991367995917748, 603.2347146106404],
-      [2.493626059866841, 0.6241464430475461, -1.869479616819295, 0.8654171079641317, 0.090725521620655, 0.2469417442369167, 1.031102338730139, 72.64879697155989],
-      [0.7473746000425087, 0.7506758352495575, 0.003301235207048836, 0.4214395317955772, 0.512879235093727, 2.605784594373179, 1.008379754769195, 189.4968261575133],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [0.7492549703787427, 0.6575551912896022, -0.09169977908914051, 0.4544412456890339, 0.4808141618915383, 2.291999149968591, 1.01102610021664, 158.8520099329332],
-      [1.907264596522195, 0.2608086670657807, -1.646455929456415, 0.9085190041327204, 0.06941357918315068, 0.1846068307505739, 1.017926922137799, 112.2003582712533],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [1.728406780109023, 0.271946361440076, -1.456460418668947, 0.8944335496577261, 0.0806207165722527, 0.2170261066583621, 1.014795057657665, 129.3437131084458],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [1.487796527802864, 0.2847223444583994, -1.203074183344464, 0.8730813859449927, 0.0977967217386584, 0.2682748342033368, 1.010086028996418, 168.507795301576],
-      [0.7307852752210421, 0.3253885211329999, -0.4053967540880422, 0.662990387749929, 0.2754579270887866, 0.9409178437993312, 1.001579276981165, 381.1098637905375],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [1.359949559117068, 0.6306310200247041, -0.7293185390923635, 0.6953932697693225, 0.2417826018950543, 0.7892077480486273, 1.018529832664994, 109.4237265266105],
-      [1.610146473573674, 0.295575805724263, -1.314570667849411, 0.8759957754456643, 0.09546225877774206, 0.2611951166191015, 1.011533781033275, 154.0937352147774],
-      [1.715477390064347, 0.2897331427705149, -1.425744247293832, 0.8853860795433099, 0.0878567603546512, 0.2383812980352491, 1.013205444735225, 140.30034250061],
-      [1.266159159503171, 0.6233288375588091, -0.6428303219443623, 0.6837634613651764, 0.2524831593014745, 0.8359330066256319, 1.017317945685561, 115.1571511369828],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [0.6283723130404157, 0.4108805621366812, -0.2174917509037345, 0.5844466770929027, 0.3502757458708007, 1.33426172002277, 1.00266779096141, 327.6290230850982],
-      [0.7038499501214425, 1.074288126772684, 0.3704381766512416, 0.2825687248808252, 0.6494778602319168, 4.585734808291115, 0.9998098616599487, 519.5658801717312],
-      [0.7960903632099977, 0.3064198752854755, -0.4896704879245222, 0.690383633266426, 0.2507810120802267, 0.8284111092745902, 1.001528173472527, 384.0581547005908],
-      [2.804411240939125, 0.2680423306686855, -2.536368910270439, 0.9611271079938829, 0.02587871848045462, 0.06574909414640087, 1.018271871808257, 110.5941319715738],
-      [2.567344730406415, 0.2528409588533208, -2.314503771553095, 0.9591719746159073, 0.02785185699399782, 0.07090579728062343, 1.021646096753239, 97.07461345310836],
-      [1.64394880222889, 0.2474158943578399, -1.39653290787105, 0.9016897106208802, 0.07468226730538176, 0.1997499357767739, 1.015372110215367, 125.7890903745634],
-      [2.703099657975977, 0.2317365898198257, -2.471363068156152, 0.9677690748702972, 0.0220162473304901, 0.05571494351648003, 1.025797054566579, 84.50581478194019],
-      [1.769686219181997, 0.3334206885905361, -1.436265530591461, 0.8969452288515714, 0.07497282340944786, 0.2005900622412083, 1.009905308443527, 170.5035056748762],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [0.9027386312484692, 0.3437531283845285, -0.5589855028639408, 0.6871058824340311, 0.2573635938383049, 0.8576911239257928, 1.002843519720821, 320.3845531958507],
-      [0.7203584342360817, 2.780967451558978, 2.060609017322896, 0.06828458396282047, 0.8653634206704666, 15.90726453193655, 1.006655729079581, 216.9391815722332],
-      [1.667362797041979, 0.6595757455025196, -1.007787051539459, 0.7214686868206905, 0.2172580836252957, 0.6869377641425238, 1.020344698517885, 101.8626220331466],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [0.7414361431873137, 2.13509308602599, 1.393656942838676, 0.1025383312212427, 0.8235938738305748, 11.55472153121103, 1.003880732926826, 283.4571077742588],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [1.906211729257289, 0.2638275222323379, -1.642384207024951, 0.9071343505253283, 0.07050722394660786, 0.1877360326631682, 1.017560674458124, 113.9594944466066],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [1.479325511679007, 1.040602416568799, -0.4387230951102086, 0.532265831024169, 0.3665650996390065, 1.432218122523272, 1.000984489350515, 418.5356338184803],
-      [0.8642106624037235, 0.2944364985785053, -0.5697741638252182, 0.7116338562842216, 0.2322009112194613, 0.7484733927102407, 1.001793245221228, 369.2462859577397],
-      [3.478865097976805, 0.2257794669822062, -3.253085630994599, 0.9896369706816557, 0.005750277629949551, 0.01431374823213959, 1.019219064691763, 106.4188355127118],
-      [2.699653627926303, 0.643497417662651, -2.056156210263652, 0.8699363132903544, 0.08569133454478364, 0.2319551982018839, 1.029161831766631, 76.55859953209715],
-      [1.767814982718923, 0.314441858204743, -1.45337312451418, 0.8774824826542279, 0.0940264962327293, 0.2568590048321259, 1.011840472883838, 151.3581542335933],
-      [1.637676135386198, 0.6546233729586473, -0.9830527624275505, 0.7203629740792601, 0.2184926138813386, 0.6919324720891085, 1.020416072167384, 101.5873252335378],
-      [1.738042910291656, 0.248668516027024, -1.489374394264632, 0.9059605146635317, 0.07136752836859506, 0.1902027666053491, 1.0171143939724, 116.1817622523754],
-      [0.7334822456382865, 0.6696964924776641, -0.0637857531606224, 0.444534184326135, 0.4905311606559503, 2.382917537018452, 1.010640451668288, 162.6728252999427],
-      [1.879607148501403, 0.2395611345752112, -1.640046013926191, 0.9167875842576594, 0.06283361296024792, 0.1659339945006168, 1.020398488454815, 101.655004151158],
-      [1.522394592337984, 1.217755436901254, -0.3046391554367298, 0.4927401735575349, 0.3937783010934641, 1.607608680750581, 1.002264530081191, 345.5762958229628],
-      [0.6301415346143076, 6.571874477089578, 5.94173294247527, 0.0008439715496452276, 0.9834107556555047, 146.7129294852706, 1.003184612129334, 307.2094991983309],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [0.8810494327171735, 0.6523995328746233, -0.2286498998425502, 0.4905566131011911, 0.4456311591866989, 1.989467169109196, 1.011855130026002, 151.2299086489192],
-      [1.525898307252199, 0.2635750080531249, -1.262323299199074, 0.8866027382856295, 0.08676893495263785, 0.2351492670559268, 1.011729125376593, 152.3397445886934],
-      [5.775068104669175, 4.409950715762764, -1.365117388906411, 0.3602482299754761, 0.1949357832971252, 0.5992679933660293, 1.000546282699082, 451.2328285107557],
-      [4.462868102654793, 0.7274063702747744, -3.735461732380019, 0.9400294199786901, 0.0238912784459467, 0.06057608974126259, 1.022481593402194, 94.2396637117247],
-      [0.742080374721134, 1.733973904294707, 0.9918935295735729, 0.1677702526354386, 0.7597544628238622, 7.826687067863332, 0.9980985374792049, 803.298187198444],
-      [1.795406198961554, 5.933020625934442, 4.137614426972888, 0.02621929068213601, 0.8212338872902345, 11.36950885566044, 1.004497930557933, 265.3058436562201],
-      [0.9252102020674368, 0.2888873377081008, -0.6363228643593359, 0.7257666524345335, 0.2202590000617651, 0.6991064864165487, 1.002271929735664, 345.2290747749637],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [1.891715267189642, 0.29243809857207, -1.599277168617572, 0.8939401124153402, 0.08088215372714161, 0.2177918115743911, 1.014427928156163, 131.7150646466589],
-      [0.9252102020674368, 0.2888873377081008, -0.6363228643593359, 0.7257666524345335, 0.2202590000617651, 0.6991064864165487, 1.002271929735664, 345.2290747749637],
-      [0.913770735907075, 0.2948542348044822, -0.6189165011025928, 0.7198478985031778, 0.225704156193793, 0.721427457110446, 1.002242743960764, 346.6026991447079],
-      [1.309954176376095, 0.3669811104538624, -0.9429730659222325, 0.817099310600047, 0.1442083147737543, 0.4170443847647913, 1.005696931577688, 236.024292522491],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.6408805179020273, 0.4070759323743263, -0.2338045855277009, 0.5903493842543279, 0.3448417540889444, 1.302667784641027, 1.002621590350805, 329.5890265409098],
-      [0.6959869230101539, 1.035599471566705, 0.3396125485565509, 0.287228323037423, 0.6451969205089962, 4.500543298097986, 1.000518972585357, 453.4420916570001],
-      [1.760549844817363, 1.069378031086694, -0.6911718137306695, 0.563153417461169, 0.3331705620392045, 1.236550611189771, 1.002814286422756, 321.5671473160598],
-      [1.313113941750192, 1.974200423393304, 0.6610864816431117, 0.3445585042440665, 0.532827812644222, 2.822733942648999, 1.005479072616174, 240.847197187974],
-      [0.7827456776450943, 1.639948145571561, 0.8572024679264663, 0.1855376208569123, 0.7382412893892146, 6.980029010467486, 0.9980108766844121, 826.4799610519159],
-      [0.7475265399757427, 0.7405192687580572, -0.007007271217685518, 0.4244757374129121, 0.5099200074520227, 2.575106046562802, 1.008631981346187, 186.0635091497142],
-      [2.019720143681412, 0.2610282411190882, -1.758691902562323, 0.9131827581085833, 0.06572185632404896, 0.1740979556709481, 1.018676377569117, 108.7701863399542],
-      [4.671066256224689, 0.278012208346587, -4.393054047878103, 0.9912557369642002, 0.00415507811556568, 0.0103263661198179, 1.009881234528573, 170.7730114163066],
-      [0.8545532705256456, 0.3185574369063932, -0.5359958336192524, 0.6937654623349651, 0.2494780908946445, 0.8226764709239547, 1.002098052851177, 353.5790905851457],
-      [1.731570239654124, 0.2575704711400302, -1.473999768514094, 0.9013898871613548, 0.07503918036913537, 0.200782003655037, 1.016131529720268, 121.4068091044012],
-      [2.578884667921036, 1.901521417751211, -0.6773632501698248, 0.5667266764043289, 0.2172435865971075, 0.6868792051230065, 1.016248980992623, 120.7570038621054],
-      [1.848619459213316, 0.2616869682753533, -1.586932490937963, 0.9053900122144505, 0.07189187292628955, 0.1917084524324426, 1.017262798599901, 115.4328934691563],
-      [1.234258419898621, 0.6672710311569465, -0.5669873887416748, 0.6571063351693377, 0.2748771566961542, 0.9381820125169892, 1.014003913287307, 134.5678010510105],
-      [0.8382414921400769, 0.3184858895823133, -0.5197556025577637, 0.6907498060753554, 0.2519253815251415, 0.8334643803652261, 1.001980100570144, 359.4798607302892],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [0.8545532705256456, 0.3185574369063932, -0.5359958336192524, 0.6937654623349651, 0.2494780908946445, 0.8226764709239547, 1.002098052851177, 353.5790905851457],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [1.690009131020467, 0.9790743560013061, -0.7109347750191607, 0.5812317826109584, 0.3232176019051868, 1.181968731908725, 1.002439684793724, 337.5423606294108],
-      [0.7925565899614575, 3.293751587163411, 2.501194997201953, 0.06035638292717715, 0.8678006798263211, 16.24616288522281, 1.009408481347121, 176.2477917889749],
-      [1.892730786476189, 0.2924123647643125, -1.600318421711876, 0.8940003734525247, 0.08083367316719411, 0.2176497873711138, 1.014435466841063, 131.6654705836744],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.271612960850018, 0.3691246406771051, -0.9024883201729126, 0.8120982521650746, 0.1484758551077651, 0.4315378637118099, 1.005328319814607, 244.3034891092874],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [0.7441461855709143, 0.6964235140118916, -0.04772267155902266, 0.4379452259617399, 0.4968586928677043, 2.444009883141286, 1.00984311198279, 171.2015774667771],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [1.50850545059984, 0.2541903779900566, -1.254315072609784, 0.8904771789732951, 0.08355059178962776, 0.2256321980687831, 1.011732738617257, 152.3076869125847],
-      [0.8375068334189539, 0.3205251509418617, -0.5169816824770922, 0.6892827980623748, 0.2533478012570146, 0.8397670499373485, 1.00200771737243, 358.0805035752871],
-      [0.8906386807517885, 0.3112718557519627, -0.5793668249998258, 0.7050913587213025, 0.2394701733418628, 0.7792830257040086, 1.002277428101499, 344.9715261966949],
-      [0.8906386807517885, 0.3112718557519627, -0.5793668249998258, 0.7050913587213025, 0.2394701733418628, 0.7792830257040086, 1.002277428101499, 344.9715261966949],
-      [2.332053896177974, 0.2367426732975472, -2.095311222880427, 0.9567142424933796, 0.03020833854521137, 0.07709184386993789, 1.025305620001162, 85.81419645843198],
-      [1.519359284614239, 0.8952173787821639, -0.6241419058320746, 0.586032202603428, 0.3258447982604828, 1.196219675699878, 1.002535016589134, 333.3264220054586],
-      [1.493530385319895, 0.2825166148549371, -1.211013770464958, 0.8746218626547535, 0.09653966264818349, 0.2644580092772787, 1.010275358443884, 166.4676271941106],
-      [0.741159697654717, 1.454089274118492, 0.7129295764637746, 0.1978623947802414, 0.7294369468118643, 6.672357461631781, 0.9972577242482238, 1099.413971794294],
-      [0.7271279866356556, 0.9846466778112422, 0.2575186911755866, 0.3075751580418761, 0.6237725523761175, 4.103324123805218, 1.000803004177771, 431.4795309176896],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [0.6130957768264779, 5.881846752530935, 5.268750975704457, 0.00287383999324318, 0.9748947372417887, 96.10655141632175, 1.006956382060379, 211.5843621947304],
-      [1.591298878042951, 1.007445942569924, -0.5838529354730269, 0.5591223929861374, 0.3423405802213612, 1.288301096485379, 1.00179691230995, 369.0494607889909],
-      [1.888500041897305, 0.3254941431646804, -1.563005898732625, 0.9073033783500426, 0.06654602075914043, 0.1764368188028648, 1.011219152413088, 157.0075395902144],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [1.465053913198879, 0.6387155101974065, -0.8263384030014727, 0.7066006658958096, 0.2314469487768909, 0.7453112001812595, 1.019579173582477, 104.9158462254426],
-      [0.7686001142324604, 1.460380799545811, 0.6917806853133507, 0.2483038227637663, 0.6804903680942397, 5.271061295655111, 0.9961984792114865, 2057.740941741361],
-      [0.7146562136311874, 1.020154303502459, 0.3054980898712711, 0.2961573308729959, 0.6355160405519924, 4.315271603830602, 1.000405672074461, 462.8454431076583],
-      [0.71388375737254, 1.391299964567261, 0.6774162071947213, 0.2417631302309584, 0.6902891595255063, 5.51613244699229, 0.9969992720764596, 1240.169075077575],
-      [2.56342106522001, 0.2099176912615375, -2.353503373958473, 0.970042119164478, 0.02073427485786662, 0.05240205711120012, 1.032331343016355, 70.38278496346575],
-      [1.66821203046079, 1.471923066682951, -0.1962889637778389, 0.4139340732887646, 0.4424454492148319, 1.963958952457436, 1.009473160541246, 175.4776641211708],
-      [1.35097096667394, 1.117116392309033, -0.2338545743649065, 0.4891207793415898, 0.4058561781368372, 1.690599027700799, 0.9999554902366874, 504.4459452156173],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [1.660141355013693, 0.2758753072592144, -1.384266047754479, 0.8886298065745603, 0.08527016812854245, 0.2307088824224967, 1.013512515563467, 138.0372677942331],
-      [1.716615580700416, 0.29073343585171, -1.425882144848706, 0.8849922896998443, 0.08816971907561147, 0.2393125560916739, 1.013142449065749, 140.7740772715756],
-      [1.623329837445012, 0.2757209373592142, -1.347608900085798, 0.88648829096835, 0.08698397459955258, 0.2357875592018877, 1.012943790487571, 142.2897838381164],
-      [0.8041802374486954, 0.668058796293116, -0.1361214411555793, 0.4657680340256792, 0.469593377298272, 2.191154819129745, 1.010836512060117, 160.707118315156],
-      [0.913770735907075, 0.2948542348044822, -0.6189165011025928, 0.7198478985031778, 0.225704156193793, 0.721427457110446, 1.002242743960764, 346.6026991447079],
-      [1.873849121467819, 0.2391534389021341, -1.634695682565685, 0.9167269397467347, 0.06287669351746519, 0.1660553970784088, 1.020379382911664, 101.7286467967916],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [2.005600754999824, 0.3048130705628662, -1.700787684436958, 0.8942833446474164, 0.0803960412692149, 0.2163684187922571, 1.01373137885075, 136.4695345683766],
-      [2.742313411455258, 0.6491360912498629, -2.093177320205395, 0.8702114049070445, 0.08502350154565029, 0.2299794793733578, 1.028638335419033, 77.6906135960578],
-      [2.780319946277745, 0.2335757271334745, -2.546744219144271, 0.9689053444449656, 0.02114487524747814, 0.05346219028085474, 1.025051548325381, 86.50740724452611],
-      [0.6784616070761063, 0.713511575926475, 0.03504996885036871, 0.4100054445880845, 0.5248885371075992, 2.734208435103876, 1.009748163519957, 172.2785924173354],
-      [1.491686145398954, 0.2835147697108123, -1.208171375688142, 0.8739747142526177, 0.09706824859036567, 0.2660616668197592, 1.010202823704949, 167.2432438068394],
-      [1.671008127150179, 1.036281411462525, -0.6347267156876546, 0.5614040715173909, 0.337600548090048, 1.261372090972171, 1.002231778567236, 347.121644235821],
-      [2.542357115421884, 0.2482824911947817, -2.294074624227103, 0.959705164219832, 0.02759063511623376, 0.07022190452651665, 1.022617502471314, 93.79472245737696],
-      [5.429881265068088, 0.2441208641883399, -5.185760400879748, 0.9982994365575451, 0.00065754601901952, 0.001628440347643101, 1.00749957914869, 202.5621865099315],
-      [1.472560088806996, 1.19710960055941, -0.2754504882475863, 0.4898041868786904, 0.3985784218890496, 1.640192480076161, 1.00162129267826, 378.719897617771],
-      [1.640710046040149, 0.6183601466049665, -1.022349899435182, 0.7368326661958797, 0.2059390099918982, 0.641866631504468, 1.023191054939217, 91.9642596751586],
-      [1.631093943433543, 0.2762423927193976, -1.354851550714146, 0.8867037575951286, 0.08681408451360255, 0.2352832574578161, 1.013033474691419, 141.6013873325877],
-      [9.531036202854718, 1.256991086886166, -8.274045115968551, 0.9295303217343907, 0.01513042739808498, 0.03802178614176676, 1.024291536304827, 88.65280346623733],
-      [0.765333903125524, 1.034835322248289, 0.2695014191227652, 0.3081344813613646, 0.6216225086336902, 4.06594478930989, 0.9994452964394535, 561.7489995274832],
-      [1.530039940811492, 0.2633509474408867, -1.266688993370606, 0.8869764057138143, 0.08647127078450603, 0.2342662202751179, 1.011832880826264, 151.4246701969734],
-      [3.612604517607296, 5.370772523972851, 1.758168006365555, 0.1175966552733099, 0.5204917899202152, 2.686444513453702, 1.003889655830638, 283.1767618719285],
-      [2.229916711021344, 11.96812271534749, 9.738206004326143, 0.003908888234979252, 0.910091617874367, 25.05214811534502, 0.9989107032221679, 637.7825047947],
-      [1.393016603643891, 0.6867026615854317, -0.7063139420584594, 0.6751729374664863, 0.2572956409121323, 0.857386210889045, 1.015486108816937, 125.1105389660327],
-      [2.945858372814618, 0.2075688914822502, -2.738289481332368, 0.9773511755067584, 0.01546354692008213, 0.03887204194081084, 1.031352424912533, 72.17527681297959],
-      [1.701599041352019, 2.219161344835312, 0.5175623034832939, 0.2463705335989004, 0.5593283694433774, 3.141317212799754, 1.021208535081048, 98.63141417826455],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [1.370257200993293, 0.7046284987465498, -0.6656287022467436, 0.6644369020843249, 0.2662195180047077, 0.8979120009800083, 1.014213415792204, 133.1425578207644],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [3.245868068630679, 0.2439759881202262, -3.001892080510453, 0.9455319328446625, 0.04060820015505345, 0.1047557276549988, 1.021739725840406, 96.74810609075362],
-      [0.854177814960061, 0.3196279605194496, -0.5345498544406113, 0.6930187209634154, 0.2502006402793262, 0.8258542165870953, 1.002111951149028, 352.8966713693397],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [4.085618348549642, 0.2341568235572885, -3.851461524992353, 0.9959897316636652, 0.001534175455185821, 0.003802785811663016, 1.011599634868702, 153.4978262896],
-      [1.508833812438653, 0.6128140655512671, -0.8960197468873856, 0.7244338012831337, 0.2169367407004849, 0.6856402462890454, 1.02213301173062, 95.40122748935462],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [0.8315352531217016, 0.3380690963747991, -0.4934661567469025, 0.6770139950760986, 0.2652481983594149, 0.8934532276344349, 1.002244072343871, 346.5399389706319],
-      [0.6408805179020273, 0.4070759323743263, -0.2338045855277009, 0.5903493842543279, 0.3448417540889444, 1.302667784641027, 1.002621590350805, 329.5890265409098],
-      [1.847218352778658, 0.2772577672009177, -1.56996058557774, 0.8983391252324235, 0.07747629749259254, 0.2078506388683279, 1.015596261359025, 124.4620123512379],
-      [1.604310329980551, 0.6508029601256018, -0.9535073698549494, 0.7183618815329906, 0.2204607716383328, 0.6999280320295665, 1.020385187747843, 101.7062602361514],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [1.511712215791997, 0.2540532364919731, -1.257658979300024, 0.8907434154153391, 0.08333995064089814, 0.2250116342450616, 1.011819371713822, 151.5431753825414],
-      [1.905569156328879, 0.2638708852958097, -1.641698271033069, 0.9070890328855306, 0.07054268726864568, 0.187837625710488, 1.017550371843159, 114.0098052236838],
-      [0.6283723130404157, 0.4108805621366812, -0.2174917509037345, 0.5844466770929027, 0.3502757458708007, 1.33426172002277, 1.00266779096141, 327.6290230850982],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [0.8437686548673489, 0.3038621440195365, -0.5399065108478124, 0.7015052801269281, 0.2415000393962996, 0.7879917713483965, 1.001784988231137, 369.6902442245855],
-      [0.8378709714781074, 0.3194529237979746, -0.5184180476801328, 0.6900328748850731, 0.2526202532655927, 0.836540324505715, 1.001993293243286, 358.8100050706929],
-      [1.410805045370672, 0.2790521178986206, -1.131752927472051, 0.8706246479087281, 0.09970888318504988, 0.2741011930681875, 1.008710471854306, 185.0208429537045],
-      [0.8500775547254543, 0.2885345530086024, -0.5615430017168519, 0.7131964507574368, 0.2301740793416509, 0.7399867163081146, 1.001594000240399, 380.2689052577834],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.083485539867942, 1.483745644337528, 0.4002601044695857, 0.2546981717257784, 0.656352022207438, 4.726972481208435, 0.9989207173873362, 636.168265153167],
-      [1.29529991548943, 2.822718070145566, 1.527418154656136, 0.1910104303900099, 0.6664520129065048, 4.945048995135743, 1.013824426520515, 135.8140647714187],
-      [0.7555272573508804, 0.9225620754844078, 0.1670348181335274, 0.3306131769153006, 0.6003737737012885, 3.718157390452658, 1.001630644263659, 378.1920674096726],
-      [1.508517048242234, 0.2541987789832431, -1.254318269258991, 0.8904731762478203, 0.08355390733454648, 0.2256419681806425, 1.011732567869391, 152.3092015236778],
-      [0.7956940972706756, 1.036443757580282, 0.2407496603096067, 0.3159449930059545, 0.612873324397869, 3.918119339511457, 0.9991188333436392, 605.8416778155473],
-      [1.863703414347923, 0.2394774345837624, -1.624225979764161, 0.9161384564607493, 0.06333764111722683, 0.1673550631751042, 1.020196582264912, 102.438899307548],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [1.104724679228379, 2.325051520691677, 1.220326841463298, 0.137047270649571, 0.758840865923011, 7.787660926625004, 1.010920529748643, 159.8795629163638],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [2.678336087847395, 0.2148913949460606, -2.463444692901334, 0.9712539532528126, 0.01977223482696409, 0.04992163480343603, 1.030422720865049, 73.96937657173362],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [0.7688096794172018, 0.6360870334186972, -0.1327226459985046, 0.4694937797881616, 0.4661784379555606, 2.161305255733828, 1.01179563972464, 151.7518193955528],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [0.6780325855961704, 0.6768462507680475, -0.001186334828122915, 0.422677047975987, 0.5123109612588637, 2.599864371429787, 1.010638493925051, 162.6927020432936],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [1.401863747573949, 2.407570591512503, 1.005706843938554, 0.1753214109329192, 0.645456725179787, 4.505654821590383, 1.018352970205483, 110.2233913373961],
-      [0.7899647167025678, 0.6637292257315908, -0.1262354909709771, 0.4637016328220971, 0.4716600883965484, 2.209407113037269, 1.010930221313895, 159.7846643038265],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [0.742639848271603, 1.654429772919499, 0.9117899246478958, 0.1754975715122595, 0.7517841622557231, 7.495898935013029, 0.9977751400410799, 896.0522021868536],
-      [0.8311283207090874, 0.3393477641780577, -0.4917805565310297, 0.6761495396287692, 0.2660870812457367, 0.8973033646181834, 1.002260961728588, 345.7439895312437],
-      [2.035958983360387, 0.2517008165729541, -1.784258166787433, 0.917784479164505, 0.06210941968733399, 0.1638948610561159, 1.020072119870347, 102.9284091060426],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [1.620472337968729, 0.2925221834697467, -1.327950154498983, 0.8781457093895568, 0.09372314975753034, 0.2559446334841221, 1.011853428872825, 151.2447817927444],
-      [1.728249509522606, 0.2710608467111953, -1.457188662811411, 0.8948436423404061, 0.08029155809647635, 0.2160626765924995, 1.01487256430749, 128.8542797794858],
-      [0.8545532705256456, 0.3185574369063932, -0.5359958336192524, 0.6937654623349651, 0.2494780908946445, 0.8226764709239547, 1.002098052851177, 353.5790905851457],
-      [1.905170670811431, 0.2638625544115928, -1.641308116399839, 0.907073840589508, 0.07055522498704983, 0.1878735448158705, 1.017549339431699, 114.0148493334995],
-      [0.8642106624037235, 0.2944364985785053, -0.5697741638252182, 0.7116338562842216, 0.2322009112194613, 0.7484733927102407, 1.001793245221228, 369.2462859577397],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [2.539045302140492, 0.2333525448274445, -2.305692757313048, 0.9635617075553675, 0.02510311858181477, 0.06372781604863012, 1.025920905311304, 84.1826381553355],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [0.750116065713855, 0.628517683236364, -0.121598382477491, 0.4673452490114015, 0.4682999757660557, 2.179804245979081, 1.011980471484952, 150.1422444810013],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.775930132483501, 0.2701217479599464, -1.505808384523554, 0.8978434078526606, 0.07789788529477548, 0.2090772065700593, 1.015552333506666, 124.719806051139],
-      [3.025848459943688, 0.2570559053486796, -2.768792554595009, 0.9681448250852617, 0.02112322640473343, 0.0534062727118948, 1.019330674399576, 105.9482532939489],
-      [2.006080225434451, 0.3047982339724533, -1.701281991461998, 0.894311410724862, 0.08037333422097406, 0.2163019667498221, 1.013733808534342, 136.4523360370618],
-      [0.7678740434441601, 0.6675735994934731, -0.100300443950687, 0.4559513611919768, 0.4792493404578045, 2.2776748911725, 1.0107380737837, 161.6879457959351],
-      [0.854177814960061, 0.3196279605194496, -0.5345498544406113, 0.6930187209634154, 0.2502006402793262, 0.8258542165870953, 1.002111951149028, 352.8966713693397],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [2.379601361784658, 0.2188131138164611, -2.160788247968197, 0.9631755249228569, 0.02569956521645206, 0.06528191996183966, 1.029873339218828, 75.07451060422915],
-      [1.362193566713833, 0.7068501007972537, -0.6553434659165794, 0.6622814104459247, 0.2680958535906689, 0.9065586969953097, 1.013981790087488, 134.7201404122967],
-      [2.844256185328447, 0.2319572422015246, -2.612298943126923, 0.9705128859883427, 0.02000822424252217, 0.05052963417843329, 1.025163837561315, 86.19959678925436],
-      [3.015919636441286, 0.2611201331034195, -2.754799503337866, 0.9670552347492279, 0.02178729355623338, 0.05512264191549684, 1.018688033687453, 108.7185510640124],
-      [0.7401326238170173, 0.2943376857530516, -0.4457949380639656, 0.6867910948254169, 0.2519957086922944, 0.833775433192942, 1.001134236074647, 408.4309186452369],
-      [1.361963520943317, 0.6305755316201611, -0.7313879893231561, 0.6957267302679279, 0.2414876500656154, 0.787938475955888, 1.018567939964747, 109.2529993739562],
-      [3.038707021101613, 0.2299725014705032, -2.808734519631109, 0.9741555633362807, 0.017430824181918, 0.04390508533415103, 1.024742332296592, 87.36704914860918],
-      [0.7907722637152931, 0.3220392526705272, -0.4687330110447659, 0.6787762701622237, 0.2621124133344687, 0.8791387515670193, 1.001752997805738, 371.4205240112349],
-      [0.913770735907075, 0.2948542348044822, -0.6189165011025928, 0.7198478985031778, 0.225704156193793, 0.721427457110446, 1.002242743960764, 346.6026991447079],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [1.470880305206531, 0.6671425046761608, -0.8037378005303706, 0.6946699517333791, 0.2406592660842428, 0.784378948253018, 1.017738019735505, 113.10060790284],
-      [0.7769218462943511, 0.3249501839982318, -0.4519716622961193, 0.6738951028819534, 0.266442203362273, 0.8989358860431415, 1.001733410476876, 372.4880523976879],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [0.7393036332288561, 0.9820217283337573, 0.2427180951049013, 0.3118340576605654, 0.6191252040015277, 4.02305795069448, 1.000666384696636, 441.7693255464455],
-      [2.714659094815133, 0.2317011201989317, -2.482957974616201, 0.9680361698580098, 0.0218196496099548, 0.05520632994699459, 1.025763006794038, 84.59511510903535],
-      [1.765090792758636, 0.3339606302662628, -1.431130162492373, 0.8964430256564759, 0.07537582063327604, 0.201756179854158, 1.009837668322859, 171.2629535476061],
-      [2.02328610129762, 0.2609319797687294, -1.762354121528891, 0.9133664075501778, 0.06557690380228479, 0.1736870273622287, 1.018708532906657, 108.627864973008],
-      [1.273021301772355, 0.3689382365451331, -0.9040830652272216, 0.8123283592161812, 0.1482775594182273, 0.4308611916340893, 1.005341579387387, 243.9954514779195],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [1.578998245994376, 0.2522325854479978, -1.326765660546378, 0.8956435232634039, 0.07948044377060336, 0.213691527192086, 1.01354961981421, 137.7688847017918],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [1.437744197201998, 0.3094041020473978, -1.1283400951546, 0.8566749938264305, 0.1112456001746353, 0.3097855232553244, 1.008454960038878, 188.4596729933195],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [0.854177814960061, 0.3196279605194496, -0.5345498544406113, 0.6930187209634154, 0.2502006402793262, 0.8258542165870953, 1.002111951149028, 352.8966713693397],
-      [0.8545532705256456, 0.3185574369063932, -0.5359958336192524, 0.6937654623349651, 0.2494780908946445, 0.8226764709239547, 1.002098052851177, 353.5790905851457],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [1.820969570081533, 1.041991524106163, -0.7789780459753699, 0.5778873359901893, 0.321052229399054, 1.170305813546966, 1.002977403445043, 315.0790379176146],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [0.8382414921400769, 0.3184858895823133, -0.5197556025577637, 0.6907498060753554, 0.2519253815251415, 0.8334643803652261, 1.001980100570144, 359.4798607302892],
-      [0.913770735907075, 0.2948542348044822, -0.6189165011025928, 0.7198478985031778, 0.225704156193793, 0.721427457110446, 1.002242743960764, 346.6026991447079],
-      [0.8017827875978873, 0.2910612307310945, -0.5107215568667929, 0.7022267674392259, 0.2392275136253522, 0.7782450512235876, 1.001321364323131, 396.4753389951715],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [3.017951216249195, 0.2570239847031878, -2.760927231546007, 0.9680445457812287, 0.02119365483386138, 0.05358819388207368, 1.019364609555701, 105.8060262201622],
-      [4.679232471428533, 0.2231835005386628, -4.456048970889871, 0.9979778443302875, 0.0008427687892309509, 0.002087539235757158, 1.010201784284691, 167.2544121169464],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [2.884610890339177, 0.2384316095816208, -2.646179280757556, 0.9698164358196457, 0.02037276752515077, 0.05146941344298502, 1.023514724359485, 90.96378017129393],
-      [6.007733506236209, 0.2727344730095016, -5.734999033226708, 0.9990539304942081, 0.0001860981828916972, 0.0004606626488816843, 1.005861545990285, 232.5082818898849],
-      [0.8500775547254543, 0.2885345530086024, -0.5615430017168519, 0.7131964507574368, 0.2301740793416509, 0.7399867163081146, 1.001594000240399, 380.2689052577834],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [3.386573798617218, 0.2270497430797874, -3.15952405553743, 0.9788807047393349, 0.01415955368985554, 0.03554700141527971, 1.023862940746632, 89.91247458983985],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [1.747982188692916, 0.2429612522326796, -1.505020936460236, 0.909189543212182, 0.06877932466009581, 0.1827954310517377, 1.017903315860403, 112.3120468033435],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [0.8642106624037235, 0.2944364985785053, -0.5697741638252182, 0.7116338562842216, 0.2322009112194613, 0.7484733927102407, 1.001793245221228, 369.2462859577397],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [4.012810906524066, 1.740008669293754, -2.272802237230312, 0.6803087637664978, 0.09961767676691284, 0.2738227249279784, 1.02812033479998, 78.84596344629516],
-      [1.893431573742368, 0.249104025998263, -1.644327547744105, 0.9131039964835928, 0.06577618147979301, 0.1742519958072535, 1.01927479388386, 106.1833227146556],
-      [0.8500775547254543, 0.2885345530086024, -0.5615430017168519, 0.7131964507574368, 0.2301740793416509, 0.7399867163081146, 1.001594000240399, 380.2689052577834],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [0.8500775547254543, 0.2885345530086024, -0.5615430017168519, 0.7131964507574368, 0.2301740793416509, 0.7399867163081146, 1.001594000240399, 380.2689052577834],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [0.7476415468821919, 0.3050688229513163, -0.4425727239308756, 0.6808592897393608, 0.2582847841992972, 0.8618301293912014, 1.001309292765077, 397.2252313488673],
-      [1.904393480036484, 0.2647501636620131, -1.639643316374471, 0.9066459155163752, 0.07089369348487556, 0.1888435840379475, 1.017432090530896, 114.5907180184054],
-      [4.059813130818677, 1.504484763319965, -2.555328367498712, 0.7138846251354523, 0.1381636611549297, 0.3967610857199549, 1.021707172754684, 96.86136707511619],
-      [1.905518538776071, 0.2638704414026535, -1.641648097373417, 0.9070866731084359, 0.07054467910903742, 0.1878433320368591, 1.017550293813628, 114.0101864407546],
-      [1.715765193114003, 0.2907674285480563, -1.424997764565947, 0.8849268720917056, 0.08822256507677341, 0.2394698707960595, 1.013131090379338, 140.8598459981256],
-      [3.391508830757959, 0.216421979148991, -3.175086851608968, 0.989984204162759, 0.005691987732051195, 0.01416782080811488, 1.021578014860261, 97.31347565728423],
-      [2.660356183495671, 0.2090031323858446, -2.451353051109826, 0.9722585501250844, 0.01912299497359507, 0.04825045315940388, 1.03229858317563, 70.44124967350001],
-      [0.7546747956064246, 0.9896341939414016, 0.234959398334977, 0.3145974918866866, 0.6158314680288743, 3.967346457417642, 1.000321113958472, 470.1236637467613],
-      [1.781050983847531, 0.2478735960713729, -1.533177387776158, 0.9084474420249427, 0.06941491996355192, 0.1846106625687735, 1.017910294904977, 112.2790028505335],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [2.84915490144642, 0.2192640719452532, -2.629890829501166, 0.973424212206449, 0.01812840121497342, 0.04569459636069093, 1.028396449617761, 78.22565626807496],
-      [1.780620092798824, 0.2556931734938472, -1.524926919304977, 0.904773879819467, 0.07235980782563177, 0.193053591985182, 1.017054200514265, 116.4883778122144],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [2.598293029507792, 0.2495774151293486, -2.348715614378444, 0.9608767304519933, 0.02666837695979273, 0.06781031950655803, 1.022208017193628, 95.14877758429073],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [0.9014924157857125, 0.2865136631226748, -0.6149787526630377, 0.7235258796884531, 0.2217291347545042, 0.7051021329532657, 1.002003492678128, 358.2938572170438],
-      [3.811668627607542, 0.2312102647241832, -3.580458362883359, 0.9913816067556424, 0.004682105159044931, 0.01164231619859586, 1.01664878577733, 118.5978884213797],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [1.777530825230482, 0.2558079156468711, -1.521722909583611, 0.9045651647702911, 0.07252496189729681, 0.1935286728485248, 1.016997577176945, 116.7783387628256],
-      [0.8606419912113049, 0.302976401582314, -0.5576655896289909, 0.7051893492617515, 0.2384306071191618, 0.7748409447762756, 1.001897755067703, 363.7187450907838],
-      [0.678471836720804, 0.7141577792230314, 0.03568594250222734, 0.4097986180900882, 0.5250941136273299, 2.736463351721737, 1.009733073766193, 172.4510351826778],
-      [1.648766207892558, 1.561734037305302, -0.08703217058725632, 0.3918919517990191, 0.4592050453328475, 2.101522571075977, 1.010917937690067, 159.9049636064798],
-      [0.8026994758561283, 0.793804226770857, -0.008895249085271284, 0.4250804735282473, 0.5085593573893024, 2.561124074116115, 1.007188543480821, 207.6299972091724],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [1.634205768711575, 0.6548164661826361, -0.9793893025289384, 0.7200071971572966, 0.2188062643449885, 0.6932039655583935, 1.020403256875369, 101.6366414595231],
-      [1.240718497203804, 0.602033040085683, -0.6386854571181209, 0.6903879306308378, 0.2473047203396537, 0.8131548420299818, 1.018268749372701, 110.6084578033472],
-      [1.779441333776731, 0.2699135741187552, -1.509527759657976, 0.8981271134950435, 0.07767070531752543, 0.2084161097472951, 1.015621002536229, 124.3173002717004],
-      [1.764282835104488, 0.3340412215601419, -1.430241613544346, 0.8963625303803646, 0.07544340811606652, 0.2019518513501425, 1.009829437552272, 171.3558391989647],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [3.742558659647554, 1.031609995620649, -2.710948664026905, 0.8489086332491331, 0.0570329289723687, 0.1496887588806893, 1.015107286497166, 127.3950770129534],
-      [1.39746988983128, 0.3625091668631258, -1.034960722968154, 0.8277783697565937, 0.1351211916819625, 0.3866591125551553, 1.006568523502712, 218.5443870290024],
-      [0.6784394920768857, 0.7127260769352587, 0.03428658485837299, 0.4102517080027428, 0.5246437894238321, 2.731526403146054, 1.009766400372795, 172.070655201214],
-      [0.8931341938027326, 1.226929193037944, 0.3337949992352114, 0.3185090309527843, 0.6065279050882537, 3.815020606282528, 0.9977855766652421, 892.7240671936559],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [4.469494099645859, 0.2441070202593358, -4.225387079386523, 0.9966380926568149, 0.001227560028664588, 0.003041839027505276, 1.009633036004173, 173.6032343848797],
-      [2.939396271734547, 0.2276946313206987, -2.711701640413849, 0.9730921780251865, 0.01822726870946815, 0.04594842925627046, 1.025767830823769, 84.58245065272946],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.834989212729688, 0.2894383370148303, -1.545550875714858, 0.8922843161668783, 0.08226324335795676, 0.2218440274966692, 1.014332885845862, 132.3436266103738],
-      [0.9139051127103903, 0.3142478474187145, -0.5996572652916758, 0.7071646828556413, 0.2381072007503703, 0.7734614970219971, 1.002531005166252, 333.5016749599022],
-      [1.715024659066031, 0.3171333269638615, -1.39789133210217, 0.8730104966215428, 0.0976869917995358, 0.2679412361113644, 1.011289628398322, 156.3450793652712],
-      [1.764742027537499, 0.2817367767573729, -1.483005250780127, 0.8919149158692393, 0.08262108186532277, 0.2228959414861747, 1.014387497033016, 131.9817029527854],
-      [2.050235694852525, 0.2514028638220026, -1.798832831030523, 0.9184631235103193, 0.06157623723284685, 0.1623955742537747, 1.02020362602822, 102.4113407295591],
-      [2.01963245169808, 0.2610208061297475, -1.758611645568332, 0.9131841665789479, 0.06572103150186677, 0.1740956170081388, 1.018678759339878, 108.7596312359858],
-      [2.033590767601274, 0.2517327146861076, -1.781858052915167, 0.9176810039491073, 0.06219072793991796, 0.1641236462790715, 1.020053771460824, 103.0009844881515],
-      [2.940100181966283, 0.2537295563135036, -2.68637062565278, 0.9673579610783642, 0.02177611220105564, 0.055093722938989, 1.020234273453945, 102.2916123497916],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [2.03108657552718, 0.2517690633248664, -1.779317512202314, 0.9175687393542246, 0.06227898473106254, 0.1643720282110906, 1.020033227438396, 103.0823706114945],
-      [2.719759032294967, 0.2335107491862068, -2.486248283108761, 0.967691305885789, 0.02203467253963299, 0.05576262144383996, 1.025307646300109, 85.80871459843078],
-      [2.028421455034558, 0.2518553712689094, -1.776566083765649, 0.9174235817894703, 0.06239321232782832, 0.1646935694545862, 1.020002010987899, 103.2062919961641],
-      [1.509350435191226, 0.2541755494920105, -1.255174885699216, 0.8905366460804409, 0.08350385893647684, 0.2254944951328877, 1.011754864381695, 152.11168233891],
-      [0.913770735907075, 0.2948542348044822, -0.6189165011025928, 0.7198478985031778, 0.225704156193793, 0.721427457110446, 1.002242743960764, 346.6026991447079],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [2.487314358465191, 0.2787058451412255, -2.208608513323965, 0.9496824517535731, 0.03412107498137948, 0.08742991457004654, 1.017434656017688, 114.5780532307779],
-      [2.934478535687643, 0.215425131410716, -2.719053404276928, 0.9755896325712901, 0.01662738523498272, 0.04184715023700355, 1.029052753767091, 76.79160069369321],
-      [1.656488735402689, 0.2921869177433767, -1.364301817659312, 0.8806118049208574, 0.0917206243520752, 0.2499237845013524, 1.012340265349199, 147.1073865524904],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [0.8375068334189539, 0.3205251509418617, -0.5169816824770922, 0.6892827980623748, 0.2533478012570146, 0.8397670499373485, 1.00200771737243, 358.0805035752871],
-      [1.688720633570221, 0.2653448899456691, -1.423375743624552, 0.8953484388586379, 0.07987045315315824, 0.2148311289167694, 1.014765590281752, 129.5307980796283],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [8.134274805885381, 0.3236848898586997, -7.810589916026681, 0.999268786738394, 0.0001046780973969218, 0.0002590963666865543, 1.008319937512439, 190.330118572013],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [0.9206027889504963, 0.2988138267809606, -0.6217889621695356, 0.7183615617347812, 0.2273629844284903, 0.7282899043609945, 1.002369001746807, 340.7385402048528],
-      [1.611739623079011, 0.29431667937043, -1.317422943708581, 0.8767068309514139, 0.0948878148131662, 0.25945860135172, 1.01162826073034, 153.2402627139267],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [3.740408356297505, 0.2614944205792935, -3.478913935718212, 0.9874666675132306, 0.006302050180701209, 0.01569594622659093, 1.013170584069406, 140.5620930969249],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [3.000783135876334, 0.2283164596125082, -2.772466676263826, 0.9739412300744752, 0.01760817539912955, 0.04435980772228281, 1.02532282943649, 85.76766211710449],
-      [4.046159953919998, 0.2197941303886325, -3.826365823531366, 0.996698584324353, 0.001362922631622436, 0.003377719302119125, 1.013118698170337, 140.9535413735539],
-      [1.330677776874429, 0.6467093397532399, -0.6839684371211895, 0.6831838163610117, 0.2520283941838427, 0.8339200190649145, 1.016952414954008, 117.0106806268766],
-      [0.8315352531217016, 0.3380690963747991, -0.4934661567469025, 0.6770139950760986, 0.2652481983594149, 0.8934532276344349, 1.002244072343871, 346.5399389706319],
-      [0.8315352531217016, 0.3380690963747991, -0.4934661567469025, 0.6770139950760986, 0.2652481983594149, 0.8934532276344349, 1.002244072343871, 346.5399389706319],
-      [1.464950434323551, 0.6692063920018679, -0.7957440423216829, 0.692980259398094, 0.2420711584667045, 0.790450455290782, 1.017532676204988, 114.0963256906952],
-      [2.552746618639876, 0.2197637476151922, -2.332982871024683, 0.9673709181784778, 0.02254934021421641, 0.05709512577400028, 1.02942457062379, 76.00342524995638],
-      [1.763975838445919, 0.3340416460876607, -1.429934192358258, 0.8963398662314417, 0.07545998907983094, 0.2019998590169023, 1.009824574095602, 171.4107725781169],
-      [1.609494614479217, 0.2699398812618315, -1.339554733217385, 0.8884940346552783, 0.08534833518686101, 0.2309401076605741, 1.013074248458301, 141.2906743362518],
-      [1.851172647644643, 0.2616824983574773, -1.589490149287166, 0.9055139845135185, 0.07179442717831423, 0.1914285026171123, 1.017292918748209, 115.2821199568123],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [1.904588503905696, 0.2647711630060389, -1.639817340899657, 0.9066450265459751, 0.07089515201464407, 0.1888477656640911, 1.017433779031084, 114.5823822390266],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [1.914170600651981, 0.2502972731597808, -1.6638733274922, 0.9134799882528462, 0.06548715832293697, 0.1734326703104307, 1.019339675379801, 105.9104902720676],
-      [0.6283723130404157, 0.4108805621366812, -0.2174917509037345, 0.5844466770929027, 0.3502757458708007, 1.33426172002277, 1.00266779096141, 327.6290230850982],
-      [0.8382414921400769, 0.3184858895823133, -0.5197556025577637, 0.6907498060753554, 0.2519253815251415, 0.8334643803652261, 1.001980100570144, 359.4798607302892],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [0.7492523886195629, 0.6576482810600396, -0.09160410755952331, 0.4544022896891072, 0.4808519466127041, 2.292346096214887, 1.011023150552758, 158.8805362645371],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [2.453499749534203, 0.2854573566883238, -2.168042392845879, 0.9589026499222643, 0.02450511964748176, 0.06217157533308705, 1.014160272400915, 133.5011430645463],
-      [1.889739353426534, 0.2924857043045225, -1.597253649122012, 0.8938187312628789, 0.08098070264167127, 0.2180805576262257, 1.014413479273869, 131.8102257961738],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [1.71352849088518, 0.9771477053842847, -0.736380785500895, 0.5847392449195513, 0.3200459536993177, 1.164911190604766, 1.002552621520318, 332.5594870922525],
-      [0.8549361465828247, 0.3175902642751303, -0.5373458823076944, 0.6944796931021142, 0.2487874201581454, 0.8196446407715443, 1.002085383609697, 354.2034904382638],
-      [2.336475131161129, 1.030735736097275, -1.305739395063853, 0.7063027053982162, 0.1832431616740689, 0.555258270676141, 1.009085942066246, 180.1937135205514],
-      [0.7769218462943511, 0.3249501839982318, -0.4519716622961193, 0.6738951028819534, 0.266442203362273, 0.8989358860431415, 1.001733410476876, 372.4880523976879],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [0.564806099957197, 0.4146369877854267, -0.1501691121717703, 0.5595327187522922, 0.3724462711940186, 1.46883412970608, 1.00277378579811, 323.220219714781],
-      [1.526710078704711, 0.2635293776951256, -1.263180701009585, 0.8866772678781609, 0.08670972951174682, 0.2349735830800894, 1.011750141655602, 152.1534759146264],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [0.7125756983357391, 0.6401303654591134, -0.07244533287662569, 0.44997777248522, 0.4852964932605593, 2.333512141800834, 1.011540522419524, 154.0325147995647],
-      [0.7801377751991305, 0.3148531020958606, -0.4652846731032699, 0.6812988595436617, 0.2591968735239502, 0.8659383846203885, 1.001584933802911, 380.7863151860167],
-      [3.016712611794625, 0.2184270905007664, -2.798285521293858, 0.9761709333335634, 0.01617263043658954, 0.04068382722451139, 1.027787131935477, 79.60843169506757],
-      [2.334928054729291, 0.2529817697151248, -2.081946285014166, 0.8188189448731039, 0.1429155155424426, 0.4126822464878207, 1.009264597631995, 177.9860265817098],
-      [0.8017827875978873, 0.2910612307310945, -0.5107215568667929, 0.7022267674392259, 0.2392275136253522, 0.7782450512235876, 1.001321364323131, 396.4753389951715],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [7.792300472335936, 0.2878921619229802, -7.504408310412956, 0.9995703281756907, 8.600802741219532e-05, 0.0002128807446451239, 1.006148192280498, 226.6333409000423],
-      [3.036127809666008, 0.2303084964859248, -2.805819313180084, 0.9740455107461452, 0.01750349347529791, 0.04409138703749779, 1.024675658758851, 87.55475354197443],
-      [1.833385630465268, 0.2894079217127561, -1.543977708752512, 0.8922116320803809, 0.08232190332399049, 0.2220164100677903, 1.014321924437296, 132.4165173347197],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.07651263206365, 0.6312887326486438, -0.445223899415006, 0.5322605998401823, 0.4061392271744343, 1.692584416177677, 1.014090805631111, 133.9728790499927],
-      [1.829969475321141, 0.2965860830115797, -1.533383392309561, 0.8888797669808787, 0.08494337823593963, 0.2297426361230873, 1.013665678154553, 136.9362938796037],
-      [0.8906386807517885, 0.3112718557519627, -0.5793668249998258, 0.7050913587213025, 0.2394701733418628, 0.7792830257040086, 1.002277428101499, 344.9715261966949],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [0.9156865095807959, 0.3099930453096433, -0.6056934642711526, 0.7102035250013152, 0.2351908633382191, 0.7610749324307075, 1.002485415633677, 335.5065881985654],
-      [0.8970686266384508, 0.2962209913993141, -0.6008476352391366, 0.7161823508436315, 0.2287950897563492, 0.7342381610667212, 1.002105913598215, 353.1927933056136],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [2.54683347842543, 0.2198250328877518, -2.327008445537678, 0.967212460807873, 0.02266598857719968, 0.05739733020703332, 1.02942113986122, 76.01061993638093],
-      [2.940549556792525, 0.2336946734881631, -2.706854883304362, 0.9718248732265972, 0.01902767980815442, 0.04800529252389728, 1.024328145102968, 88.54691405675462],
-      [1.265357149497031, 0.2842865437782062, -0.9810706057188253, 0.7690854950306439, 0.1853149385524942, 0.5629641195726505, 1.006033987260548, 228.9374825707941],
-      [3.87217777307695, 0.9272071988017576, -2.944970574275192, 0.8832672642526476, 0.04672575763566923, 0.1213105390415442, 1.011747702303144, 152.1750720919439],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [1.894907727153429, 0.2469128471108598, -1.64799488004257, 0.9141136978177385, 0.06497476661893217, 0.1719813825798932, 1.01956132055181, 104.9893216144414],
-      [0.9143263755260678, 0.3132893075830935, -0.6010370679429743, 0.7078649599298348, 0.2374352462676864, 0.770599103782582, 1.002520867280375, 333.9454156334616],
-      [1.511391875054376, 0.6129903057067593, -0.8984015693476172, 0.7246590567127789, 0.2167333743527181, 0.6848196441238223, 1.022152038272382, 95.33705684840299],
-      [1.728532135807204, 0.2710492376146671, -1.457482898192537, 0.894864864376412, 0.08027459485841856, 0.2160130447451841, 1.014877434418238, 128.82365374119],
-      [0.9019329377820589, 0.3461953402214831, -0.5557375975605758, 0.6855612839555099, 0.258847144180966, 0.864361929839065, 1.002867784438382, 319.409620335311],
-      [0.7391568230734554, 0.9415714782384356, 0.2024146551649801, 0.3210605998412318, 0.6101804993260873, 3.87395705592724, 1.001443306515297, 389.057466861088],
-      [1.88697930215683, 0.2636882247877085, -1.623291077369121, 0.9063101049944153, 0.07116254615639214, 0.1896146104725104, 1.017406751842688, 114.7159607498255],
-      [0.7688068083213828, 0.6361687183095418, -0.132638090011841, 0.4694559305089389, 0.4662149761096786, 2.161622609857363, 1.011792741272698, 151.7773420355772],
-      [1.508941951772613, 0.6659968244061185, -0.8429451273664947, 0.7000820666707988, 0.2358739495711217, 0.7639677263653059, 1.018272118001973, 110.5930025905576],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [1.854144473996553, 0.2482651931323251, -1.605879280864228, 0.911693355383927, 0.06687768686978803, 0.1773792065938124, 1.018900363058617, 107.7867676332771],
-      [2.995835661509661, 0.2177481459736557, -2.778087515536006, 0.9760370356447799, 0.01627606015247546, 0.0409483196443525, 1.028080471094038, 78.93637478717828],
-      [0.9668665416554862, 0.3009599098333312, -0.6659066318221551, 0.7241811011389289, 0.2229386169158468, 0.7100517706055723, 1.002874442834298, 319.14314136437],
-      [2.840422857790316, 0.2192612564237259, -2.62116160136659, 0.9732579953808159, 0.01824949051068622, 0.04600548865574921, 1.028438778026523, 78.13146865018253],
-      [2.455005917288323, 0.3057837283991338, -2.149222188889189, 0.9408513770576292, 0.03974851164728981, 0.1024462159425694, 1.013999387746001, 134.5989348783295],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [1.332105504292163, 0.2911527042999624, -1.0409527999922, 0.8580664866696359, 0.1099519966711528, 0.3057382173740006, 1.006919592646802, 212.2251145617833],
-      [0.879923297328947, 0.3398407921249819, -0.5400825052039652, 0.6852765479619829, 0.2585528188121205, 0.863036368798984, 1.002612170061262, 329.9915859770657],
-      [2.491162154708401, 0.2786074996896643, -2.212554655018737, 0.9498361142817293, 0.0340058323374775, 0.08712422821188849, 1.017442877786285, 114.5374851302631],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [4.176822111673053, 0.2393194605017307, -3.937502651171322, 0.9924917191674293, 0.003990084113697441, 0.009914673748003902, 1.014148482349454, 133.5809661006575],
-      [2.720677787970423, 0.2079160295827146, -2.512761758387708, 0.9736541385090387, 0.0181208301669939, 0.04567516052169845, 1.032395404079509, 70.26875466305658],
-      [0.7117442853123787, 0.6750078834102817, -0.03673640190209693, 0.4353740231518176, 0.4996082788135175, 2.471038713266321, 1.010525437646852, 163.8490465249102],
-      [2.500523841033011, 0.2269268494417441, -2.273596991591267, 0.9642325385084416, 0.02474522610131521, 0.06279620239103423, 1.027610842816234, 80.0181358918106],
-      [2.978958836684555, 0.2680312662768128, -2.710927570407742, 0.9821665206412863, 0.007032970310477123, 0.01752927662434437, 1.011258902418437, 156.633191849101],
-      [1.592635024957624, 0.2801119876882321, -1.312523037269391, 0.8823976166017655, 0.09028267779042472, 0.2456167646981983, 1.012164518780813, 148.5739223895976],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [2.601420958867407, 0.2101101404899524, -2.391310818377455, 0.9707923028857582, 0.02018140596153751, 0.05097600312886122, 1.032154149997674, 70.70024102322525],
-      [0.8773937341354101, 0.3475099896630789, -0.5298837444723312, 0.680300917779261, 0.2633474859906303, 0.8847621604953562, 1.002697441028938, 326.3835308627669],
-      [0.9624315338084155, 0.3106932502616423, -0.6517382835467732, 0.7172379818069443, 0.2295641327051292, 0.7374415107863223, 1.002954263939352, 315.9832585879507],
-      [1.667319262539328, 0.6272923305929466, -1.040026931946381, 0.7356120595181982, 0.2065749504793381, 0.64436477134683, 1.022733121004735, 93.41964071503168],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [0.5722855475328105, 0.9362471643639783, 0.3639616168311678, 0.3174673733776016, 0.6211480790112477, 4.057753786980037, 1.00898686434514, 181.4423296529839],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [0.7846952375911359, 0.3419695414072991, -0.4427256961838368, 0.66474930843101, 0.2758187037484801, 0.9426195616677815, 1.002042312464576, 356.3430111960679],
-      [0.9027386312484692, 0.3437531283845285, -0.5589855028639408, 0.6871058824340311, 0.2573635938383049, 0.8576911239257928, 1.002843519720821, 320.3845531958507],
-      [0.7960903632099977, 0.3064198752854755, -0.4896704879245222, 0.690383633266426, 0.2507810120802267, 0.8284111092745902, 1.001528173472527, 384.0581547005908],
-      [1.082459202612813, 0.6303250205192519, -0.4521341820935609, 0.5333985981074874, 0.4050806177920331, 1.685168701353431, 1.014168213543414, 133.4474338868085],
-      [0.8413075707773295, 0.358938194848529, -0.4823693759288006, 0.6666617693115888, 0.2757165802675116, 0.9421376917651514, 1.002604040127967, 330.3398048529531],
-      [4.538414837959855, 0.2434491174865033, -4.294965720473352, 0.9935909409228831, 0.003380031349888639, 0.008393656316472247, 1.012588069724019, 145.0893217258987],
-      [1.890043403434193, 0.2924876019425393, -1.597555801491653, 0.8938335591220085, 0.08096786618657266, 0.2180429436004691, 1.014413229399085, 131.8118727308687],
-      [1.273687850790189, 0.3689010401916521, -0.9047868105985366, 0.8124184203742892, 0.1482015260309627, 0.4306018158481385, 1.005348400421654, 243.8372968412305],
-      [1.466667961550674, 0.7089142997238984, -0.7577536618267757, 0.676859446275393, 0.2545004063749204, 0.8448918251794992, 1.015267057889396, 126.4211459557757],
-      [0.9156865095807959, 0.3099930453096433, -0.6056934642711526, 0.7102035250013152, 0.2351908633382191, 0.7610749324307075, 1.002485415633677, 335.5065881985654],
-      [1.481783647959608, 1.736451524245542, 0.254667876285934, 0.3344158997063016, 0.5147039257950496, 2.624887783562591, 1.011433528258836, 155.0100821043556],
-      [0.7037078232127147, 1.594878727728295, 0.8911709045155802, 0.1723966179978587, 0.7584787080362883, 7.772272335970688, 0.9974444145414667, 1016.161569101106],
-      [1.275118896745693, 0.368784791932814, -0.9063341048128792, 0.8126209139365349, 0.1480281360776774, 0.4300104968147133, 1.005361889457443, 243.5251481417109],
-      [2.648377596754611, 0.2770584485217114, -2.371319148232899, 0.9670923591199616, 0.01870636593777724, 0.04717919032569691, 1.014668969935728, 130.1481597762916],
-      [0.7401326238170173, 0.2943376857530516, -0.4457949380639656, 0.6867910948254169, 0.2519957086922944, 0.833775433192942, 1.001134236074647, 408.4309186452369],
-      [0.7475862077233261, 0.7289016926185065, -0.01868451510481961, 0.4280221324975716, 0.5064676994405842, 2.539780652051855, 1.008927429021141, 182.1998744948708],
-      [0.7871260302852221, 0.3391963520899104, -0.4479296781953117, 0.6670270080830214, 0.2736441503670521, 0.9323882015745496, 1.002009915419368, 357.9696003076922],
-      [2.411323584048575, 0.5805378369995056, -1.830785747049069, 0.6096380066591316, 0.3357362411583407, 1.250885920101035, 1.016516888473279, 119.301325105085],
-      [2.396009525246266, 0.3812314445698044, -2.014778080676462, 0.7485895024695801, 0.2072063773965674, 0.6468491459159433, 1.005927989361195, 231.1190861723064],
-      [0.7960903632099977, 0.3064198752854755, -0.4896704879245222, 0.690383633266426, 0.2507810120802267, 0.8284111092745902, 1.001528173472527, 384.0581547005908],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [0.9444540669483967, 0.3575106756104039, -0.5869433913379928, 0.6865353752944214, 0.2588678624946797, 0.8644552791274397, 1.003330330066721, 301.9094206827929],
-      [4.733855670346002, 0.2493868935702829, -4.484468776775719, 0.9937487924115234, 0.003251041119604616, 0.008072289166132477, 1.01162389268238, 153.2795072790302],
-      [0.8017827875978873, 0.2910612307310945, -0.5107215568667929, 0.7022267674392259, 0.2392275136253522, 0.7782450512235876, 1.001321364323131, 396.4753389951715],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739],
-      [1.525255200133543, 0.2636106099260035, -1.261644590207539, 0.8865445659921086, 0.08681512652097743, 0.2352863499806732, 1.011712761233763, 152.4851052444758],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [0.8910433359442418, 0.3103357814592619, -0.5807075544849798, 0.7057855884293825, 0.2388019956728835, 0.7764265002122339, 1.002266581537338, 345.479962660838],
-      [0.7441463041072498, 0.6964220918130122, -0.04772421229423762, 0.4379455818218148, 0.4968583433131759, 2.444006465749883, 1.009843132299588, 171.2013484835587],
-      [0.8882249441693671, 0.3172865720399499, -0.5709383721294172, 0.7007791696166791, 0.2436218023822329, 0.7971447477653065, 1.002348321846302, 341.6852605085693],
-      [0.8789701966315052, 0.3275055332809348, -0.5514646633505704, 0.69266092973228, 0.2513023379988544, 0.8307112483915374, 1.002425828111919, 338.1641517723739]
-      ]
-    }
-  },
- "settings":{
-   "grid size":20,
-   "chains":5,
-   "chain-length":2000000,
-   "burn-in":1000000,
-   "samples":100,
-   "concentration":0.5,
-   "posterior":0.9
+    ["BayesFactor[alpha<beta]", "Empiricial Bayes Factor for positive selection at a site"] 
+    ]
   },
- "grid":[
-  [0, 0, 0.003566485105868109],
-  [0, 0.07142857142857142, 0.002826400980852295],
-  [0, 0.1428571428571428, 0.002208975005805559],
-  [0, 0.2142857142857143, 0.002289838507721244],
-  [0, 0.2857142857142857, 0.001783646295561258],
-  [0, 0.3571428571428571, 0.001682428079291638],
-  [0, 0.4285714285714285, 0.002766714646882475],
-  [0, 0.5, 0.001348475614247424],
-  [0, 0.5714285714285714, 0.001624594474256382],
-  [0, 0.6428571428571428, 0.001773448880425334],
-  [0, 0.7142857142857142, 0.001350933590560411],
-  [0, 0.7857142857142857, 0.001611523238364097],
-  [0, 0.8571428571428571, 0.001532150955904425],
-  [0, 1, 0.001370389320470131],
-  [0, 1.226851851851852, 0.001452940651691179],
-  [0, 2.814814814814814, 0.001492384497161619],
-  [0, 7.124999999999997, 0.000911053111213648],
-  [0, 15.51851851851851, 0.0008204393311313389],
-  [0, 29.35648148148148, 0.0006172699429229924],
-  [0, 49.99999999999997, 7.492152685461611e-05],
-  [0.07142857142857142, 0, 0.002460458469557386],
-  [0.07142857142857142, 0.07142857142857142, 0.00262839253562382],
-  [0.07142857142857142, 0.1428571428571428, 0.002246646200247642],
-  [0.07142857142857142, 0.2142857142857143, 0.002301238589697125],
-  [0.07142857142857142, 0.2857142857142857, 0.001943017923948005],
-  [0.07142857142857142, 0.3571428571428571, 0.001985764372906819],
-  [0.07142857142857142, 0.4285714285714285, 0.001517102522432792],
-  [0.07142857142857142, 0.5, 0.001745180911894929],
-  [0.07142857142857142, 0.5714285714285714, 0.001472114404040637],
-  [0.07142857142857142, 0.6428571428571428, 0.001897354313855837],
-  [0.07142857142857142, 0.7142857142857142, 0.001837519839811746],
-  [0.07142857142857142, 0.7857142857142857, 0.001667733627124252],
-  [0.07142857142857142, 0.8571428571428571, 0.001560644090949045],
-  [0.07142857142857142, 1, 0.001615669649678702],
-  [0.07142857142857142, 1.226851851851852, 0.001320998501434628],
-  [0.07142857142857142, 2.814814814814814, 0.001518127913462953],
-  [0.07142857142857142, 7.124999999999997, 0.001071621827169525],
-  [0.07142857142857142, 15.51851851851851, 0.0007056647373996531],
-  [0.07142857142857142, 29.35648148148148, 0.0006206957308863899],
-  [0.07142857142857142, 49.99999999999997, 2.834027170181406e-12],
-  [0.1428571428571428, 0, 0.003199373678685308],
-  [0.1428571428571428, 0.07142857142857142, 0.003083640864170892],
-  [0.1428571428571428, 0.1428571428571428, 0.002550563317149404],
-  [0.1428571428571428, 0.2142857142857143, 0.003070071388649915],
-  [0.1428571428571428, 0.2857142857142857, 0.002540205111958184],
-  [0.1428571428571428, 0.3571428571428571, 0.001904128130031458],
-  [0.1428571428571428, 0.4285714285714285, 0.002122713269999842],
-  [0.1428571428571428, 0.5, 0.00174955337462884],
-  [0.1428571428571428, 0.5714285714285714, 0.001742898904399907],
-  [0.1428571428571428, 0.6428571428571428, 0.001632368869041386],
-  [0.1428571428571428, 0.7142857142857142, 0.00167606910365811],
-  [0.1428571428571428, 0.7857142857142857, 0.001390780044626511],
-  [0.1428571428571428, 0.8571428571428571, 0.001502992472117009],
-  [0.1428571428571428, 1, 0.001744661755533303],
-  [0.1428571428571428, 1.226851851851852, 0.001715924371474862],
-  [0.1428571428571428, 2.814814814814814, 0.001096443518974232],
-  [0.1428571428571428, 7.124999999999997, 0.001011341949531368],
-  [0.1428571428571428, 15.51851851851851, 0.000596919106645181],
-  [0.1428571428571428, 29.35648148148148, 0.0005986777735393406],
-  [0.1428571428571428, 49.99999999999997, 5.394909713193237e-12],
-  [0.2142857142857143, 0, 0.003796797473995552],
-  [0.2142857142857143, 0.07142857142857142, 0.003433539578794974],
-  [0.2142857142857143, 0.1428571428571428, 0.00301939869903142],
-  [0.2142857142857143, 0.2142857142857143, 0.002187359854626631],
-  [0.2142857142857143, 0.2857142857142857, 0.002715365058624243],
-  [0.2142857142857143, 0.3571428571428571, 0.002372334802668396],
-  [0.2142857142857143, 0.4285714285714285, 0.002153488888048853],
-  [0.2142857142857143, 0.5, 0.001965723666608315],
-  [0.2142857142857143, 0.5714285714285714, 0.002192909876050419],
-  [0.2142857142857143, 0.6428571428571428, 0.00235025256331522],
-  [0.2142857142857143, 0.7142857142857142, 0.001749179128168067],
-  [0.2142857142857143, 0.7857142857142857, 0.001426008538060742],
-  [0.2142857142857143, 0.8571428571428571, 0.001818456704505477],
-  [0.2142857142857143, 1, 0.001674195986678133],
-  [0.2142857142857143, 1.226851851851852, 0.001727822131412832],
-  [0.2142857142857143, 2.814814814814814, 0.001634427072141269],
-  [0.2142857142857143, 7.124999999999997, 0.00125352126450876],
-  [0.2142857142857143, 15.51851851851851, 0.0005759273354706306],
-  [0.2142857142857143, 29.35648148148148, 0.0006159248597468593],
-  [0.2142857142857143, 49.99999999999997, 1.534567413897764e-05],
-  [0.2857142857142857, 0, 0.003671527830301379],
-  [0.2857142857142857, 0.07142857142857142, 0.002679378264525472],
-  [0.2857142857142857, 0.1428571428571428, 0.003016134447030957],
-  [0.2857142857142857, 0.2142857142857143, 0.00310306847311674],
-  [0.2857142857142857, 0.2857142857142857, 0.001826431868541163],
-  [0.2857142857142857, 0.3571428571428571, 0.002351495885884325],
-  [0.2857142857142857, 0.4285714285714285, 0.002227158317147043],
-  [0.2857142857142857, 0.5, 0.002234907321847176],
-  [0.2857142857142857, 0.5714285714285714, 0.002007583403665229],
-  [0.2857142857142857, 0.6428571428571428, 0.001945909001979804],
-  [0.2857142857142857, 0.7142857142857142, 0.001625471903098237],
-  [0.2857142857142857, 0.7857142857142857, 0.001666739480232462],
-  [0.2857142857142857, 0.8571428571428571, 0.002479904186938647],
-  [0.2857142857142857, 1, 0.002280938421655963],
-  [0.2857142857142857, 1.226851851851852, 0.002058496502887372],
-  [0.2857142857142857, 2.814814814814814, 0.001503579886306614],
-  [0.2857142857142857, 7.124999999999997, 0.0009144292946391937],
-  [0.2857142857142857, 15.51851851851851, 0.0006566114215945892],
-  [0.2857142857142857, 29.35648148148148, 0.0008803807370328192],
-  [0.2857142857142857, 49.99999999999997, 0.0001702530484939889],
-  [0.3571428571428571, 0, 0.004118199494559098],
-  [0.3571428571428571, 0.07142857142857142, 0.004151229886670712],
-  [0.3571428571428571, 0.1428571428571428, 0.003674043425014049],
-  [0.3571428571428571, 0.2142857142857143, 0.002683032458724193],
-  [0.3571428571428571, 0.2857142857142857, 0.002785827354168251],
-  [0.3571428571428571, 0.3571428571428571, 0.002159872728561493],
-  [0.3571428571428571, 0.4285714285714285, 0.002394272533350332],
-  [0.3571428571428571, 0.5, 0.002518245064642241],
-  [0.3571428571428571, 0.5714285714285714, 0.002094544785686356],
-  [0.3571428571428571, 0.6428571428571428, 0.002537889368802281],
-  [0.3571428571428571, 0.7142857142857142, 0.002229022400396113],
-  [0.3571428571428571, 0.7857142857142857, 0.00234596756199876],
-  [0.3571428571428571, 0.8571428571428571, 0.001818266937123089],
-  [0.3571428571428571, 1, 0.002169977995308523],
-  [0.3571428571428571, 1.226851851851852, 0.002221740898729235],
-  [0.3571428571428571, 2.814814814814814, 0.001827342908496349],
-  [0.3571428571428571, 7.124999999999997, 0.001084085913565364],
-  [0.3571428571428571, 15.51851851851851, 0.0007621074138405115],
-  [0.3571428571428571, 29.35648148148148, 0.0005906789240157908],
-  [0.3571428571428571, 49.99999999999997, 1.319060493947554e-11],
-  [0.4285714285714285, 0, 0.004377629604482557],
-  [0.4285714285714285, 0.07142857142857142, 0.003727730225676119],
-  [0.4285714285714285, 0.1428571428571428, 0.002804412221528817],
-  [0.4285714285714285, 0.2142857142857143, 0.002906405086520727],
-  [0.4285714285714285, 0.2857142857142857, 0.003528577225566362],
-  [0.4285714285714285, 0.3571428571428571, 0.003144800763981022],
-  [0.4285714285714285, 0.4285714285714285, 0.002331942279731347],
-  [0.4285714285714285, 0.5, 0.002790055765644821],
-  [0.4285714285714285, 0.5714285714285714, 0.002333947914938426],
-  [0.4285714285714285, 0.6428571428571428, 0.002179969541563648],
-  [0.4285714285714285, 0.7142857142857142, 0.001959126229259504],
-  [0.4285714285714285, 0.7857142857142857, 0.001821142356372389],
-  [0.4285714285714285, 0.8571428571428571, 0.001837143827628365],
-  [0.4285714285714285, 1, 0.002025959874000692],
-  [0.4285714285714285, 1.226851851851852, 0.001710022654364109],
-  [0.4285714285714285, 2.814814814814814, 0.00162354787914332],
-  [0.4285714285714285, 7.124999999999997, 0.000910183983527698],
-  [0.4285714285714285, 15.51851851851851, 0.0007118207583761478],
-  [0.4285714285714285, 29.35648148148148, 0.0006549760717555229],
-  [0.4285714285714285, 49.99999999999997, 0.0001341122792574428],
-  [0.5, 0, 0.004955538135638055],
-  [0.5, 0.07142857142857142, 0.002924178070872752],
-  [0.5, 0.1428571428571428, 0.003147273306496483],
-  [0.5, 0.2142857142857143, 0.002911531640439218],
-  [0.5, 0.2857142857142857, 0.003325303396919567],
-  [0.5, 0.3571428571428571, 0.0029056584857205],
-  [0.5, 0.4285714285714285, 0.002177842263620834],
-  [0.5, 0.5, 0.002663555391828788],
-  [0.5, 0.5714285714285714, 0.002065133900386383],
-  [0.5, 0.6428571428571428, 0.002248047348982078],
-  [0.5, 0.7142857142857142, 0.001733960673905844],
-  [0.5, 0.7857142857142857, 0.002294226326882008],
-  [0.5, 0.8571428571428571, 0.001674899245602686],
-  [0.5, 1, 0.002207709550312046],
-  [0.5, 1.226851851851852, 0.002008840722389587],
-  [0.5, 2.814814814814814, 0.001988815883082963],
-  [0.5, 7.124999999999997, 0.000920622247457354],
-  [0.5, 15.51851851851851, 0.000885154644084932],
-  [0.5, 29.35648148148148, 0.0005876770579685993],
-  [0.5, 49.99999999999997, 0.0004038677581444775],
-  [0.5714285714285714, 0, 0.004790929312101004],
-  [0.5714285714285714, 0.07142857142857142, 0.00462260586482703],
-  [0.5714285714285714, 0.1428571428571428, 0.003603829892718844],
-  [0.5714285714285714, 0.2142857142857143, 0.003511622621253757],
-  [0.5714285714285714, 0.2857142857142857, 0.002672617611336282],
-  [0.5714285714285714, 0.3571428571428571, 0.003071826477012179],
-  [0.5714285714285714, 0.4285714285714285, 0.003480256946505197],
-  [0.5714285714285714, 0.5, 0.002753792675331192],
-  [0.5714285714285714, 0.5714285714285714, 0.004280449767751163],
-  [0.5714285714285714, 0.6428571428571428, 0.002203272232350238],
-  [0.5714285714285714, 0.7142857142857142, 0.001600910968683837],
-  [0.5714285714285714, 0.7857142857142857, 0.002047560928751004],
-  [0.5714285714285714, 0.8571428571428571, 0.002161357037185646],
-  [0.5714285714285714, 1, 0.001774659435132773],
-  [0.5714285714285714, 1.226851851851852, 0.001802524119650845],
-  [0.5714285714285714, 2.814814814814814, 0.002312328014197016],
-  [0.5714285714285714, 7.124999999999997, 0.000959895409307253],
-  [0.5714285714285714, 15.51851851851851, 0.0006169988395988917],
-  [0.5714285714285714, 29.35648148148148, 0.0005296745836157754],
-  [0.5714285714285714, 49.99999999999997, 0.0004273732301919077],
-  [0.6428571428571428, 0, 0.003848889759341566],
-  [0.6428571428571428, 0.07142857142857142, 0.005263992662143216],
-  [0.6428571428571428, 0.1428571428571428, 0.003374439600405826],
-  [0.6428571428571428, 0.2142857142857143, 0.003525113051095404],
-  [0.6428571428571428, 0.2857142857142857, 0.00331074395992592],
-  [0.6428571428571428, 0.3571428571428571, 0.002847947348419937],
-  [0.6428571428571428, 0.4285714285714285, 0.002533924956667675],
-  [0.6428571428571428, 0.5, 0.003145327775958633],
-  [0.6428571428571428, 0.5714285714285714, 0.002170663467695599],
-  [0.6428571428571428, 0.6428571428571428, 0.002509692174109326],
-  [0.6428571428571428, 0.7142857142857142, 0.001850299264964193],
-  [0.6428571428571428, 0.7857142857142857, 0.002299156727927514],
-  [0.6428571428571428, 0.8571428571428571, 0.002402209983461819],
-  [0.6428571428571428, 1, 0.001998392492360502],
-  [0.6428571428571428, 1.226851851851852, 0.00282974736474546],
-  [0.6428571428571428, 2.814814814814814, 0.002294136532075434],
-  [0.6428571428571428, 7.124999999999997, 0.001135418233892558],
-  [0.6428571428571428, 15.51851851851851, 0.000733887069162004],
-  [0.6428571428571428, 29.35648148148148, 0.0006570587906052773],
-  [0.6428571428571428, 49.99999999999997, 0.0001455635578299942],
-  [0.7142857142857142, 0, 0.005281032499200192],
-  [0.7142857142857142, 0.07142857142857142, 0.002998631373914088],
-  [0.7142857142857142, 0.1428571428571428, 0.003890892428949155],
-  [0.7142857142857142, 0.2142857142857143, 0.003968478051307647],
-  [0.7142857142857142, 0.2857142857142857, 0.003452557568942735],
-  [0.7142857142857142, 0.3571428571428571, 0.002976539852448634],
-  [0.7142857142857142, 0.4285714285714285, 0.002782306568899104],
-  [0.7142857142857142, 0.5, 0.002343030804265045],
-  [0.7142857142857142, 0.5714285714285714, 0.002662932757366384],
-  [0.7142857142857142, 0.6428571428571428, 0.002372251015769065],
-  [0.7142857142857142, 0.7142857142857142, 0.002422655236227494],
-  [0.7142857142857142, 0.7857142857142857, 0.002540244852742098],
-  [0.7142857142857142, 0.8571428571428571, 0.002608550629555038],
-  [0.7142857142857142, 1, 0.001860280439381926],
-  [0.7142857142857142, 1.226851851851852, 0.002152567383887691],
-  [0.7142857142857142, 2.814814814814814, 0.001600405845247067],
-  [0.7142857142857142, 7.124999999999997, 0.0009888296769279608],
-  [0.7142857142857142, 15.51851851851851, 0.0007623595956351668],
-  [0.7142857142857142, 29.35648148148148, 0.0005744347348384921],
-  [0.7142857142857142, 49.99999999999997, 2.570444039427348e-11],
-  [0.7857142857142857, 0, 0.005185186965274221],
-  [0.7857142857142857, 0.07142857142857142, 0.004834076738514053],
-  [0.7857142857142857, 0.1428571428571428, 0.003929676322252884],
-  [0.7857142857142857, 0.2142857142857143, 0.003069784000348836],
-  [0.7857142857142857, 0.2857142857142857, 0.003625717465153146],
-  [0.7857142857142857, 0.3571428571428571, 0.002713188311368018],
-  [0.7857142857142857, 0.4285714285714285, 0.003172397669557559],
-  [0.7857142857142857, 0.5, 0.002545876123079843],
-  [0.7857142857142857, 0.5714285714285714, 0.002989406803733328],
-  [0.7857142857142857, 0.6428571428571428, 0.002781927384312028],
-  [0.7857142857142857, 0.7142857142857142, 0.00304272959446627],
-  [0.7857142857142857, 0.7857142857142857, 0.001939940670678482],
-  [0.7857142857142857, 0.8571428571428571, 0.002521015509439848],
-  [0.7857142857142857, 1, 0.002532995606127067],
-  [0.7857142857142857, 1.226851851851852, 0.002600073525154905],
-  [0.7857142857142857, 2.814814814814814, 0.001891335130397677],
-  [0.7857142857142857, 7.124999999999997, 0.001058126376238864],
-  [0.7857142857142857, 15.51851851851851, 0.0007000315590681962],
-  [0.7857142857142857, 29.35648148148148, 0.0008777810472400403],
-  [0.7857142857142857, 49.99999999999997, 0.0002126709629464618],
-  [0.8571428571428571, 0, 0.006143423338138224],
-  [0.8571428571428571, 0.07142857142857142, 0.00670187700279457],
-  [0.8571428571428571, 0.1428571428571428, 0.005030811804073232],
-  [0.8571428571428571, 0.2142857142857143, 0.003313264360380082],
-  [0.8571428571428571, 0.2857142857142857, 0.002916791956246419],
-  [0.8571428571428571, 0.3571428571428571, 0.002818662523207853],
-  [0.8571428571428571, 0.4285714285714285, 0.002534106240588181],
-  [0.8571428571428571, 0.5, 0.002381655629268263],
-  [0.8571428571428571, 0.5714285714285714, 0.00328769339080697],
-  [0.8571428571428571, 0.6428571428571428, 0.003945358065690954],
-  [0.8571428571428571, 0.7142857142857142, 0.003015620879562573],
-  [0.8571428571428571, 0.7857142857142857, 0.003298819368713533],
-  [0.8571428571428571, 0.8571428571428571, 0.002537380440763714],
-  [0.8571428571428571, 1, 0.001899585721869981],
-  [0.8571428571428571, 1.226851851851852, 0.003380666575548595],
-  [0.8571428571428571, 2.814814814814814, 0.002285328627911579],
-  [0.8571428571428571, 7.124999999999997, 0.001108411570936609],
-  [0.8571428571428571, 15.51851851851851, 0.0006689371641030385],
-  [0.8571428571428571, 29.35648148148148, 0.0007415798913210063],
-  [0.8571428571428571, 49.99999999999997, 0.0002175517838603884],
-  [1, 0, 0.00765806010035156],
-  [1, 0.07142857142857142, 0.007807457503843863],
-  [1, 0.1428571428571428, 0.004159725948417481],
-  [1, 0.2142857142857143, 0.003399148709293635],
-  [1, 0.2857142857142857, 0.004525235637734775],
-  [1, 0.3571428571428571, 0.003780851582847601],
-  [1, 0.4285714285714285, 0.004569693279325371],
-  [1, 0.5, 0.003857970129706884],
-  [1, 0.5714285714285714, 0.002933804772153088],
-  [1, 0.6428571428571428, 0.00303406089332697],
-  [1, 0.7142857142857142, 0.003114683839386268],
-  [1, 0.7857142857142857, 0.002429051754108082],
-  [1, 0.8571428571428571, 0.002268772043297931],
-  [1, 1, 0.002398083082148811],
-  [1, 1.226851851851852, 0.003035322698040208],
-  [1, 2.814814814814814, 0.003263060834764834],
-  [1, 7.124999999999997, 0.001231893732383622],
-  [1, 15.51851851851851, 0.0006343468731492734],
-  [1, 29.35648148148148, 0.0005628071276917429],
-  [1, 49.99999999999997, 0.0003375241235138881],
-  [1.226851851851852, 0, 0.005486093955090999],
-  [1.226851851851852, 0.07142857142857142, 0.009610940238548873],
-  [1.226851851851852, 0.1428571428571428, 0.005675448572148123],
-  [1.226851851851852, 0.2142857142857143, 0.006088386992338565],
-  [1.226851851851852, 0.2857142857142857, 0.004794302244730719],
-  [1.226851851851852, 0.3571428571428571, 0.004786336767940444],
-  [1.226851851851852, 0.4285714285714285, 0.003666024296536285],
-  [1.226851851851852, 0.5, 0.003737461270631796],
-  [1.226851851851852, 0.5714285714285714, 0.003182641251622425],
-  [1.226851851851852, 0.6428571428571428, 0.003141728458929417],
-  [1.226851851851852, 0.7142857142857142, 0.004095750239857854],
-  [1.226851851851852, 0.7857142857142857, 0.004026403158879832],
-  [1.226851851851852, 0.8571428571428571, 0.003778994964563776],
-  [1.226851851851852, 1, 0.003381423623646984],
-  [1.226851851851852, 1.226851851851852, 0.003554908137809505],
-  [1.226851851851852, 2.814814814814814, 0.003705378803974616],
-  [1.226851851851852, 7.124999999999997, 0.001107422604820455],
-  [1.226851851851852, 15.51851851851851, 0.0005915336097180631],
-  [1.226851851851852, 29.35648148148148, 0.0007027622148077111],
-  [1.226851851851852, 49.99999999999997, 7.898492615571901e-05],
-  [2.814814814814814, 0, 0.07470839861493363],
-  [2.814814814814814, 0.07142857142857142, 0.03629888527244875],
-  [2.814814814814814, 0.1428571428571428, 0.01042100873655743],
-  [2.814814814814814, 0.2142857142857143, 0.007201266334133851],
-  [2.814814814814814, 0.2857142857142857, 0.007271649971854223],
-  [2.814814814814814, 0.3571428571428571, 0.01307015620578551],
-  [2.814814814814814, 0.4285714285714285, 0.007460981919634715],
-  [2.814814814814814, 0.5, 0.008137207651782106],
-  [2.814814814814814, 0.5714285714285714, 0.006957570691579626],
-  [2.814814814814814, 0.6428571428571428, 0.004633754901357615],
-  [2.814814814814814, 0.7142857142857142, 0.006850686281752066],
-  [2.814814814814814, 0.7857142857142857, 0.007798865860822833],
-  [2.814814814814814, 0.8571428571428571, 0.005610725548643745],
-  [2.814814814814814, 1, 0.003256861800651695],
-  [2.814814814814814, 1.226851851851852, 0.005558217734956425],
-  [2.814814814814814, 2.814814814814814, 0.006897113354127229],
-  [2.814814814814814, 7.124999999999997, 0.00175029290499021],
-  [2.814814814814814, 15.51851851851851, 0.0007145857148101797],
-  [2.814814814814814, 29.35648148148148, 0.000900294594835348],
-  [2.814814814814814, 49.99999999999997, 0.0002720137221748741],
-  [7.124999999999997, 0, 0.00398417470554285],
-  [7.124999999999997, 0.07142857142857142, 0.002439413316640502],
-  [7.124999999999997, 0.1428571428571428, 0.00238415904086006],
-  [7.124999999999997, 0.2142857142857143, 0.002252829226358759],
-  [7.124999999999997, 0.2857142857142857, 0.001970530740482054],
-  [7.124999999999997, 0.3571428571428571, 0.002222741239949268],
-  [7.124999999999997, 0.4285714285714285, 0.001744210540259185],
-  [7.124999999999997, 0.5, 0.001993900770440676],
-  [7.124999999999997, 0.5714285714285714, 0.001764470862569359],
-  [7.124999999999997, 0.6428571428571428, 0.001705485823955997],
-  [7.124999999999997, 0.7142857142857142, 0.00191068869828945],
-  [7.124999999999997, 0.7857142857142857, 0.002435886622212691],
-  [7.124999999999997, 0.8571428571428571, 0.00172518884404653],
-  [7.124999999999997, 1, 0.002130831950329923],
-  [7.124999999999997, 1.226851851851852, 0.001834645818520661],
-  [7.124999999999997, 2.814814814814814, 0.002566227575409709],
-  [7.124999999999997, 7.124999999999997, 0.0017531864641651],
-  [7.124999999999997, 15.51851851851851, 0.0008489943724799491],
-  [7.124999999999997, 29.35648148148148, 0.0005978977445014268],
-  [7.124999999999997, 49.99999999999997, 6.300310911994327e-05],
-  [15.51851851851851, 0, 0.000953496201063784],
-  [15.51851851851851, 0.07142857142857142, 0.00106058286991154],
-  [15.51851851851851, 0.1428571428571428, 0.001005752149637742],
-  [15.51851851851851, 0.2142857142857143, 0.0006455641728210646],
-  [15.51851851851851, 0.2857142857142857, 0.0008751928354308413],
-  [15.51851851851851, 0.3571428571428571, 0.0008193578822576485],
-  [15.51851851851851, 0.4285714285714285, 0.0007796859096090168],
-  [15.51851851851851, 0.5, 0.0009747867573569269],
-  [15.51851851851851, 0.5714285714285714, 0.0007094395907142635],
-  [15.51851851851851, 0.6428571428571428, 0.0008424416905178129],
-  [15.51851851851851, 0.7142857142857142, 0.0007178246294540181],
-  [15.51851851851851, 0.7857142857142857, 0.0009301935919149497],
-  [15.51851851851851, 0.8571428571428571, 0.0005277994710603308],
-  [15.51851851851851, 1, 0.0006225448092072107],
-  [15.51851851851851, 1.226851851851852, 0.0007916286357155097],
-  [15.51851851851851, 2.814814814814814, 0.0009983292869775982],
-  [15.51851851851851, 7.124999999999997, 0.0007962185687239956],
-  [15.51851851851851, 15.51851851851851, 0.000505660706469485],
-  [15.51851851851851, 29.35648148148148, 0.0006014094573757414],
-  [15.51851851851851, 49.99999999999997, 1.146153717420187e-12],
-  [29.35648148148148, 0, 0.000730263611243498],
-  [29.35648148148148, 0.07142857142857142, 0.0005785791605808555],
-  [29.35648148148148, 0.1428571428571428, 0.0005721264349885725],
-  [29.35648148148148, 0.2142857142857143, 0.0005699724719162318],
-  [29.35648148148148, 0.2857142857142857, 0.0009090795788675955],
-  [29.35648148148148, 0.3571428571428571, 0.0005748822518164995],
-  [29.35648148148148, 0.4285714285714285, 0.0006198121254602603],
-  [29.35648148148148, 0.5, 0.000693896104581783],
-  [29.35648148148148, 0.5714285714285714, 0.0008289477822111757],
-  [29.35648148148148, 0.6428571428571428, 0.0006539207561656256],
-  [29.35648148148148, 0.7142857142857142, 0.0008837467855461176],
-  [29.35648148148148, 0.7857142857142857, 0.0007060147882856993],
-  [29.35648148148148, 0.8571428571428571, 0.0006641638869036757],
-  [29.35648148148148, 1, 0.0005722511029581886],
-  [29.35648148148148, 1.226851851851852, 0.0007172634236766243],
-  [29.35648148148148, 2.814814814814814, 0.0006248044974519586],
-  [29.35648148148148, 7.124999999999997, 0.0006326357864134605],
-  [29.35648148148148, 15.51851851851851, 0.0006359769193741896],
-  [29.35648148148148, 29.35648148148148, 0.0003993430391488372],
-  [29.35648148148148, 49.99999999999997, 4.823664865156492e-15],
-  [49.99999999999997, 0, 0.0006508525986467596],
-  [49.99999999999997, 0.07142857142857142, 0.0006165121778205312],
-  [49.99999999999997, 0.1428571428571428, 0.000610809109953181],
-  [49.99999999999997, 0.2142857142857143, 0.0005632680159270425],
-  [49.99999999999997, 0.2857142857142857, 0.0006660165786033839],
-  [49.99999999999997, 0.3571428571428571, 0.0006860563369544599],
-  [49.99999999999997, 0.4285714285714285, 0.0005009311302318973],
-  [49.99999999999997, 0.5, 0.0007478231977906841],
-  [49.99999999999997, 0.5714285714285714, 0.0005605236092755399],
-  [49.99999999999997, 0.6428571428571428, 0.000582374587267548],
-  [49.99999999999997, 0.7142857142857142, 0.0007538329956925178],
-  [49.99999999999997, 0.7857142857142857, 0.0005467902239469845],
-  [49.99999999999997, 0.8571428571428571, 0.0006106927854378733],
-  [49.99999999999997, 1, 0.0005650721240346655],
-  [49.99999999999997, 1.226851851851852, 0.0005648317033213288],
-  [49.99999999999997, 2.814814814814814, 0.0007262156