changeset 0:a4136c1534be draft

planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/glimmer commit 37388949e348d221170659bbee547bf4ac67ef1a
author bgruening
date Tue, 28 Nov 2017 10:11:42 -0500
parents
children b7b320f4c595
files glimmer2seq.py glimmer_gbk_to_orf.py glimmer_glimmer_to_gff.py glimmer_long_orfs.xml glimmer_wo_icm.py macros.xml test-data/coordTest.txt test-data/extractTestOutput.fasta test-data/glimmer.gff test-data/glimmer_w_icm_trans-table-11_genomic.dout test-data/glimmer_w_icm_trans-table-11_genomic.fasta test-data/glimmer_w_icm_trans-table-11_genomic.out test-data/glimmer_wo_icm_trans-table-11_plasmid_genomic.fasta test-data/longORFSTestOutput.dat test-data/orf_aa.fa test-data/orf_nc.fa test-data/streptomyces_Tu6071_genomic.acgt test-data/streptomyces_Tu6071_genomic.fasta test-data/streptomyces_Tu6071_plasmid_genes.fasta test-data/streptomyces_Tu6071_plasmid_genes.icm test-data/streptomyces_Tue6071_plasmid_genomic.fasta test-data/test.gbk
diffstat 22 files changed, 9757 insertions(+), 0 deletions(-) [+]
line wrap: on
line diff
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/glimmer2seq.py	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,47 @@
+#!/usr/bin/env python
+"""
+Input: DNA FASTA file + Glimmer ORF file
+Output: ORF sequences as FASTA file
+Author: Bjoern Gruening
+"""
+import sys
+
+from Bio import SeqIO
+from Bio.SeqRecord import SeqRecord
+
+
+def glimmer2seq(glimmer_prediction=sys.argv[1], genome_sequence=sys.argv[2], outfile=sys.argv[3]):
+    if len(sys.argv) >= 4:
+        glimmerfile = open(glimmer_prediction, "r")
+        sequence = open(genome_sequence)
+    else:
+        print("Missing input values.")
+        sys.exit()
+
+    fastafile = SeqIO.parse(sequence, "fasta")
+
+    sequences = dict()
+    seq_records = list()
+    for entry in fastafile:
+        sequences[entry.description] = entry
+
+    for line in glimmerfile:
+        if line.startswith('>'):
+            entry = sequences[line[1:].strip()]
+        else:
+            orf_start = int(line[8:17])
+            orf_end = int(line[18:26])
+
+            orf_name = line[0:8]
+            if orf_start <= orf_end:
+                seq_records.append(SeqRecord(entry.seq[orf_start - 1:orf_end], id=orf_name, description=entry.description))
+            else:
+                seq_records.append(SeqRecord(entry.seq[orf_end - 1:orf_start].reverse_complement(), id=orf_name, description=entry.description))
+
+    SeqIO.write(seq_records, outfile, "fasta")
+    glimmerfile.close()
+    sequence.close()
+
+
+if __name__ == "__main__":
+    glimmer2seq()
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/glimmer_gbk_to_orf.py	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,63 @@
+#!/usr/bin/env python
+
+###################################################################
+#
+# gbk2orf.py by Errol Strain (estrain@gmail.com)
+#
+# Read a GenBank file and export fasta formatted amino acid and
+# CDS files
+#
+###################################################################
+
+import sys
+from optparse import OptionParser
+
+from Bio import SeqIO
+from Bio.Seq import Seq
+from Bio.SeqRecord import SeqRecord
+
+
+# Command line usage
+usage = "usage: %prog -g input.gbk -a aa.fasta -n nuc.fasta"
+p = OptionParser(usage)
+p.add_option("-t", "--translate", dest="transtabl", type="int", default=11,
+             help="Translation table used to translate coding regions (default=11)")
+p.add_option("-g", "--genbank", dest="gb_file", help="GenBank input file")
+p.add_option("-a", "--amino_acid", dest="aa_file", help="Fasta amino acid output")
+p.add_option("-n", "--nucleotide", dest="orf_file", help="Fasta nucleotide output")
+(opts, args) = p.parse_args()
+# Do I need this next line?
+if not opts and not args:
+    p.error("Use --help to see usage")
+if len(sys.argv) == 1:
+    p.error("Use --help to see usage")
+
+# Lists to hold SeqRecords
+aalist = []
+nuclist = []
+
+# If the CDS does not have a locus tag the name will be assigned using the
+# order in which it was found
+feat_count = 0
+
+# Iterate through genbank records in input file
+for gb_record in SeqIO.parse(open(opts.gb_file, "r"), "genbank"):
+    for (index, feature) in enumerate(gb_record.features):
+        if feature.type == "CDS":
+            feat_count = feat_count + 1
+            gene = feature.extract(gb_record.seq)
+            if "locus_tag" in feature.qualifiers:
+                value = feature.qualifiers["locus_tag"][0]
+            else:
+                value = "Index_" + str(feat_count)
+            nuclist.append(SeqRecord(Seq(str(gene)), id=value, name=value))
+            pro = Seq(str(gene.translate(table=opts.transtabl, to_stop=True)))
+            aalist.append(SeqRecord(pro, id=value, name=value))
+
+# Write out lists in fasta format
+aa_handle = open(opts.aa_file, "w")
+SeqIO.write(aalist, aa_handle, "fasta")
+aa_handle.close()
+orf_handle = open(opts.orf_file, "w")
+SeqIO.write(nuclist, orf_handle, "fasta")
+orf_handle.close()
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/glimmer_glimmer_to_gff.py	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,38 @@
+#!/usr/bin/env python
+
+"""
+Input: Glimmer3 prediction
+Output: GFF3 file
+Return a GFF3 file with the genes predicted by Glimmer3
+Bjoern Gruening
+
+Note: Its not a full-fledged GFF3 file, its a really simple one.
+
+"""
+
+import re
+import sys
+
+
+def __main__():
+    input_file = open(sys.argv[1], 'r')
+
+    print('##gff-version 3\n')
+    for line in input_file:
+        line = line.strip()
+        if line[0] == '>':
+            header = line[1:]
+        else:
+            (id, start, end, frame, score) = re.split('\s+', line)
+            if int(end) > int(start):
+                strand = '+'
+            else:
+                strand = '-'
+                (start, end) = (end, start)
+
+            rest = 'frame=%s;score=%s' % (frame, score)
+            print('\t'.join([header, 'glimmer_prediction', 'predicted_gene', start, end, '.', strand, '.', rest]))
+
+
+if __name__ == "__main__":
+    __main__()
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/glimmer_long_orfs.xml	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,119 @@
+<tool id="glimmer_long_orfs" name="Glimmer long ORFs" version="@WRAPPER_VERSION@">
+    <description>identify long, non-overlapping ORFs</description>
+    <macros>
+        <import>macros.xml</import>
+    </macros>
+    <expand macro="requirements"/>
+    <command><![CDATA[
+        long-orfs
+            -n -t
+            $cutoff
+            '$inputfile'
+            '$output'
+            2>&1
+    ]]></command>
+    <inputs>
+        <param name="inputfile" type="data" format="fasta" label="Genome Sequence" help="Dataset missing? See TIP below"/>
+        <param name='cutoff' type='float' label='cutoff' value='1.5'/>
+    </inputs>
+    <outputs>
+        <data format="tabular" name="output" />
+    </outputs>
+    <tests>
+        <test>
+            <param name="inputfile" value='streptomyces_Tu6071_genomic.fasta'/>
+            <param name='cutoff' value='1.5'/>
+            <output name="output" file='longORFSTestOutput.dat'/>
+        </test>
+    </tests>
+    <help><![CDATA[
+
+**What it does**
+
+    This program identifies long, non-overlapping open reading frames (orfs) in a DNA sequence file.
+    These orfs are very likely to contain genes, and can be used as a set of training sequences
+    More specifically, among all orfs longer than a minimum length , those that do not overlap any others are output. The start codon used for
+    each orf is the first possible one. The program, by default, automatically determines the
+    value that maximizes the number of orfs that are output. With the -t option, the initial
+    set of candidate orfs also can be filtered using entropy distance, which generally produces
+    a larger, more accurate training set, particularly for high-GC-content genomes.
+
+
+
+-----
+
+**Glimmer Overview**
+
+::
+
+**************		**************		**************		**************
+*            *		*	     *		*            *		*            *
+* long-orfs  *  ===>	*   Extract  *	===>	* build-icm  *  ===>	*  glimmer3  *
+*            *		*	     *		*	     *  	*	     *
+**************		**************		**************		**************
+
+-----
+
+**Example**
+
+
+* input::
+
+	-Genome Sequence
+
+	CELF22B7  C.aenorhabditis elegans (Bristol N2) cosmid F22B7
+	GATCCTTGTAGATTTTGAATTTGAAGTTTTTTCTCATTCCAAAACTCTGT
+	GATCTGAAATAAAATGTCTCAAAAAAATAGAAGAAAACATTGCTTTATAT
+	TTATCAGTTATGGTTTTCAAAATTTTCTGACATACCGTTTTGCTTCTTTT
+	TTTCTCATCTTCTTCAAATATCAATTGTGATAATCTGACTCCTAACAATC
+	GAATTTCTTTTCCTTTTTCTTTTTCCAACAACTCCAGTGAGAACTTTTGA
+	ATATCTTCAAGTGACTTCACCACATCAGAAGGTGTCAACGATCTTGTGAG
+	AACATCGAATGAAGATAATTTTAATTTTAGAGTTACAGTTTTTCCTCCGA
+	CAATTCCTGATTTACGAACATCTTCTTCAAGCATTCTACAGATTTCTTGA
+	TGCTCTTCTAGGAGGATGTTGAAATCCGAAGTTGGAGAAAAAGTTCTCTC
+	AACTGAAATGCTTTTTCTTCGTGGATCCGATTCAGATGGACGACCTGGCA
+	GTCCGAGAGCCGTTCGAAGGAAAGATTCTTGTGAGAGAGGCGTGAAACAC
+	AAAGGGTATAGGTTCTTCTTCAGATTCATATCACCAACAGTTTGAATATC
+	CATTGCTTTCAGTTGAGCTTCGCATACACGACCAATTCCTCCAACCTAAA
+	AAATTATCTAGGTAAAACTAGAAGGTTATGCTTTAATAGTCTCACCTTAC
+	GAATCGGTAAATCCTTCAAAAACTCCATAATCGCGTTTTTATCATTTTCT
+	.....
+
+	- Cutoff 1.5
+
+* output::
+
+	Sequence file = /home/mohammed/galaxy-central/database/files/000/dataset_34.dat
+	Excluded regions file = none
+	Circular genome = true
+	Initial minimum gene length = 90 bp
+	Determine optimal min gene length to maximize number of genes
+	Maximum overlap bases = 30
+	Start codons = atg,gtg,ttg
+	Stop codons = taa,tag,tga
+	Sequence length = 40222
+	Final minimum gene length = 97
+
+	Putative Genes:
+	00001   40137      52  +2   0.892
+	00002    1319    1095  -3   0.654
+	00003    1555    1391  -2   0.793
+	00004    1953    2066  +3   1.078
+	00005    2045    2146  +2   0.919
+	00006    4463    4759  +2   0.985
+	00007    6785    6582  -3   1.033
+	00008    6862    7020  +1   0.915
+	00009    7300    7488  +1   0.900
+	00010    7463    7570  +2   0.912
+	00011    8399    8527  +2   1.044
+	00012   10652   10545  -3   0.895
+	00013   12170   12066  -3   1.108
+	00014   13891   13748  -2   0.998
+	00015   14157   14044  -1   1.026
+	00016   15285   15410  +3   0.928
+	00017   15829   15704  -2   0.949
+
+	....
+    ]]></help>
+    <expand macro="citation" />
+</tool>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/glimmer_wo_icm.py	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,77 @@
+#!/usr/bin/env python
+"""
+Input: DNA Fasta File
+Output: Tabular
+Return Tabular File with predicted ORF's
+Bjoern Gruening
+"""
+import os
+import shutil
+import subprocess
+import sys
+import tempfile
+
+from glimmer2seq import glimmer2seq
+
+
+def main():
+    genome_seq_file = sys.argv[1]
+    outfile_classic_glimmer = sys.argv[2]
+    outfile_ext_path = sys.argv[3]
+    oufile_genes = sys.argv[8]
+
+    tag = 'glimmer_non_knowlegde_based_prediction'
+    tempdir = tempfile.gettempdir()
+
+    trainingset = os.path.join(tempdir, tag + ".train")
+    icm = os.path.join(tempdir, tag + ".icm")
+
+    longorfs = tempfile.NamedTemporaryFile()
+    trainingset = tempfile.NamedTemporaryFile()
+    icm = tempfile.NamedTemporaryFile()
+
+    # glimmeropts = "-o0 -g110 -t30 -l"
+    glimmeropts = "-o%s -g%s -t%s" % (sys.argv[4], sys.argv[5], sys.argv[6])
+    if sys.argv[7] == "true":
+        glimmeropts += " -l"
+
+    """
+        1. Find long, non-overlapping orfs to use as a training set
+    """
+    subprocess.Popen(["long-orfs", "-n", "-t", "1.15",
+                      genome_seq_file, "-"], stdout=longorfs,
+                     stderr=subprocess.PIPE).communicate()
+
+    """
+        2. Extract the training sequences from the genome file
+    """
+    subprocess.Popen(["extract", "-t",
+                      genome_seq_file, longorfs.name], stdout=trainingset,
+                     stderr=subprocess.PIPE).communicate()
+
+    """
+        3. Build the icm from the training sequences
+    """
+
+    # the "-" parameter is used to redirect the output to stdout
+    subprocess.Popen(["build-icm", "-r", "-"],
+                     stdin=open(trainingset.name), stdout=icm,
+                     stderr=subprocess.PIPE).communicate()
+
+    """
+        Run Glimmer3
+    """
+    subprocess.Popen(["glimmer3", glimmeropts,
+                      genome_seq_file, icm.name, os.path.join(tempdir, tag)],
+                     stdout=subprocess.PIPE, stderr=subprocess.PIPE).communicate()
+
+    if outfile_classic_glimmer.strip() != 'None':
+        shutil.copyfile(os.path.join(tempdir, tag + ".predict"), outfile_classic_glimmer)
+    if outfile_ext_path.strip() != 'None':
+        shutil.copyfile(os.path.join(tempdir, tag + ".detail"), outfile_ext_path)
+
+    glimmer2seq(os.path.join(tempdir, tag + ".predict"), genome_seq_file, oufile_genes)
+
+
+if __name__ == "__main__":
+    main()
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/macros.xml	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,18 @@
+<?xml version="1.0"?>
+<macros>
+    <xml name="requirements">
+        <requirements>
+            <requirement type="package" version="3.02">glimmer</requirement>
+            <requirement type="package" version="1.70">biopython</requirement>
+            <yield/>
+        </requirements>
+    </xml>
+
+    <token name="@WRAPPER_VERSION@">3.02</token>
+
+    <xml name="citation">
+        <citations>
+            <citation type="doi">10.1093/bioinformatics/btm009</citation>
+        </citations>
+    </xml>
+</macros>
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/coordTest.txt	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,17 @@
+00001   40137      52  +2   0.892
+00002    1319    1095  -3   0.654
+00003    1555    1391  -2   0.793
+00004    1953    2066  +3   1.078
+00005    2045    2146  +2   0.919
+00006    4463    4759  +2   0.985
+00007    6785    6582  -3   1.033
+00008    6862    7020  +1   0.915
+00009    7300    7488  +1   0.900
+00010    7463    7570  +2   0.912
+00011    8399    8527  +2   1.044
+00012   10652   10545  -3   0.895
+00013   12170   12066  -3   1.108
+00014   13891   13748  -2   0.998
+00015   14157   14044  -1   1.026
+00016   15285   15410  +3   0.928
+00017   15829   15704  -2   0.949
Binary file test-data/extractTestOutput.fasta has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/glimmer.gff	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,62 @@
+##gff-version 3
+
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	897	2918	.	+	.	frame=+3;score=3.19
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	144	938	.	-	.	frame=-3;score=2.86
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	7237	7368	.	-	.	frame=-1;score=2.50
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	10347	11945	.	+	.	frame=+3;score=2.93
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	12110	12238	.	-	.	frame=-2;score=6.22
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	13067	15088	.	-	.	frame=-2;score=2.95
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	15045	16529	.	+	.	frame=+3;score=3.36
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	20276	21385	.	-	.	frame=-2;score=2.90
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	21382	23037	.	-	.	frame=-1;score=2.93
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	23031	24797	.	+	.	frame=+3;score=2.92
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	27115	27291	.	-	.	frame=-1;score=1.92
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	28556	28960	.	+	.	frame=+2;score=2.51
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	29040	30026	.	+	.	frame=+3;score=0.40
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	32942	33151	.	-	.	frame=-2;score=1.06
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	34754	38242	.	-	.	frame=-2;score=2.97
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	43100	43300	.	-	.	frame=-2;score=6.70
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	43402	43497	.	+	.	frame=+1;score=0.97
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	44963	45157	.	-	.	frame=-2;score=1.68
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	46852	47430	.	-	.	frame=-1;score=0.78
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	48354	51314	.	-	.	frame=-3;score=2.96
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	55069	55329	.	-	.	frame=-1;score=1.43
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	56431	59457	.	-	.	frame=-1;score=2.96
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	59669	60169	.	+	.	frame=+2;score=2.15
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	60516	60881	.	+	.	frame=+3;score=0.34
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	60959	62032	.	-	.	frame=-2;score=2.90
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	61997	62821	.	+	.	frame=+2;score=3.73
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	62922	66395	.	-	.	frame=-3;score=2.97
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	70996	71166	.	+	.	frame=+1;score=0.90
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	81835	81960	.	-	.	frame=-1;score=1.90
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	87355	89982	.	+	.	frame=+1;score=2.96
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	90028	90390	.	+	.	frame=+1;score=1.66
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	91917	92009	.	+	.	frame=+3;score=0.65
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	93307	93540	.	-	.	frame=-1;score=1.81
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	94568	96379	.	-	.	frame=-2;score=2.94
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	96383	96523	.	-	.	frame=-2;score=0.37
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	99628	100467	.	+	.	frame=+1;score=3.23
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	98455	99645	.	-	.	frame=-1;score=2.91
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	100811	102931	.	+	.	frame=+2;score=2.95
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	103074	105521	.	+	.	frame=+3;score=2.96
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	105847	106200	.	-	.	frame=-1;score=0.32
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	108069	108365	.	-	.	frame=-3;score=4.89
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	109947	110498	.	-	.	frame=-3;score=0.90
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	110791	110907	.	-	.	frame=-1;score=2.13
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	116538	117071	.	-	.	frame=-3;score=0.81
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	117443	117733	.	-	.	frame=-2;score=0.01
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	118399	118776	.	-	.	frame=-1;score=3.59
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	119582	119740	.	-	.	frame=-2;score=0.41
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	123152	123484	.	+	.	frame=+2;score=2.86
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	123767	123925	.	+	.	frame=+2;score=0.89
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	124906	126459	.	-	.	frame=-1;score=2.93
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	126704	128992	.	-	.	frame=-2;score=2.95
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	129011	129178	.	-	.	frame=-2;score=1.85
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	130337	132172	.	-	.	frame=-2;score=2.94
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	134993	136987	.	+	.	frame=+2;score=2.94
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	137245	137523	.	-	.	frame=-1;score=1.14
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	137825	140512	.	-	.	frame=-2;score=2.96
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	140766	142487	.	-	.	frame=-3;score=2.94
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	142484	143056	.	-	.	frame=-2;score=0.89
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	143099	143578	.	-	.	frame=-2;score=0.42
+gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence	glimmer_prediction	predicted_gene	144230	147016	.	-	.	frame=-2;score=2.96
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/glimmer_w_icm_trans-table-11_genomic.dout	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,1391 @@
+Command:  glimmer3 -o 50 -g 90 -t 30 -z 11 -A atg,gtg,ttg -l /tmp/tmpubrxoL/files/000/dataset_1.dat /tmp/tmpubrxoL/files/000/dataset_2.dat glimmer_output
+
+Sequence file = /tmp/tmpubrxoL/files/000/dataset_1.dat
+Number of sequences = 1
+ICM model file = /tmp/tmpubrxoL/files/000/dataset_2.dat
+Excluded regions file = none
+List of orfs file = none
+Input is NOT separate orfs
+Independent (non-coding) scores are used
+Circular genome = false
+Truncated orfs = false
+Minimum gene length = 90 bp
+Maximum overlap bases = 50
+Threshold score = 30
+Use first start codon = false
+Translation table = 11
+Start codons = atg,gtg,ttg
+Start probs = 0.333,0.333,0.333
+Stop codons = taa,tag,tga
+GC percentage = 70.9%
+Ignore score on orfs longer than 1738
+
+
+>gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+Sequence length = 147347
+
+           ----- Start -----           --- Length ----  ------------- Scores -------------
+ ID  Frame   of Orf  of Gene     Stop   of Orf of Gene      Raw InFrm F1 F2 F3 R1 R2 R3 NC
+        +1      289      316      417      126      99   -12.44     0  0  0  0  -  0  0 99
+        +1      418      706      894      474     186   -12.50     0  0  0 72  -  0  0 26
+        +2      203      755      907      702     150    -7.78     0  -  0  4  -  0  5 89
+        -2      934      478      245      687     231   -16.05     0  -  0  0  -  0  0 99
+        -1     1005      960      808      195     150   -10.87     0  -  -  0  0  -  0 99
+        +1      895      904     1029      132     123   -21.92     0  0  -  0  -  -  0 99
+        +2     1211     1316     1450      237     132    -9.27     0  0  0  0  0  0 99  0
+        -2     1513     1462     1295      216     165   -13.99     0  0  -  0  0  0 99  0
+        -1     1587     1506     1006      579     498   -11.27     0  -  -  0  0  -  1 98
+        +1     1132     1774     2016      882     240   -10.77     0  0  0  0  0  0 99  0
+        -2     2221     1633     1514      705     117   -17.27     0  0  0  0  -  0  0 99
+        +2     1451     2192     2287      834      93    -3.86     2  0  2 11  0  -  5 80
+        +2     2288     2414     2524      234     108   -14.85     0  0  0  0  0  0 98  0
+        +1     2386     2521     2676      288     153   -10.44     0  0  0  0  -  0 99  0
+        -2     2704     2332     2222      480     108    -8.27     0  -  - 83  0  0  7  9
+        +1     2677     2713     2865      186     150   -16.16     0  0  0 42  -  0  4 53
+0001    +3      174      183     2918     2742    2733    -2.60     0  -  -  0  -  - 99  0
+        +2     2525     2828     2947      420     117    -8.18     0  -  0  -  -  0  0 99
+0002    -3     3062     2777      144     2916    2631    -1.16     0  0  -  -  0  -  0 99
+        -2     3301     2845     2705      594     138    -6.29     0  0  0 62  -  0  0 37
+        +2     2948     3149     3352      402     201   -10.20     0  0  0  0  0  -  - 99
+        +1     2866     3262     3363      495      99    -8.25     0  0  - 13  0  -  3 83
+        -1     3396     3171     2995      399     174    -6.74     0  0  0  -  0  0  - 99
+        -2     3403     3400     3302       99      96   -10.07     0  -  - 95  0  0  1  2
+        -3     3419     3407     3195      222     210    -5.41     0  -  -  1  -  -  0 98
+        -1     3810     3810     3553      255     255   -10.41     0  -  0  0  0  - 99  0
+        +3     3102     3750     3866      762     114     0.43     0  0  0  0  -  0 98  0
+        +3     3867     4098     4313      444     213    -6.66     0  0  0  0  - 38  0 60
+        -3     4343     3824     3420      921     402    -0.79     4  -  0  0  -  -  4 95
+        +2     3353     3869     4357     1002     486     1.19     5  0  5  -  - 94  -  0
+        +1     3754     4183     4413      657     228    -5.38     0  0  -  -  0  0  - 99
+        -1     4416     4254     4105      309     147    -9.43     0 27  0  0  0 10  0 60
+        -2     4438     4081     3641      795     438    -3.03     0  -  0  -  -  0  0 99
+        +1     4516     4519     4635      117     114   -13.75     0  0  -  0  0  0  1 98
+        +1     4636     4651     4755      117     102   -11.88     0  0  - 51  2  0  0 45
+        +1     4756     4789     4884      126      93   -12.88     0  0  - 57  0  -  6 35
+        +1     4885     5017     5109      222      90   -13.07     0  0  0 99  -  0  0  0
+        -2     5323     5050     4859      462     189   -13.21     0  -  - 83  0  0  0 16
+        +1     5110     5227     5376      264     147   -10.43     0  0  - 17  0  -  0 81
+        +3     4314     5430     5606     1290     174    -8.42     0  -  -  0  -  0  0 99
+        -3     5699     4442     4344     1353      96   -16.33     0  -  -  3  -  0  0 96
+        -2     5710     5560     5339      369     219   -19.46     0  -  -  0  -  0  0 99
+        +3     5607     5631     5786      177     153   -14.74     0  0  0  0  0  -  - 99
+        -3     5876     5849     5715      159     132   -13.78     0  6  0  -  0  -  0 92
+        +2     5540     5840     5956      414     114    -7.11     0 99  0  0  0  0  -  0
+        -3     6170     6080     5922      246     156   -12.41     0  6  -  -  0  -  0 93
+        +1     5596     5833     6183      585     348    -1.28     1  1  -  -  0  -  - 98
+        +2     5957     6044     6196      237     150   -13.96     0  -  0  0 41  -  - 58
+        -1     6366     5805     5617      747     186    -4.60     0  0  0  -  0  -  - 99
+        +1     6247     6304     6399      150      93   -15.50     0  0  0  0  - 66  - 33
+        -3     6500     6494     6354      144     138    -8.37     0  -  0  0  -  0  0 99
+        +2     6197     6200     6559      360     357    -9.78     0  -  0  0  -  -  - 99
+        +3     6036     6426     6566      528     138   -12.55     0  -  -  0  0  0  - 99
+        -2     6571     6460     6230      339     228    -6.11     0  -  0  0  -  0  - 99
+        +2     6560     6632     6760      198     126    -4.57     0  0  0  0  0  0  0 99
+        -1     6828     6486     6367      459     117   -11.09     0  -  2  0  0  0  0 97
+        +3     6567     6870     7016      447     144   -17.36     0  0  -  0  0  -  0 99
+        -3     7055     6722     6591      462     129    -6.81     0  0  0  0  0  0  0 99
+        -1     7155     7107     6829      324     276    -3.23     0  0  -  -  0  -  - 99
+        +1     6514     6934     7179      663     243    -5.08     0  0  -  -  -  -  - 99
+        +3     7125     7131     7247      120     114   -15.65     0  -  0  0  -  2  - 97
+        +2     6944     7136     7255      309     117   -10.52     0  -  0  -  -  0  - 99
+        -2     7291     7213     6950      339     261   -12.13     0  -  0  -  -  0  - 99
+0003    -1     7398     7368     7237      159     129     3.44    98  -  -  - 98  -  0  1
+        -3     7457     7295     7191      264     102   -12.20     0  -  -  -  -  0  0 99
+        -2     7525     7429     7334      189      93   -14.52     0  -  -  0  -  0  0 99
+        +3     7248     7380     7550      300     168    -9.53     0  -  -  0  -  -  - 99
+        +2     7526     7556     7780      252     222   -10.05     0  -  0  -  -  -  - 99
+        +2     7781     7787     7894      111     105   -15.90     0  -  0  0  0  0  0 99
+        +3     7644     7740     7940      294     198   -10.74     0  -  -  0  0  0  - 99
+        -2     7993     7951     7673      318     276   -14.08     0  -  -  -  0  0  - 99
+        -1     8067     7737     7588      477     147    -8.85     0  -  0  -  0  -  - 99
+        +1     7798     7918     8139      339     219    -9.52     0  0  1  -  -  -  0 98
+        -1     8262     8190     8068      192     120   -14.54     0  -  0  0  0  0  0 99
+        +2     7895     8147     8278      381     129    -5.46     0  0  0  0  -  2  0 97
+        -3     8279     7934     7773      504     159    -8.91     0  -  -  0  0  0  0 99
+        +3     7941     8220     8342      399     120   -19.30     0  -  -  0  -  1  - 98
+        -1     8400     8385     8263      135     120   -15.34     0  -  -  -  0  0  - 99
+        -1     8685     8571     8401      282     168   -14.38     0  0  0  0  0  0  - 99
+        +3     8343     8673     8771      426      96   -17.17     0  0  2  0  -  0  0 97
+        -3     8885     8798     8451      432     345   -11.88     0  -  0  -  -  0  0 99
+        +2     8279     8861     8965      684     102   -18.08     0  0  0  0  0  0  - 99
+        +1     8830     8896     9006      174     108   -15.65     0  0  -  -  0  0  - 99
+        -2     9076     8263     7994     1080     267    -0.85     1  - 83  0  -  1  0 14
+        -1     9483     8790     8686      795     102   -12.36     0  -  0  -  0  0  0 99
+        -2     9571     9427     9290      279     135    -9.65     0  0 57  0  0  0  6 36
+        +3     9081     9201     9602      519     399    -0.17    22  0  0 22  -  - 31 45
+0004    -3     9656     9575     9039      615     534     0.16    70  0  0  -  -  - 70 29
+        +2     8966     9524     9664      696     138    -7.28     0  0  0  -  0  -  - 99
+        +2     9665     9719     9829      162     108   -12.97     0  4  0  0 32  -  - 63
+        -3     9887     9875     9753      132     120    -8.52     0  0  -  0  0  -  0 98
+        +1     9007     9685     9906      897     219    -3.64     0  0  -  - 35  -  - 64
+        -1     9912     9651     9484      426     165    -8.05     0  0  0  -  0  -  0 99
+        +3     9723     9807     9938      213     129    -6.37     0  -  -  0  -  -  - 99
+        -2     9982     9958     9821      159     135    -2.76     2  -  -  -  -  2  - 97
+        -3    10040     9986     9888      150      96    -9.57     0  -  0  -  - 84  0 15
+        +2     9830     9929    10084      252     153   -13.60     0  3  0  -  0  -  - 96
+        -1    10209    10197     9913      294     282    -9.64     0  0  -  -  0  -  - 99
+        -2    10222    10159    10067      153      90    -5.61     0  0  -  0  0  0  0 99
+        -3    10340    10181    10041      297     138   -10.51     0  0  -  -  0  -  0 99
+        -1    10401    10374    10264      135     108   -10.75     0  0  0  0  0  -  - 99
+        +1     9907    10183    10419      510     234   -12.07     0  0  0  -  -  -  - 99
+        +2    10178    10322    10444      264     120   -12.05     0  -  0 97  -  -  -  2
+        -2    10486    10471    10361      123     108   -11.14     0  -  - 93  -  0  0  6
+        +1    10426    10462    10572      144     108    -6.74     0  0  -  5  -  -  0 94
+        +1    10573    10627    10731      156     102    -3.73     0  0  - 87 12  0  0  0
+        +1    10876    10909    11001      123      90    -4.86     0  0  - 13 48  0  0 37
+0005    -1    11013    10986    10468      543     516     0.70    96  -  -  1 96  -  0  2
+        +1    11029    11110    11238      207     126   -10.47     0  0  0  0  0  0  0 99
+        -2    11440    10756    10529      909     225   -14.23     0  -  -  0 40  0  0 59
+        +1    11239    11371    11469      228      96    -4.69     1  1  0 16  3  -  0 79
+        -2    11833    11776    11525      306     249   -12.23     0  0  -  0  1  0  0 97
+        -3    11894    10529    10356     1536     171   -10.42     0  -  - 98  -  -  0  1
+0006    +3    10203    10347    11945     1740    1596    -1.83     0  0  -  0  0  -  - 99
+        +2    11879    11978    12073      192      93    -4.30     0  2  0  -  0 61  - 35
+        +1    11470    12001    12120      648     117    -4.07     0  0  -  -  0  -  - 98
+        -1    12189    11226    11014     1173     210    -2.85     0  -  -  0  0  0  0 99
+        +3    12096    12174    12266      168      90   -10.28     0  0  -  0  - 99  0  0
+        +3    12267    12285    12458      189     171    -4.74     0  -  0  0  -  0  - 99
+        +2    12209    12503    12598      387      93    -3.02     5  0  5  0  1  3  1 87
+0007    -2    12676    12238    12110      564     126     7.26    99  -  -  0  - 99  0  0
+        -3    12713    12680    12402      309     276    -9.35     0  -  -  -  -  0  0 99
+        +3    12459    12543    12764      303     219    -7.41     0  -  -  0  -  -  - 99
+        -2    12832    12778    12677      153      99   -16.52     0  -  -  -  0  0  - 99
+        +2    12710    12779    12916      204     135    -5.60     0  -  0  -  -  -  - 99
+        +1    12889    12913    13005      114      90    -4.16     2  2  0  0 11  4  0 81
+        +2    12917    13121    13507      588     384    -7.23     0  -  0  3  -  0 96  0
+        -1    14547    14259    13831      714     426    -4.31     0 23  0  0  0  0  0 76
+        -1    14775    14700    14548      225     150    -6.10     0  0  0 15  0  0 84  0
+        +1    13543    14908    15006     1461      96    -5.75     0  0  0 20  0  0  1 77
+        +2    14366    14801    15037      669     234    -7.10     0  -  0  0  -  0  3 96
+0008    -2    15154    15112    13067     2085    2043    -7.94     0  0  0  0  -  0 99  0
+        -1    15279    15219    15109      168     108   -15.51     0  0  0 32  0  -  5 61
+        +1    15067    15070    15357      288     285   -13.38     0  0  0 90  -  -  5  3
+        -2    15499    15301    15158      339     141    -7.93     0  0  0 69  -  0  4 25
+        +1    15361    15412    15759      396     345    -3.55     0  0 97  0  0  -  2  0
+        -1    15993    15705    15322      669     381    -6.78     0  -  -  0  0  - 95  4
+        +2    15416    15914    16114      696     198    -7.67     0  -  0  0  -  0  0 99
+        -2    16204    15676    15500      702     174    -2.81     0  0 97  0  0  0  2  0
+        +1    16060    16144    16257      195     111   -15.80     0  0  5  0  0  -  0 94
+0009    +3    12831    12882    16529     3696    3645    -3.90     0  0  3  0  0  0  1 95
+0010    -3    16595    16316    12822     3771    3492    -0.87     1  -  -  -  -  -  1 98
+        -2    16642    16429    16331      309      96    -5.22     0  0  0  0  -  0  0 99
+        +3    16542    16551    16682      138     129    -2.40     0  4  0  0 93  -  -  1
+        +1    16327    16534    16818      489     282    -0.65    11 11  0  - 19  -  - 69
+        -1    16863    16746    16402      459     342    -6.56     0  0  0  -  0  -  - 99
+        -2    16939    16867    16700      237     165   -16.35     0  -  0  -  0  0  0 99
+        +3    16728    16809    17009      279     198   -10.48     0  -  0  0  -  -  0 99
+        -3    17057    16808    16689      366     117   -16.34     0  0  0  -  0  -  0 99
+0011    +3    17010    17052    17144      132      90    -0.53    38  -  0 38  0  0  - 61
+        -1    17268    17091    16993      273      96   -10.32     0  0 14  -  0  0  - 85
+        +2    16115    17243    17365     1248     120    -2.29     6  -  6  0  -  0  0 93
+        -3    17483    17408    17241      240     165   -11.91     0  -  -  -  -  0  0 99
+        +2    17378    17429    17527      147      96    -2.54     5 32  5  0  0  0  - 60
+        +3    17247    17280    17534      285     252   -12.81     0 10  -  0  -  0  - 89
+        +2    17528    17549    17680      150     129    -8.62     0  0  0  0  0  0  - 99
+        +1    17275    17515    17724      447     207    -3.57     0  0  -  -  0  0  - 99
+        -2    17770    17404    17210      558     192    -6.12     0  -  -  -  -  0  - 99
+        +3    17535    17709    17888      351     177    -9.11     0  -  -  0  0  -  0 99
+        +1    17749    17890    18015      264     123    -6.56     0  0  -  0  3  -  0 96
+        -3    18077    17756    17607      468     147    -7.62     0  -  -  0  0  0  0 99
+        +3    17889    17982    18137      246     153    -9.16     0  -  0  0  0  0  - 99
+        -1    18243    17442    17296      945     144    -6.61     0 15  -  0  0  2  0 81
+        -2    18376    18013    17909      465     102   -13.57     0  0  -  0 98  0  0  0
+        +2    17951    18281    18415      462     132   -20.58     0  0  0  0  -  -  0 99
+        +1    18112    18292    18537      423     243   -14.81     0  0  -  0  -  -  0 99
+        -3    18551    18530    18279      270     249   -14.75     0  0  -  0  -  -  0 99
+        +3    18138    18246    18644      504     396   -14.96     0  -  -  0  -  -  - 99
+        -2    18661    18619    18377      282     240    -3.99     0  -  -  0  -  0  - 99
+        -3    18836    18653    18552      282      99    -8.58     0 96  0  -  0  0  0  2
+        +2    18416    18833    18973      555     138   -13.48     0  0  0  0  0  0  - 99
+        -3    18995    18971    18837      156     132    -8.60     0  0  0  0  0  0  0 99
+        -1    19023    18711    18472      549     237    -6.32     0  -  3  -  0  -  - 96
+        -2    19051    18808    18662      387     144   -12.74     0  0  0 18  1  0  0 79
+        +1    18538    18970    19062      522      90   -10.42     0  0  0  0  -  -  - 99
+        +2    18974    19043    19153      177     108    -3.28     0  -  0  0  0  - 96  3
+        +1    19078    19150    19245      165      93   -12.66     0  0  - 14  0  0  0 85
+0012    +3    18666    19242    19361      693     117     0.51    62  0  - 62  1  0  0 35
+        +1    19246    19252    19371      123     117    -8.89     0  0  -  -  3  0  0 96
+        +2    19499    19514    19621      120     105   -12.19     0  0  0  0  1  -  0 97
+        -3    19694    19097    18996      696      99    -4.82     0  -  0  0  -  -  0 99
+        +3    19494    19758    19883      387     123     0.69     0  0  -  0 99  -  -  0
+        -3    19994    19988    19809      183     177    -9.69     0  0  -  - 98  -  0  0
+        +1    19372    19906    20079      705     171    -1.39     5  5  0  0 42  0  - 52
+        -1    20205    19140    19024     1179     114   -12.42     0  -  6  0  0  - 58 35
+        -2    20275    20083    19874      399     207    -8.43     0  -  -  - 64  0  - 35
+        +3    19884    20343    20444      558      99    -7.90     0  - 20  0  0  0 45 34
+        +3    20478    20589    20702      222     111    -7.21     0  0  0  0  0  0  3 95
+        +1    20593    20650    20754      159     102   -12.16     0  0  1  -  0  0 98  0
+        +1    20785    20800    20892      105      90    -8.04     0  0 89  0  -  0  0 10
+        -3    21473    20153    19995     1476     156    -9.30     0  -  0  0  3  0  0 96
+        +3    20703    21399    21503      798     102   -11.04     0 63  0  0  0  4  - 31
+0013    +2    19910    20378    21781     1869    1401     1.14    99  - 99  -  -  0  -  0
+        +2    21920    21977    22099      177     120    -8.11     0 99  0  -  0  0  0  0
+        +2    22142    22316    22531      387     213    -2.03     0 99  0  -  0  0  -  0
+        +2    22532    22691    22789      255      96    -9.18     0  1  0  0  0  0  0 98
+0014    -2    22909    22348    20276     2631    2070    -3.10     0  - 99  -  -  0  0  0
+0015    +1    21358    21418    23106     1746    1686     0.15    93 93  -  -  0  -  -  6
+        +1    23107    23260    23433      324     171   -16.12     0  0  0 44  0  0  0 55
+0016    -1    23451    23427    21382     2067    2043    -6.96     0 98  0  -  0  1  -  0
+        -3    23498    22838    22689      807     147    -7.76     0  0  -  -  0  0  0 99
+        +2    23462    23474    23602      138     126    -7.84     0  0  0  0  0  0  - 99
+        -2    23659    23452    23249      408     201   -17.44     0  -  - 96  0  0  0  3
+        +1    23434    23596    23688      252      90    -4.87     0  0  - 99  0  -  0  0
+        +1    23773    23803    23922      147     117    -6.78     0  0  -  0 89  0  0  9
+        +1    23923    23944    24054      129     108    -6.63     0  0  -  7  0  -  0 92
+        -1    24633    24237    23452     1179     783    -2.82     0  -  -  0  0  -  - 99
+        -3    24719    23789    23592     1125     195    -2.65     0  -  - 99  0  -  0  0
+0017    +3    22695    22827    24797     2100    1968    -2.29     0  0  -  0  -  0  - 99
+        +1    24214    24706    24816      600     108    -7.65     0  0  -  -  0  0  - 99
+        -2    24904    24787    24512      390     273   -13.82     0  0  -  0  -  0  - 99
+        -3    24923    24908    24798      123     108   -24.86     0  -  -  0  0  0  0 99
+        +2    24935    24950    25120      183     168   -11.13     0 54  0  0  5  -  0 39
+        -3    25124    25046    24924      198     120   -16.78     0  0  -  0  0  -  0 99
+        +3    24798    24813    25253      453     438   -11.90     0  8  -  0  0  -  - 91
+        -1    25485    24831    24697      786     132    -7.02     0  -  -  -  0  0  - 99
+        -2    25534    25174    24980      552     192    -9.09     0 68  -  0  0  0  - 31
+        +1    24817    24958    25551      732     591    -4.29     0  0  -  -  -  -  - 99
+        -3    25601    25562    25428      171     132   -13.20     0  -  0  -  -  -  0 99
+        -3    25799    25733    25602      195     129    -7.87     0  0  2  0  0  -  0 97
+        -1    25839    25710    25591      246     117    -8.70     0  0  0  0  0  -  - 99
+        -2    25858    25759    25613      243     144    -3.29     0  0  4  0  0  0  0 94
+        -3    25940    25922    25800      138     120   -16.95     0 11  0  -  -  -  0 88
+0018    +1    25804    25867    26025      219     156    -0.38    35 35  0  -  1  0  - 62
+        +2    25340    25991    26125      783     132   -12.33     0  -  0  -  0  0  - 99
+        +1    26026    26173    26274      246      99    -2.90     5  5  0  0  0  0  0 93
+        -1    26370    25992    25840      528     150    -5.24     0 13  0  -  0  -  - 86
+        +3    26058    26487    26618      558     129    -8.71     0 10  0  0  0  0  0 89
+        -2    26659    25963    25859      798     102    -6.89     0 41  0  -  1  0  - 57
+        +1    26323    26362    26727      402     363    -6.80     0  0  0  -  -  -  0 99
+        -3    26813    26309    26139      672     168   -10.84     0  -  0  0  0  0  0 99
+        +3    26619    26769    26879      258     108    -9.15     0  0  0  0  -  -  - 99
+        +2    26126    26798    26890      762      90   -17.94     0  0  0  -  0  -  - 99
+        -1    27114    27093    26773      339     318    -9.73     0  0  -  -  0  -  - 99
+        +2    27011    27011    27142      129     129    -7.86     0 92  0  -  -  -  -  7
+0019    +1    26728    27031    27147      417     114     0.62    66 66  -  -  -  -  - 33
+        -2    27214    27166    27041      171     123    -8.40     0  -  -  -  -  0  - 99
+        +1    27151    27376    27477      324      99    -4.43     0  0  0  0 95  0  0  3
+0020    -1    27489    27291    27115      372     174     2.59    98  -  -  0 98  -  0  1
+        +3    27105    27420    27587      480     165    -7.06     0  -  -  0  -  0  0 99
+        -2    27640    27352    27236      402     114   -20.04     0  0  -  0 78  0  0 21
+        +1    27478    27565    27675      195     108   -18.55     0  0  -  -  0  -  0 99
+        +3    27645    27672    27815      168     141   -12.87     0  -  -  0  -  -  0 99
+        -3    27974    27218    27096      876     120   -11.19     0  -  -  -  -  0  0 99
+        +1    27910    27931    28113      201     180    -0.56    27 27  0  -  0  0  - 72
+        +2    27812    28025    28129      315     102    -3.86     2  -  2  -  0  0  - 97
+        -2    28147    28111    27773      372     336    -2.08     0  -  -  -  -  0  - 99
+        -1    28173    27957    27778      393     177    -5.57     0  -  -  -  0 90  0  9
+        +2    28130    28136    28246      114     108    -4.82     0  0  0  0  -  -  0 98
+        -3    28250    28151    28047      201     102    -7.02     0  -  -  -  0  0  0 99
+        +1    28114    28303    28410      294     105    -7.71     0  0  0  9  -  0  0 89
+        -2    28477    28399    28148      327     249    -3.62     0  0  -  0  -  0  - 99
+        +3    28140    28224    28481      339     255    -4.79     0  -  -  0  -  0  - 99
+        -3    28736    28364    28251      483     111    -9.53     0  6  -  0  0  0  0 92
+        +3    28575    28665    28766      189      99   -10.20     0  - 81  0  0  0  - 18
+        -1    28839    28542    28396      441     144   -12.18     0  -  -  -  0  -  0 99
+0021    +2    28469    28556    28960      489     402     2.80    99  - 99  -  -  0  -  0
+        +1    28789    28981    29115      324     132    -2.03     0  0  0 73 22  0  0  3
+        +1    29281    29341    29484      201     141    -9.83     0  0  0 43  0  0  0 56
+        -2    29623    28843    28478     1143     363   -11.60     0  - 99  -  0  0  -  0
+        +1    29485    29566    29688      201     120    -4.27     0  0  - 97  0  -  0  2
+        -2    29917    29917    29624      291     291    -8.18     0  -  - 99  0  0  0  0
+        +2    29657    29873    29983      324     108   -13.91     0  0  0  0  0  -  0 99
+        -3    29990    28943    28851     1137      90    -4.84     0  0  0 15 82  0  0  1
+0022    +3    28797    28860    30026     1227    1164     0.65    99  -  - 99  0  -  -  0
+        +1    29689    29806    30093      402     285    -3.27     0  0  -  -  0  -  - 99
+        -2    30121    30043    29948      171      93    -8.62     0  3  -  -  1  0  - 94
+        +2    29984    30053    30169      183     114    -9.52     0  -  0  0 14  -  - 85
+        +1    30094    30160    30252      156      90   -11.54     0  0  -  1  0  0  0 98
+        -1    30279    29391    28840     1437     549    -0.77     0  -  - 98  0  0  -  1
+        -2    30337    30283    30122      213     159   -11.21     0  -  -  0  0  0  0 99
+        +3    30027    30249    30377      348     126   -13.24     0  -  -  0  -  -  0 99
+        -3    30449    30185    30069      378     114    -6.34     0  -  -  1 65  -  0 33
+        -3    30596    30572    30450      144     120   -10.03     0  0  0  -  -  0  0 99
+        +1    30358    30487    30600      240     111   -15.34     0  0  0  -  -  0  0 99
+        -2    30634    30442    30338      294     102   -12.60     0  -  0  -  0  0  0 99
+0023    -3    30725    30704    30597      126     105    -0.37    40  -  0  0  -  - 40 59
+        -2    30826    30739    30635      189     102    -5.84     0  -  0  2  0  0  - 97
+        -1    30861    30720    30604      255     114    -9.50     0  -  0  0  0  - 64 34
+        +2    30335    30518    30919      582     399    -9.92     0  -  0  -  -  -  - 99
+        -3    30929    30827    30726      201      99    -7.67     0  0  0  0  0  0  0 99
+        +1    30904    30973    31107      201     132    -9.84     0  0  0  0  8  0  0 91
+        +3    30597    31089    31229      630     138   -11.03     0  -  0  0  0  -  0 99
+        -1    31254    30963    30862      390      99    -5.94     0  -  -  0  0  -  - 99
+        -3    31283    31055    30930      351     123    -7.33     0  0  0  1  1  0  0 96
+        +1    31108    31198    31383      273     183    -6.75     0  0  0  -  -  -  - 99
+        +2    30920    31118    31429      507     309    -7.35     0  -  0  -  -  -  - 99
+        -3    31451    31400    31284      165     114    -6.55     0  -  0  0  0  0  0 99
+        -1    31587    31368    31255      330     111    -7.99     0  0  0  0  0  0  - 99
+        -1    31725    31698    31588      135     108   -14.93     0  0  0  -  0 41  0 58
+        +2    31430    31757    31849      417      90    -2.13    13  0 13  -  0  0  - 86
+        +2    31850    31850    32008      156     156    -5.35     0  0  0  0  0  0  5 94
+        -2    32011    31333    31226      783     105    -8.26     0  0  0  0  -  0  - 98
+        +1    31537    32014    32124      585     108    -2.29     7  7  0  -  0 11  0 80
+        +2    32009    32021    32137      126     114    -6.99     0  -  0  -  0  1  0 98
+        -3    32141    32015    31791      348     222    -6.37     0  0  -  -  0  0  0 99
+        -1    32166    32031    31726      438     303    -7.69     0  0  -  -  0  -  - 99
+        +3    32112    32286    32393      279     105   -13.92     0  0 36  0  0  1  0 62
+        -2    32470    32209    32012      456     195   -12.36     0  -  -  -  -  0  - 99
+        -1    32505    32340    32191      312     147   -20.69     0  0  0  0  0  0  0 99
+        -1    32631    32601    32506      123      93   -12.30     0  -  0  0  0 37  - 62
+0024    -2    32785    32590    32471      312     117     0.10    52  -  0  0  - 52  - 46
+        -3    32945    32732    32535      408     195    -7.85     0  -  0  0  -  0  0 99
+        +3    32427    32766    32960      531     192    -9.31     0  0 67  0  0  -  - 32
+        -1    33027    32835    32698      327     135    -8.56     0  1  0  0  0  -  0 97
+        +2    32159    33038    33139      978      99    -1.36    15  0 15  -  0 28  0 56
+        +1    32674    32968    33255      579     285    -3.46     0  0  -  -  - 11  0 88
+        +2    33140    33185    33349      207     162   -11.63     0  -  0  0  0  0  5 94
+        -3    33371    33329    32961      408     366    -7.30     0  -  -  -  -  0  0 99
+        -1    33411    33243    33028      381     213    -8.64     0  0  -  -  0  0  0 99
+0025    -2    33424    33151    32942      480     207     1.61    96  0  -  -  - 96  -  3
+        +1    33355    33436    33543      186     105    -2.12    10 10  -  0  -  -  0 89
+        +3    33084    33396    33638      552     240   -16.81     0  -  -  0  -  -  0 99
+        -3    33662    33650    33372      288     276   -15.72     0  -  -  -  -  -  0 99
+        -2    33670    33592    33482      186     108   -11.81     0  -  0  0  -  0  0 99
+        -1    33846    33795    33658      186     135    -5.91     0  -  0  0  0  -  - 99
+        -3    33920    33800    33663      255     135   -14.43     0  -  0  0  0  -  0 99
+        +3    33639    33813    33980      339     165   -13.62     0  -  0  0  -  0  - 99
+        +3    33987    33990    34085       96      93    -7.10     0  - 88  0  0  0  - 11
+        -1    34245    33978    33847      396     129    -9.56     0  -  0  0  0  0  - 99
+        -2    34363    33802    33671      690     129   -10.55     0  -  0  0  1  0  0 98
+        +3    34233    34314    34418      183     102    -2.61     7  -  0  7  0  -  - 92
+        -1    34440    34389    34276      162     111   -16.50     0  -  0  0  0  -  - 99
+        +2    33449    34310    34447      996     135   -17.33     0  -  0  -  -  -  - 99
+        -3    34508    34439    34323      183     114   -19.96     0  -  0  -  0  -  0 99
+        -2    34534    34531    34364      168     165   -14.83     0  0  -  -  -  0  - 99
+        +1    34363    34444    34593      228     147    -1.91     6  6  -  -  -  -  - 93
+        +1    34675    34780    34905      228     123    -2.87     2  2  0  -  - 31  0 66
+        -3    34997    34727    34590      405     135   -16.00     0  -  -  -  -  -  0 99
+        -1    35109    35001    34861      246     138    -3.46     0  -  0  -  0  0  0 99
+        -1    35748    35727    35533      213     192   -12.36     0  -  0  -  0  0 99  0
+        +1    35626    35737    35943      315     204   -15.96     0  0 95  0  -  0  -  4
+        +3    35712    35826    35963      249     135     1.38     0  -  0  0  0  0 99  0
+        -1    36222    36081    35818      402     261   -13.83     0  -  0  -  0  0 99  0
+        +3    36048    36129    36251      201     120    -7.80     0  -  0  0  -  0  - 99
+        -1    36348    36318    36223      123      93   -13.03     0  -  2  -  0  0 78 19
+        +3    36339    36477    36569      228      90    -4.45     0  - 25  0  0  0 74  0
+        -1    36750    36738    36349      399     387   -10.48     0  -  0  -  0  0 99  0
+        +3    36639    36768    36926      285     156     1.78     0  0  0  0  -  0 99  0
+        +3    37008    37017    37148      138     129    -8.62     0  -  0  0  -  0  0 99
+        +3    37218    37362    37457      237      93    -3.92     0  -  4  0  -  0 95  0
+        +3    37458    37467    37559       99      90    -7.95     0  -  4  0  -  0  8 86
+0026    -3    37697    37619    36318     1377    1299     1.24    99  -  0  -  -  0 99  0
+        -1    37719    37704    37609      108      93    -9.79     0  0  0  0  0  0  - 99
+        +3    37605    37932    38033      426      99   -13.69     0  0  0  0  - 14  - 85
+        +3    38034    38097    38210      174     111   -12.81     0  9 19  0  -  5  - 65
+0027    +2    34712    35060    38236     3522    3174    -1.50     0  -  0  -  -  0  - 99
+0028    -2    38272    38242    34754     3516    3486    -8.09     0  -  0  -  -  0  0 99
+        -3    38291    38255    38133      156     120   -16.21     0  0  -  -  0  0  0 99
+        -1    38379    38268    38107      270     159    -8.58     0  0  -  -  0  0  - 99
+        -3    38468    38399    38292      174     105   -13.97     0  0  -  -  -  -  0 99
+        +1    37915    38254    38484      567     228    -6.82     0  0  -  -  -  -  - 99
+        -1    38535    38520    38419      114      99    -7.45     0  -  0  0  0  0  - 99
+        -2    38560    38476    38351      207     123   -11.90     0  0  -  -  -  0  - 99
+        +3    38412    38481    38774      360     291    -8.93     0  -  0  0  -  -  - 99
+        +2    38423    38588    38785      360     195   -10.83     0  0  0  -  5  -  - 94
+        +1    38509    38683    38811      300     126    -5.02     0  0  -  - 63  0  0 36
+        -3    38849    38744    38634      213     108    -9.94     0  0  0 28 14  -  0 57
+        -2    38860    38830    38669      189     159    -8.04     0  -  -  -  7  0  0 92
+        +3    38775    38886    39011      234     123    -8.44     0  0  0  0  0  0  - 99
+        +1    38812    38956    39123      309     165   -10.70     0  0  0  -  0  0  0 99
+        -3    39218    39131    38889      327     240    -8.32     0  -  0  -  0  0  0 99
+0029    +1    39124    39154    39252      126      96    -0.55    37 37  0  -  0  0  - 61
+        -2    39262    39241    38861      399     378    -7.86     0  -  0  -  0  0  - 99
+        -1    39450    38724    38557      891     165    -3.50     0  0  0  0  0  -  - 99
+        +3    39192    39417    39596      402     177    -8.19     0  - 99  0  -  0  0  0
+        -1    39618    39612    39484      132     126    -8.00     0  - 37  -  0  0  0 62
+        -3    39629    39560    39222      405     336    -7.28     0  - 10  0  -  -  0 89
+        -2    39688    39511    39263      423     246    -2.49     0  - 27  0  -  0  0 72
+        +3    39597    39621    39719      120      96    -8.36     0  -  0  0  0  -  - 99
+        +1    39649    39664    39771      120     105    -6.07     0  0  0  -  -  -  0 99
+        -3    39773    39746    39630      141     114   -11.72     0  -  0  -  -  -  0 99
+        +3    39720    39840    39941      219      99    -8.78     0 32  0  0  - 27  - 38
+        -2    39976    39823    39689      285     132   -10.71     0  -  0  -  -  0  - 99
+        -1    40044    39987    39889      153      96    -5.96     0 67  0  -  0  -  - 31
+        +2    38786    39989    40114     1326     123   -13.23     0  1  0  0  -  0  - 98
+        -1    40242    40140    40045      195      93    -6.38     0 39  -  0  0 32  - 27
+        -2    40471    40195    39977      492     216    -5.77     0  0  -  0  -  0  - 99
+        -3    40490    40436    40263      225     171    -5.78     0  0  -  -  -  0  0 99
+        +2    40373    40514    40762      387     246    -2.68     0  0  0  0 22 68  0  9
+        -1    40773    40659    40429      342     228    -3.51     0  0  0  -  0  -  - 99
+        -3    40904    40682    40491      411     189    -2.28     0  5  0  0 53  1  0 38
+        +2    40763    40820    40930      165     108    -9.54     0 12  0  -  0  0  - 87
+        +1    39787    40507    41007     1218     498    -3.26     0  0  -  -  -  0  - 99
+        +3    40926    40953    41147      219     192   -14.46     0  -  0  0  0 30  - 68
+        +2    40943    40985    41164      219     177    -7.14     0  -  0  -  0 92  -  7
+        +2    41165    41177    41308      141     129    -9.75     0 74  0  - 16  0  -  8
+        +3    41292    41295    41432      138     135    -8.73     0 99  -  0  0  0  -  0
+        -1    41493    40908    40801      690     105    -5.79     0  0  0  -  0  0  0 98
+        +2    41309    41411    41509      198      96   -13.90     0  8  0  -  -  5  0 85
+        +1    41008    41284    41547      537     261    -0.87     9  9  -  -  -  0  - 90
+        -2    41596    40777    40472     1122     303    -2.11     0  0  -  0  0  0  - 99
+        +3    41448    41538    41663      213     123   -14.35     0  -  0  0  0  -  - 99
+        -1    41871    41637    41536      333      99    -3.40     3  -  0  0  3  -  - 96
+        +1    41578    41614    41877      297     261    -5.00     0  0  0  -  -  -  - 99
+        -3    41984    41885    41736      246     147    -7.26     0  -  0  -  -  -  0 99
+0030    +1    41971    42070    42213      240     141     0.20    56 56  0  0  -  0  0 42
+        +2    41510    42089    42262      750     171    -5.32     0  -  0  0  0  0  0 99
+        +3    41820    42177    42353      531     174    -6.09     0  -  -  0  0  0  0 99
+        +1    42328    42334    42462      132     126   -10.37     0  0  0  -  0  0  0 99
+        -3    42623    42158    41985      636     171    -5.37     0  9  0  0  -  0  0 90
+        -1    42702    42249    42085      615     162    -5.01     0  -  0  0  0  0  0 99
+        +3    42417    42498    42881      462     381    -9.83     0  0  0  0  - 99  -  0
+        -1    43050    42927    42799      249     126   -10.81     0  0  0  -  0 99  -  0
+        -3    43076    43010    42819      255     189   -11.43     0  0  0  -  0 99  0  0
+        -2    43099    41881    41786     1311      93    -1.61    18  -  0  -  - 18  0 80
+        +2    42338    43040    43333      993     291    -3.68     0  3  0  0  -  -  - 96
+        -1    43428    43221    43084      342     135    -5.41     0  0 75  0  0  -  0 24
+0031    -2    43486    43300    43100      384     198     7.36    99  0  0  0  0 99  -  0
+0032    +1    42463    43402    43497     1032      93     2.22    79 79  -  0  -  -  9 10
+        -3    43559    43490    43314      243     174    -4.11     0  0  -  0  -  0  0 99
+        -3    43802    43736    43599      201     135    -8.28     0  0  -  0  0  -  0 99
+        +3    43044    43617    43916      870     297    -9.61     0  0  -  0  0  -  - 99
+        +1    43597    43687    43938      339     249    -7.54     0  0  0  -  0  0  - 99
+        +3    43917    43980    44099      180     117   -10.28     0  -  1  0  0 36  0 62
+        -2    44107    43819    43664      441     153    -8.40     0  0  -  0  0  0  - 99
+        -3    44111    43907    43803      306     102    -5.66     0  2  0  0  0  0  0 96
+        -1    44115    43986    43540      573     444    -9.69     0  -  -  -  0  -  - 99
+        +2    43682    44057    44164      480     105    -8.51     0  0  0  -  -  -  - 99
+        -3    44396    44345    44112      282     231   -14.48     0  0  -  -  -  -  0 99
+        +1    44050    44101    44670      618     567    -4.73     0  0  -  -  -  -  - 99
+        +2    44387    44498    44686      297     186   -12.70     0  -  0  0  0  -  - 99
+        +3    44316    44583    44693      375     108   -12.50     0  -  -  0  0  0  - 99
+        -1    44832    44400    44116      714     282    -8.86     0  0  -  -  0  -  0 99
+        -2    44962    44941    44807      153     132    -2.81     2  0  9  -  -  2  5 83
+        -3    44990    44966    44742      246     222    -2.88     0  0  -  -  -  -  0 99
+        -1    45054    44949    44839      213     108    -9.79     0  0 24  -  0  2  3 69
+        +3    44859    44925    45191      330     264    -9.77     0  0  0  0  -  -  - 99
+0033    -2    45325    45157    44963      360     192     2.29    98  0  0  0  - 98  -  1
+        +2    44774    45203    45376      600     171    -0.66    24  0 24  0  0  -  0 75
+        +2    45377    45377    45475       96      96    -5.10     0  3  0  -  0  -  0 95
+        -3    45728    45293    44997      729     294    -6.86     0  0  0  -  - 99  0  0
+        +1    44716    45736    45900     1182     162    -7.60     0  0  -  0 92  0  -  7
+        -2    45922    45889    45644      276     243   -11.35     0  0  -  0 62  0  - 37
+        -1    45978    45285    45055      921     228    -7.81     0  0  2  -  0 93  0  4
+        -3    46160    45956    45807      351     147    -7.60     0  -  -  0 97  -  0  2
+        -2    46252    46183    45995      255     186    -0.57    26  -  0  0  0 26  - 73
+        -1    46527    46164    45979      546     183    -6.30     0  -  0  0  0  -  0 99
+        +1    46132    46459    46572      438     111   -14.46     0  0 44  0  -  4 19 30
+        +2    45842    46382    46636      792     252    -1.84     1  -  1  0  -  0  0 98
+        -3    46646    46352    46209      435     141    -5.69     0 25  0  3  0  -  0 71
+        +3    45633    46533    46778     1143     243    -9.32     0  -  -  0  0  0  - 99
+        -2    46837    46531    46253      582     276    -5.59     0  0  0  0  0  0 52 47
+        -1    46851    46626    46528      321      96   -14.61     0  -  7  1  0  0  0 90
+        -3    46979    46865    46650      327     213    -8.91     0  -  -  -  -  -  0 99
+        +2    46724    46856    47026      300     168   -15.09     0  0  0  0  0  0  - 99
+        -3    47393    47126    46980      411     144    -3.47     0  0  -  - 87  -  0 12
+        -3    47540    47525    47394      144     129   -11.60     0  3  0  0  0  -  0 95
+        -3    47657    47654    47541      114     111    -9.53     0  0  0  0  0  -  0 99
+        +2    47114    47150    47761      645     609   -12.50     0  0  0  0  1  -  - 98
+        -3    47831    47825    47703      126     120   -11.29     0  0  -  0  0  -  0 99
+        +3    47046    47247    47840      792     591    -4.78     0  0  -  0  0  -  - 99
+0034    -1    47892    47430    46852     1038     576     0.98    99  0  -  - 99  -  -  0
+        -3    47963    47936    47832      129     102    -8.87     0 88  -  -  -  0  0 11
+        +1    46804    47620    48033     1227     411    -6.40     0  0  -  -  -  -  - 99
+        -1    48309    48162    48019      288     141    -3.58     0  -  -  0  0  0  0 99
+        +2    48092    48152    48325      231     171    -8.48     0  -  0  0  -  0  0 99
+        +1    48190    48214    48339      147     123    -7.41     0  0  -  0  -  0  0 99
+        -3    48353    48089    47964      387     123    -9.73     0  -  0  0  -  0  0 99
+        +1    48418    48433    48555      135     120   -19.80     0  0  -  0  -  0  0 99
+        -1    48666    48633    48481      183     150    -8.62     0  -  -  0  0  0  0 99
+        +1    48556    48589    48738      180     147   -13.11     0  0  -  0  -  0  0 99
+        -2    48739    48109    47933      804     174   -10.80     0  -  -  0  -  0  - 99
+        -2    48892    48841    48740      150      99   -15.75     0  -  -  0  0  0  0 99
+        +3    47841    48816    48908     1065      90    -1.76    17  -  0 17  -  -  1 81
+        +2    48794    49109    49252      456     141    -1.01     0  0  0  -  0 99  0  0
+0035    -2    49297    49264    48893      402     369     0.44    83  -  -  -  - 83  0 16
+        +1    48991    49174    49356      363     180    -9.79     0  0  -  -  -  -  0 99
+        +1    49426    49447    49539      111      90   -11.49     0  0  0  0  -  0  0 99
+        +2    49253    49454    49735      480     279   -11.75     0  -  0  0  -  0  0 99
+        -1    49854    49650    49513      339     135   -12.84     0  -  0  0  0  0  0 99
+        +1    49561    49732    49887      324     153   -12.76     0  0  0  0  -  0  0 99
+        -2    49951    49516    49382      567     132   -10.47     0  -  0  0  0  0  0 99
+        +2    49736    50015    50272      534     255    -8.07     0  -  0  0  -  -  0 99
+        -2    50419    50230    50117      300     111    -8.04     0  -  0  0  0  0  0 99
+        +1    50218    50284    50466      246     180   -10.02     0  0  0 89  0  -  0 10
+        +3    49302    50385    50483     1179      96    -1.46    17  -  0 17 13  -  2 67
+        -1    50598    50415    50242      354     171    -4.92     0  0  -  1  0  0  0 98
+        +3    50502    50574    50684      180     108   -13.34     0  0 13  0  -  1  0 85
+        +1    50578    50650    50796      216     144   -12.12     0  0 20  -  0 28  0 50
+        +3    50685    50709    50834      147     123    -7.54     0  - 58  0  0  1  0 40
+        +2    50543    50762    51112      567     348    -0.61    10  - 10  -  -  0  0 88
+        +3    50955    51393    51503      546     108    -7.20     0  0  5  0  -  6  0 87
+        +1    51340    51343    51534      192     189   -12.22     0  0 21  -  -  0  0 78
+        -1    51645    51615    51472      171     141   -10.16     0  - 99  -  0  0  0  0
+0036    -3    51743    51314    48354     3387    2958    -5.75     7  -  0  0  -  0  7 92
+        -2    52228    50689    50498     1728     189    -6.42     0  -  -  -  -  0  0 99
+        -3    52244    52127    51933      309     192   -12.41     0  0  0  -  0 17  0 80
+        -2    52546    52495    52229      315     264   -12.19     0  0  0  -  0  0  - 99
+        +2    51113    52430    52582     1467     150   -10.47     0  0  0  -  0  -  - 99
+        +1    51625    52531    52674     1047     141    -2.64     2  2  -  0  0  -  - 97
+        +2    52595    52709    52804      207      93   -10.05     0 27  0  0  0  4  - 68
+        -1    52995    51747    51646     1347      99    -7.40     0  0  0  -  0  0  0 99
+        +2    52805    52868    52999      192     129    -7.23     0  0  0  0  0  0  0 99
+        +3    52713    52923    53018      303      93   -11.56     0  0  -  0  -  0  1 97
+        +1    52675    52930    53094      417     162   -11.31     0  0  -  -  -  0 30 69
+        -3    53192    52970    52752      438     216    -8.34     0  0  -  0  0  -  0 99
+        -1    53280    53259    53137      141     120   -15.38     0  0 18  -  0 66  - 15
+        +3    53181    53250    53354      171     102   -14.66     0  - 86  0  -  0  0 13
+        -3    53420    53378    53193      225     183    -6.21     0  -  8  -  -  0  0 91
+        +3    53622    53679    53771      147      90    -7.67     0  0 93  0  -  4  0  1
+        +3    53781    53853    53963      180     108   -15.62     0  -  0  0  0  0  0 99
+        -3    53990    53954    53817      171     135    -9.67     0  -  0  0  -  0  0 99
+        +1    53875    53893    54021      144     126    -8.31     0  0  0  -  -  0  - 99
+        +2    53000    53960    54157     1155     195    -9.66     0  -  0  -  -  0  - 99
+        -3    54158    54083    53991      165      90   -14.89     0  -  6  0  - 17  0 76
+        -2    54181    53278    52862     1317     414    -5.11     0  -  -  -  -  0  - 99
+        -2    54499    54457    54332      165     123   -15.32     0  0  -  -  3  0  0 96
+        -3    54539    54260    54159      378      99   -10.77     0  0  -  0  0  -  0 99
+        +2    54464    54548    54700      234     150   -11.33     0  0  0  2  0  0  0 96
+        -3    54707    54689    54540      165     147    -5.14     0  0  0  7  0  0  0 92
+        -2    54742    54670    54500      240     168    -9.09     0  0  0 28  0  0  - 71
+        -3    54869    54821    54708      159     111    -6.96     0  0  -  7  7  -  0 84
+        -1    55068    54312    54145      921     165    -9.14     0  0  -  0  0  -  - 99
+        -3    55121    55055    54948      171     105    -8.27     0 72  0  3 11  0  0 12
+        -2    55195    55009    54878      315     129   -10.64     0  0  0  0 98  0  -  1
+0037    -1    55329    55329    55069      258     258     1.88    99  0  0  0 99  -  -  0
+        -2    55387    55348    55196      189     150   -12.30     0  0  0  8  -  0  - 91
+        -3    55472    55397    55236      234     159    -9.54     0  0  0 28  -  -  0 71
+        +1    54073    55333    55476     1401     141    -7.30     0  0  0 43  -  -  0 56
+        +3    54399    55113    55484     1083     369    -1.98     0  -  0  0  -  -  - 99
+0038    -1    55953    55446    55345      606      99     0.57    36  0  0 41 36  -  0 21
+        +2    54758    55880    55990     1230     108    -2.71     5  0  5  0  -  0  0 93
+        -2    55996    55903    55811      183      90    -3.25     4  3 19  0  0  4  0 72
+        +3    55692    55743    56000      306     255   -10.44     0  0  -  0  -  -  - 99
+        -3    56003    55964    55761      240     201    -6.53     0  0  0  0  -  -  0 99
+        +1    55477    55747    56016      537     267   -11.30     0  0  -  -  -  -  - 99
+        -1    56148    56049    55954      192      93    -8.94     0  -  -  -  0  -  - 99
+        -2    56152    56110    55997      153     111   -14.33     0  -  0  -  0  0  - 99
+        +2    55991    56276    56386      393     108    -6.17     0  0  0  0  -  0  0 99
+        +1    56017    56272    56424      405     150   -13.69     0  0  -  0  -  0  0 99
+        +3    56118    56340    56471      351     129   -13.40     0  -  -  0  -  0  0 99
+        -3    56489    56240    56127      360     111    -8.37     0  0  0  0  -  -  0 99
+        -2    56653    56374    56153      498     219    -7.52     0  0  0  0  0  0  0 99
+        +2    56528    56663    56758      228      93   -10.97     0 22  0  -  0  0  0 76
+        -3    57029    56903    56622      405     279   -10.35     0 76  -  -  0  -  0 23
+        +3    56898    56997    57110      210     111    -6.71     0  8  0  0  0  0  - 91
+        -2    57187    57118    56900      285     216    -6.25     0 88  -  -  0  0  - 11
+        +3    57111    57117    57275      162     156   -10.32     0 55  0  0  0  -  0 44
+        +2    56936    57254    57355      417      99   -14.38     0 63  0  -  0  -  0 36
+        -3    57443    57191    57081      360     108    -7.36     0 96  0  -  0  0  0  2
+        -2    57571    57424    57314      255     108    -3.37     2 19  -  -  5  2  0 72
+        +1    56518    57841    57933     1413      90    -6.40     0  0  0 89  7  -  0  2
+        +2    57650    57800    58018      366     216    -9.47     0  -  0 99  0  -  0  0
+        +1    57949    58069    58191      240     120    -9.48     0  0  -  0 99  0  0  0
+        -3    58202    57578    57444      756     132    -4.95     0  0  - 95  0  -  0  4
+        +1    58192    58195    58293       99      96    -8.29     0  0  -  1  0  0  - 97
+        +1    58321    58501    58653      330     150   -16.76     0  0  - 25  0  0 57 16
+        -2    58714    58453    57878      834     573   -11.79     0  -  - 99  0  0  -  0
+        -2    58996    58960    58715      279     243   -12.35     0  -  - 27  0  0  0 72
+        +1    58768    58918    59025      255     105    -8.13     0  0  0 80  0  -  0 19
+0039    +3    57393    57579    59345     1950    1764    -0.26    18  -  - 18  0  -  - 81
+        -3    59411    58718    58203     1206     513    -4.04     0  -  - 99  0  0  0  0
+0040    -1    59496    59457    56431     3063    3024    -5.11     0  -  -  -  0  0  - 99
+        +3    59346    59451    59552      204      99    -5.25     0  - 19  0  -  0  5 74
+        +3    59553    59706    59804      249      96   -14.11     0  - 42  0  0 50  -  6
+        -1    59844    59616    59497      345     117   -10.05     0  - 99  -  0  0  0  0
+        +3    59817    59952    60056      237     102    -1.80     0  0  0  0  0  0 99  0
+        -3    60083    60017    59910      171     105     0.97    29  0 59  0  -  0 29 10
+        -1    60090    60051    59941      147     108    -7.56     0  0  0  0  0  0 99  0
+        +1    59854    60043    60135      279      90   -13.73     0  0  3  -  - 23  - 73
+0041    +2    58922    59222    60169     1245     945     1.34    99  - 99  -  -  0  -  0
+        +1    60196    60202    60303      105      99    -4.93     0  0  0  0  0  0  - 98
+        +3    60177    60237    60335      156      96    -1.82    15  -  0 15  1  0  - 83
+        -2    60373    59098    58997     1374      99    -1.74     4  - 71  0  0  4  2 21
+        +2    60170    60185    60403      231     216   -14.07     0  -  0  -  0  -  - 99
+        +1    60388    60568    60687      297     117    -7.38     0  0  0 35 50  0  0 13
+0042    +3    60336    60516    60881      543     363     0.64    91  -  - 91  0  -  0  8
+        +1    60688    60781    60888      198     105    -6.24     0  0  -  - 21  -  0 78
+        +1    60889    60964    61056      165      90   -10.70     0  0  0  0  0  0  0 99
+        -3    61094    60536    60270      822     264    -3.37     0  -  -  - 24  -  0 74
+        +3    60894    61002    61115      219     111    -8.82     0  - 58  0  0  0  - 41
+        +3    61116    61380    61514      396     132   -10.24     0  - 44  0  0 55  0  0
+        -3    61559    61208    61095      462     111    -6.99     0  - 97  -  0  0  0  1
+        -1    61608    60273    60091     1515     180   -12.18     0  -  -  -  0  0  0 99
+        +3    61593    61602    61703      108      99    -6.09     0  0 50  0  -  0  0 48
+        -1    61848    61731    61609      237     120   -12.27     0  0 92  -  0  0  0  7
+        -1    62040    61983    61849      189     132   -11.19     0  0 81  0  0  2  0 16
+        -3    62390    61685    61560      828     123   -11.41     0  0  0  -  -  0  0 99
+        -1    62604    62394    62302      300      90   -10.29     0  0  0  0  0  0  0 99
+        +3    61704    62550    62702      996     150   -12.62     0  0 99  0  -  0  0  0
+        -3    62714    62657    62481      231     174    -8.67     0  0 54  0  - 45  0  0
+0043    -2    62719    62692    60959     1758    1731    -3.24     0  - 98  -  0  0  -  1
+0044    +2    60866    60878    62821     1953    1941    -1.66     0  -  0  -  -  -  - 99
+        -3    62921    62870    62715      204     153   -16.23     0  0  -  -  0  -  0 99
+        -1    62982    62787    62689      291      96   -12.28     0  -  0  -  0  -  - 99
+        -2    63151    63010    62870      279     138    -8.61     0  0  0  0  -  0  - 99
+        +1    62719    63145    63291      570     144   -11.08     0  0  0 96  -  -  1  2
+        -2    63334    63265    63152      180     111   -13.00     0  0  0 99  0  0  0  0
+        -2    63634    63445    63335      297     108   -11.57     0  0  0 99  -  0  0  0
+        -2    63859    63736    63635      222      99   -16.31     0  0  0 96  0  0  0  3
+        -1    63909    63852    63616      291     234    -9.83     0  0  - 15  0  -  0 84
+        -2    64195    64069    63977      216      90   -11.76     0  0 12 21  -  0 45 20
+        +1    63577    63883    64374      795     489   -14.09     0  0  0  0  -  -  0 99
+        +1    64375    64378    64485      108     105   -14.06     0  0  0 99  0  -  0  0
+        -1    64485    64392    64213      270     177    -2.64     0  -  0 99  0  -  0  0
+        -2    64585    64573    64448      135     123   -14.17     0  -  0 89  -  0  3  6
+        -1    64776    64752    64618      156     132    -3.62     0  0  - 98  0  0  1  0
+        -1    65010    64968    64777      231     189   -12.75     0  0  0 96  0  0  0  3
+        -2    65080    64756    64586      492     168   -12.88     0  0  - 99  -  0  0  0
+        +1    64558    64696    65262      702     564   -13.81     0  0  0 99  -  -  0  0
+        -1    65313    65274    65095      216     177   -10.09     0  -  0 12  0  - 71 16
+        -2    65326    65317    65159      165     156   -15.10     0  -  0  4  0  0 52 42
+        -1    65517    65454    65314      201     138   -10.07     0  -  0 99  0  -  0  0
+        -2    65674    65632    65495      177     135   -10.49     0  -  0  0  -  0  0 98
+        -1    65808    65760    65629      177     129   -10.77     0  0  0 97  0  -  0  1
+        +2    64688    65252    65866     1176     612    -8.27     0  -  0  0  -  -  0 99
+        +1    65893    65947    66180      285     231    -9.84     0  0  -  0  0  -  0 99
+        -1    66204    65901    65809      393      90   -10.60     0  -  -  0  0  -  0 99
+0045    +3    62781    62892    66248     3465    3354    -1.11     0  -  0  0  -  -  0 99
+0046    -3    66506    66395    62922     3582    3471    -4.06     0  0  - 99  -  -  0  0
+        +3    66249    66315    66518      267     201   -14.26     0  0  0  0  0  -  - 99
+        +2    65984    66422    66574      588     150    -9.62     0  0  0  -  -  -  - 99
+        +1    66319    66520    66621      300      99    -6.31     0  0  -  -  - 88  0 11
+        -2    66628    66589    66467      159     120    -2.49     5  0  -  -  -  5  - 94
+        -3    66752    66635    66507      243     126   -10.52     0  -  -  -  -  -  0 99
+        -2    66856    66835    66629      225     204   -12.74     0  0  0  -  0  0  - 99
+        -1    67053    66756    66568      483     186   -16.13     0  -  -  -  0  -  0 99
+        +2    66989    67058    67174      183     114   -17.56     0  0  0  0  0  0  0 99
+        -3    67220    66896    66753      465     141   -13.13     0  0  0  0  0  -  0 99
+        -1    67662    67263    67054      606     207   -15.89     0  0  -  0  0  0  - 99
+        +3    66672    67659    67751     1077      90   -11.57     0  0  0  0  -  0  0 99
+        +2    67175    67805    67900      723      93    -7.43     0  0  0  0  - 12  0 87
+        -3    67907    67343    67221      684     120   -11.85     0  0  0  0  0  0  0 99
+        +1    67042    67186    67953      909     765   -14.55     0  0  -  -  -  0  - 99
+        -2    68128    66991    66857     1269     132   -14.65     0  0  -  0  0  0  0 99
+        -3    68135    68033    67908      225     123   -14.88     0  -  0  0  -  0  0 99
+        -2    68371    68332    68129      240     201    -9.30     0  0  0  0  0  0  - 99
+        -3    68378    68255    68136      240     117   -16.94     0  0  0  0  0  0  0 99
+        +3    67809    68304    68408      597     102   -10.66     0  0  0  0  0  -  - 99
+        +2    67901    68351    68443      540      90   -14.66     0 35  0  - 11  -  - 53
+        -1    68469    68205    68005      462     198    -8.71     0  0  0  0  0  -  - 99
+        +1    67954    68359    68478      522     117    -2.42     5  5  -  -  -  -  - 94
+        -3    68636    68564    68445      189     117   -13.63     0  -  -  0  -  0  0 99
+        +1    68479    68482    68658      177     174    -6.63     0  0  0  -  -  0  - 99
+        +2    68486    68615    68800      312     183    -9.38     0  -  0  0 99  0  -  0
+        -2    68842    68500    68372      468     126    -7.68     0  -  -  -  -  0  - 99
+        -1    68853    68766    68497      354     267    -2.55     0  -  0  -  0  0  - 99
+        -3    68885    68768    68637      246     129   -10.24     0  -  0  0 99  0  0  0
+        +1    68659    68797    68910      249     111   -10.65     0  0 98  0  -  -  -  1
+        +3    68577    68835    68927      348      90   -12.01     0  - 98  0  -  -  -  1
+        +3    68928    69024    69146      216     120    -6.00     0  0  0  0  -  0  0 99
+        +2    68801    69269    69379      576     108    -5.49     0  0  0  -  -  0 11 88
+        +1    69028    69256    69387      357     129   -16.05     0  0  -  -  -  0  0 99
+        -2    69445    68986    68843      600     141    -1.42     0  - 99  -  -  0  -  0
+        -3    69542    68990    68886      654     102    -1.43    16  - 11  -  0  1 16 70
+        +3    69354    69489    69749      393     258   -17.62     0  0  0  0  0  -  - 99
+        +2    69380    69593    69790      408     195    -0.49    28  0 28  -  0  -  0 71
+        +1    69487    69658    69795      306     135   -12.52     0  0  -  -  0  0  0 99
+        -2    69838    69775    69638      198     135    -3.25     1  0  4  -  0  1  0 94
+        -1    69894    69507    69376      516     129    -9.11     0  -  0  0  0  -  0 99
+        -2    70024    69943    69851      171      90   -12.69     0  0  0  3  -  0 94  2
+        +2    69791    69929    70117      324     186    -4.80     0  0  0  0  -  - 22 77
+        -3    70172    69641    69543      627      96   -14.15     0  0  3  0  0 70  0 25
+        -1    70191    70176    70039      150     135   -13.66     0  0  -  0  0  0 11 88
+        +3    69750    70143    70286      534     141   -10.68     0  0  -  0  -  0  - 99
+        -2    70396    70195    70025      369     168   -12.58     0  0  -  0  -  0  - 99
+        +2    70229    70244    70405      174     159   -10.52     0  0  0  -  -  -  0 99
+        +3    70287    70422    70520      231      96    -3.79     2  0  0  2  0  -  4 92
+        -3    70634    70265    70173      459      90    -6.97     0  0  -  0  -  0  0 99
+        -3    70805    70805    70662      141     141   -12.26     0  0  -  0  0  -  0 99
+        +2    70838    70916    71044      204     126   -13.24     0  5  0  0 88  0  0  5
+        -3    71111    70997    70857      252     138   -11.73     0  0  0  0  0  -  0 98
+0047    +1    69796    70996    71166     1368     168     1.58    91 91  -  0  2  0  -  6
+        -1    71241    70437    70255      984     180    -6.57     0  0  -  -  0  -  0 99
+        -3    71426    71261    71112      312     147   -10.53     0  -  -  0  -  0  0 99
+        +3    70521    71511    71615     1092     102   -18.64     0  0  0  0  0  0  0 99
+        -1    71622    71340    71242      378      96   -14.77     0  -  -  0  0  -  0 99
+        -3    71630    71630    71499      129     129    -8.57     0  0  0  -  -  0  0 99
+        -2    71746    71401    71258      486     141   -10.13     0  -  0  0  0  0  0 99
+        +1    71329    71689    71853      522     162   -17.59     0  0  0  0  0  -  0 99
+        -3    71918    71741    71631      285     108   -10.33     0  0  0  -  0  0  0 99
+        -1    72018    71922    71623      393     297   -17.60     0  -  0  -  0  -  - 99
+        -2    72109    72004    71858      249     144   -16.63     0  -  0  0  0  0  - 99
+        +2    71249    72062    72163      912      99    -5.68     0  -  0  0  0  - 62 36
+        -3    72170    72131    71919      249     210   -10.53     0  -  0  0  -  -  0 99
+        -1    72393    72177    72049      342     126   -12.31     0  -  -  0  0  -  - 99
+        +1    72136    72409    72540      402     129    -6.07     0  0  0  0  -  0  0 99
+        +3    71682    72093    72581      897     486   -12.51     0  -  -  0  -  -  - 99
+        -2    72592    72220    72110      480     108    -8.77     0  -  -  0  0  0  - 99
+        +1    72541    72766    72885      342     117   -17.46     0  0  5  0  0  -  0 94
+        +3    72714    72774    72893      177     117   -14.08     0  -  0  0  0  -  0 99
+        -3    72950    72287    72171      777     114   -20.96     0  0  -  0  0  0  0 99
+        +2    72242    72941    73432     1188     489   -13.33     0  0  0  0  0  -  - 99
+        -2    73444    73201    73085      357     114   -17.10     0  0  0  0  0  0  0 99
+        -3    73454    73214    73074      378     138    -9.78     0  0  0  0  0  -  0 99
+        +1    72904    73306    73458      552     150   -10.45     0  0  -  0  0  -  0 99
+        +3    72894    73203    73496      600     291   -13.39     0  -  -  0  0  -  - 99
+        -2    73672    73657    73445      225     210   -10.88     0  -  0  -  0  0  - 99
+        +2    73433    73568    73693      258     123   -11.21     0  -  0  0  0  -  0 99
+        +1    73615    73696    73824      207     126   -12.12     0  0  0  0  0  0  0 99
+        -3    73922    73688    73455      465     231   -13.58     0  -  0  -  0  -  0 99
+        -1    73980    72588    72469     1509     117    -6.87     0  -  0  -  0  0  0 99
+        +1    73858    73888    73986      126      96    -6.95     0  0  0  0  -  0  - 99
+        +2    73694    74033    74134      438      99    -3.87     2  -  2  0  -  0  0 96
+        -3    74249    74027    73923      324     102   -12.20     0  -  0  0  -  0  0 99
+        -1    74274    74253    74059      213     192   -13.80     0  -  -  0  0  0  0 99
+        +3    73497    74199    74324      825     123   -14.13     0  -  0  0  -  0  - 99
+        +1    74215    74218    74331      114     111   -10.22     0  0  0  -  -  0  - 99
+        +1    74332    74347    74487      153     138   -13.38     0  0  -  -  0  0  - 99
+        -2    74605    73951    73673      930     276   -10.63     0  -  -  0  0  0  - 99
+        +1    74488    74536    74634      144      96   -15.85     0  0  0  1  0  -  - 98
+        +2    74495    74513    74644      147     129   -15.13     0  -  0  0  0  -  - 99
+        +3    74517    74577    74750      231     171   -12.64     0  -  -  0  0  -  0 99
+        -3    74816    74735    74553      261     180   -12.68     0  -  -  0  0  -  0 99
+        -1    74925    74394    74275      648     117   -13.05     0  -  -  -  0  0  - 99
+        -2    74935    74899    74759      174     138   -10.39     0  0  -  -  0  0  - 99
+        +1    74635    74839    74958      321     117    -5.16     0  0  -  0  -  -  0 99
+        +3    74823    74859    75002      177     141    -9.31     0  -  0  0  -  -  0 99
+        -3    75020    74915    74817      201      96    -4.61     1  0  -  -  0  1  1 97
+        +2    74846    75098    75211      363     111   -13.67     0  0  0  2  0  -  - 97
+        +3    75054    75072    75227      171     153    -5.59     0  0  -  0  0  -  - 99
+        +1    75076    75127    75234      156     105   -12.07     0  0  -  -  0  -  - 99
+        -1    75234    75099    75004      228      93   -16.88     0  -  0  -  0  -  - 99
+        -1    75357    75342    75244      111      96   -11.95     0  0  -  0  0  -  0 99
+        -3    75374    75257    75162      210      93   -12.12     0  -  -  -  -  -  0 99
+        +1    75235    75286    75378      141      90    -7.74     0  0  0  -  -  7  0 92
+        -2    75418    75409    75254      162     153    -5.78     0  -  -  -  -  0  - 99
+        +2    75515    75518    75631      114     111   -11.41     0 99  0  -  -  -  0  0
+0048    +1    75379    75550    75654      273     102    -0.12    47 47  -  -  -  -  0 52
+        -3    75707    75623    75375      330     246   -17.74     0  0  -  -  -  -  0 99
+        -1    75777    75774    75616      159     156   -10.55     0  -  -  -  0  -  - 99
+        +2    75632    75716    75910      276     192   -11.74     0  0  0  0  -  0  - 99
+        +1    75655    75760    76032      375     270   -11.06     0  0  -  0  -  0  - 99
+        -2    76066    75781    75620      444     159   -14.64     0  -  -  -  0  0  - 99
+        +2    75911    75959    76267      354     306   -12.68     0  -  0  0  0  -  0 99
+        -2    76375    76375    76067      306     306   -15.21     0  -  -  0  0  0  0 99
+        -1    76503    76497    75778      723     717   -14.31     0  -  -  0  0  -  - 99
+        -2    76582    76507    76376      204     129   -19.32     0  0  -  0  0  0  0 99
+        +3    75675    76272    76622      945     348    -8.70     0  0  -  0  -  -  0 99
+        -1    76638    76626    76504      132     120    -6.82     0  0  -  -  0  -  0 99
+        +1    76276    76642    76812      534     168    -6.67     0  0  0  -  -  0  0 99
+        -2    76861    76729    76631      228      96    -5.96     0  0  0  -  -  0  0 99
+        -3    76901    76070    75951      948     117   -17.23     0  -  0  0  0  0  0 99
+        -1    76956    76896    76771      183     123   -15.84     0  -  -  -  0  -  0 99
+        -2    77041    76960    76862      177      96   -13.69     0  -  0  0  1  0  - 98
+        -1    77073    77073    76957      114     114    -4.41     0  0  -  1  0  - 96  2
+        +1    76876    76969    77172      294     201    -7.94     0  0  - 57  -  - 22 19
+        -2    77197    77188    77096       99      90   -10.99     0  -  -  3 16  0  0 79
+        +3    76800    77154    77381      579     225    -1.72     2  -  -  2  -  -  0 97
+        -3    77384    77054    76902      480     150    -2.00     5  0  -  0  -  -  5 94
+        -2    77419    77314    77207      210     105   -13.21     0  -  - 67  0  0 18 14
+        +1    77230    77302    77460      228     156   -11.25     0  0  0  -  -  -  - 99
+        -1    77802    77796    77632      168     162   -11.22     0  0  0  0  0  0  0 99
+        -2    78019    77752    77567      450     183   -13.40     0  0  0  0  -  0  0 99
+        +2    77303    77888    78061      756     171   -10.48     0  0  0  0  0  -  0 99
+        +3    77457    78063    78164      705      99    -7.55     0  0  -  0 35  0  - 64
+        -1    78171    77934    77803      366     129   -10.44     0  0  0  0  0  0  - 99
+        +1    77518    78100    78231      711     129    -9.02     0  0  -  -  -  0  - 99
+        -2    78286    78178    78050      234     126    -9.86     0  0  -  -  -  0  - 99
+        +2    78137    78446    78589      450     141   -12.62     0  0  0  0  0  0  0 99
+        +3    78165    78342    78596      429     252    -9.86     0  0  -  0  -  0  0 99
+        +2    78590    78629    78760      168     129    -9.36     0  0  0  0  0  0  0 99
+        +3    78597    78690    78944      345     252    -9.46     0  0  -  0  0  0  0 99
+        -1    78951    78594    78400      549     192    -6.72     0  0  -  0  0  0  0 99
+        +3    78945    79017    79187      240     168    -7.51     0  0  0  0  0  0  0 99
+        +1    78232    78934    79236     1002     300    -8.00     0  0  0  -  -  0  0 99
+        -2    79243    78403    78287      954     114   -14.90     0  0  0  0  0  0  0 99
+        -1    79314    79185    78952      360     231   -10.34     0  0  0  0  0  0  0 99
+        +2    78896    79226    79372      474     144    -2.69     2  -  2  0  -  -  0 97
+        -3    79406    78281    78111     1293     168    -7.16     0  -  -  -  -  0  0 99
+        +3    79188    79233    79421      231     186    -9.05     0  0  -  0  -  -  - 99
+        -2    79537    79510    79337      198     171   -15.54     0  0  -  -  0  0  - 99
+        -3    79784    79538    79407      375     129   -16.40     0  0  0  -  4  0  0 95
+        +3    79422    79578    79850      426     270   -10.56     0  0  0  0  0  0  - 99
+        -2    79930    79738    79538      390     198   -11.35     0  0  0  0  0  0  0 99
+        +1    79237    79852    79953      714      99    -6.96     0  0  3  0  0  -  0 96
+        -1    80007    79473    79315      690     156   -10.25     0  0  -  -  0  -  - 99
+        +2    79373    79937    80056      681     117   -21.65     0  -  0  0  -  -  0 99
+        +3    79851    80016    80114      261      96   -14.75     0  -  -  0  -  -  0 99
+        +1    80047    80053    80205      156     150   -10.00     0  0  0  -  -  -  0 99
+        +1    80206    80242    80388      180     144   -15.99     0  0  0  0  0  0  0 99
+        +1    80389    80449    80571      180     120    -8.16     0  0  0  0  0  0  0 99
+        -1    80592    80304    80161      429     141   -14.53     0  -  0  0  0  0  0 99
+        -2    80635    80182    80060      573     120   -10.79     0  0  0  -  -  0  0 99
+        +2    80057    80486    80653      594     165   -17.22     0  -  0  0  -  -  0 99
+        -2    80938    80755    80645      291     108   -17.12     0  0  -  0  0  0  0 99
+        +2    80654    80852    80944      288      90   -17.71     0  0  0  0  0  -  0 99
+        +3    80154    80913    81068      912     153   -15.54     0  0  -  0  0  -  0 99
+        -2    81181    81130    81014      165     114   -10.14     0  0  0  -  0  0  0 99
+        -3    81200    80243    79839     1359     402   -11.29     0  -  -  -  -  -  0 99
+        +2    80945    81137    81268      321     129    -6.27     0  0  0  0  0  -  - 99
+        -1    81363    80853    80761      600      90   -12.98     0  0  0  0  0  0  0 99
+        +1    80572    81214    81435      861     219    -4.15     0  0  -  -  -  -  0 99
+        -3    81518    81293    81201      315      90    -5.33     0  0  -  2  0  0  0 95
+        +1    81436    81454    81669      231     213   -13.77     0  0  0  0  0  0  - 99
+        +2    81269    81590    81700      429     108    -8.02     0  -  0  0  0  0  0 99
+        -1    81720    81465    81364      354      99    -6.94     0  -  0  -  0  -  0 99
+        +3    81426    81630    81746      318     114    -8.45     0  -  -  0  -  1  0 98
+        -3    81776    81650    81519      255     129   -11.24     0  0  0  0  0  0  0 99
+        -2    81907    81724    81386      519     336    -7.53     0  -  -  -  0  0  - 99
+        +1    81670    81805    82050      378     243    -4.68     0  0  -  0  -  -  - 99
+0049    -1    82095    81960    81835      258     123     2.86    96  0  0  0 96  -  -  3
+        -3    82289    82007    81912      375      93    -7.72     0  0  0  2  1  -  0 95
+        +3    81747    82125    82319      570     192    -4.62     0  -  0  0  -  -  - 99
+        +2    82034    82298    82423      387     123   -11.24     0  0  0  -  -  0  0 99
+        -3    82502    82436    82290      210     144    -9.48     0  0  -  -  -  0  0 99
+        +1    82294    82417    82518      222      99   -16.28     0  0  -  0  0  0  - 99
+        -1    82542    82488    82303      237     183   -11.30     0  0  -  -  0  0  0 99
+        +1    82519    82555    82656      135      99    -5.14     0  0  0  -  - 73  0 26
+        -2    82663    82411    82265      396     144   -10.02     0  -  0  -  -  0  - 99
+        -3    82706    82625    82503      201     120   -13.55     0  -  0  -  -  0  0 99
+        -1    82836    82710    82603      231     105   -11.92     0  -  0  0  0  -  0 99
+        -2    82849    82840    82664      183     174   -13.61     0  0  0  0  0  0  - 99
+        +3    82566    82797    82967      399     168   -16.96     0  0  0  0  -  -  0 99
+        +2    82424    82919    83020      594      99   -16.06     0  0  0  -  0  0  0 99
+        +3    82968    82980    83075      105      93   -16.63     0  0  -  0  -  0  0 99
+        -2    83200    82978    82850      348     126   -11.61     0  0  0  -  0  0  0 99
+        +2    83030    83102    83209      177     105   -11.47     0  0  0  0  -  -  0 99
+        -3    83330    82853    82707      621     144   -10.12     0  0  0  0  -  0  0 99
+        -1    83460    83277    83155      303     120   -16.15     0  0  -  0  0  -  0 99
+        +2    83210    83285    83764      552     477   -14.26     0  0  0  0  -  0  - 99
+        -1    83790    83637    83521      267     114   -11.52     0  0  0  0  0  0  - 99
+        +1    82657    83455    83832     1173     375   -13.89     0  0  -  0  -  0  - 99
+        -2    83881    83464    83201      678     261   -12.23     0  0  -  0  0  0  - 99
+        +2    83765    83834    83935      168      99    -6.83     0  -  0  0  0  -  - 99
+        +3    83076    83841    83984      906     141    -8.22     0  -  -  0  0  -  - 99
+        -1    83991    83949    83821      168     126    -7.12     0  -  -  0  0  -  - 99
+        +2    83936    84053    84187      249     132   -18.50     0  0  0  0  0  0  0 99
+        -2    84361    83995    83882      477     111   -14.93     0  -  -  -  0  0  0 99
+        +3    84057    84255    84422      363     165    -7.84     0  0  0  0  0  -  0 99
+        -3    84533    84365    84048      483     315   -11.55     0  0  -  -  0  0  0 99
+        -1    84738    84183    83992      744     189   -10.78     0  0  0  -  0  0  - 99
+        +1    83908    84553    84795      885     240   -14.52     0  0  0  0  -  0  - 99
+        -1    85233    85110    84739      492     369   -14.62     0  -  0  0  0  0  - 99
+        +2    84497    85154    85378      879     222    -7.88     0  0  0  0  -  0  0 99
+        -3    85415    85037    84792      621     243   -13.62     0  -  0  0  0  0  0 99
+        +1    84853    85375    85470      615      93    -8.31     0  0  0  0  5  0  - 93
+        -2    85477    84679    84362     1113     315   -10.23     0  0  -  -  0  0  - 99
+        +1    85471    85540    85650      177     108   -12.70     0  0  0  0  0  0  0 99
+        +3    84432    85533    85730     1296     195   -13.82     0  -  0  0  0  0  0 99
+        -1    85884    85779    85234      648     543   -12.36     0  -  -  -  0  -  - 99
+        -2    85906    85888    85478      426     408   -15.67     0  -  0  -  0  0  0 99
+        +1    85651    85915    86010      357      93   -14.92     0  0  0  0  0  0  0 99
+        +2    85379    85826    86029      648     201   -17.06     0  -  0  0  -  -  0 99
+        -2    86074    86017    85907      165     108   -17.05     0  -  0  0  0  0  0 99
+        -3    86087    86075    85416      669     657   -16.30     0  -  -  -  -  -  0 99
+        +3    85731    86034    86153      420     117   -12.34     0  0  0  0  0  -  - 99
+        -1    86205    86019    85885      318     132   -15.37     0  -  0  0  0  -  0 99
+        -2    86302    86209    86075      225     132   -19.06     0  0  0  -  0  0  - 99
+        +3    86154    86169    86306      150     135   -13.48     0  0  0  0  -  0  0 99
+        +1    86011    86311    86409      396      96   -20.50     0  0  0  -  -  0  - 99
+        +2    86030    86369    86467      435      96   -13.10     0  -  0  -  -  0  0 99
+        -3    86513    86510    86361      150     147    -8.76     0  -  -  -  -  0  0 99
+        +3    86400    86406    86582      180     174    -8.91     0  0  -  0  -  0  - 99
+        -2    86620    86596    86303      315     291   -10.86     0  -  -  -  -  0  - 99
+        +1    86410    86521    86640      228     117   -14.74     0  0  0  -  0  -  0 99
+        -3    86738    86657    86514      222     141    -8.07     0  -  0  -  0  -  0 99
+        +3    86583    86628    86804      219     174   -14.48     0  -  0  0  0  -  - 99
+        -3    86936    86840    86739      195      99    -3.91     2  -  0  -  0  -  2 97
+        -1    87213    86535    86413      798     120    -9.78     0  0  -  0  0  0  - 99
+        +1    86812    87106    87255      441     147   -12.82     0  0  0  0  -  0  0 99
+        +3    87048    87207    87308      258      99   -15.40     0  -  0  0  -  0  0 99
+        +2    86507    87257    87358      849      99   -13.26     0  -  0  -  0  -  0 99
+        -3    87365    87128    86937      426     189   -12.75     0  0  0  -  0  -  0 99
+        -1    87594    87372    87244      348     126   -12.13     0  -  -  -  0  -  - 99
+        +3    87309    87495    87671      360     174   -13.23     0  0  -  0  -  0  0 99
+        -1    87771    87720    87595      174     123   -10.63     0  0  0  -  0  0  0 99
+        +2    87551    87752    87844      291      90   -11.56     0  0  0  0  -  0  0 99
+        -3    87884    87860    87366      516     492   -15.49     0  0  -  -  -  0  0 99
+        -1    87918    87888    87772      144     114   -11.81     0  0  -  0  0  0  0 99
+        +3    87672    87966    88115      441     147   -11.57     0 16  0  0  0  0  0 83
+        -2    88336    87694    87305     1029     387   -11.28     0  0  -  -  -  0  - 99
+        +3    88116    88218    88343      225     123    -6.04     0  0  0  0  0  - 34 64
+        -3    88400    88340    87906      492     432    -7.85     0  0  0  -  -  0  0 99
+        +2    87845    88325    88426      579      99   -12.97     0  0  0  -  0  -  - 99
+        -1    88641    88038    87919      720     117    -7.37     0  0  0  0  0  0  0 99
+        +3    88344    88581    88733      387     150    -7.85     0  0  0  0  -  0 25 73
+        +2    88427    88727    88819      390      90    -8.83     0 99  0  -  0  0  -  0
+        -3    89129    89054    88893      234     159    -6.63     0 12  0  6 79  0  0  1
+        -3    89372    89234    89130      240     102   -14.05     0 96  0  0  3  0  0  0
+        +2    88856    89291    89611      753     318   -13.66     0 99  0  0  0  0  -  0
+        -2    89674    88645    88337     1335     306   -11.60     0  0  -  -  0  0  - 99
+        +3    88791    89061    89825     1032     762    -9.92     0 99  -  0  0  -  -  0
+0050    +1    87298    88741    89982     2682    1239     0.27    96 96  -  -  0  -  -  3
+        -3    90167    89861    89649      516     210    -4.91     0  0  -  -  0  -  0 99
+0051    +1    89983    90028    90390      405     360     1.98    99 99  0  -  0  0  -  0
+        -2    90430    90226    89948      480     276    -9.84     0  -  0  -  0  0  - 99
+        +2    89909    90206    90631      720     423   -12.81     0  -  0  -  0  -  - 99
+        +2    90632    90644    90793      159     147   -15.34     0 74  0  0  0  0  - 25
+        -2    90844    90595    90431      411     162    -7.58     0  0  0  0  0  0  - 99
+        +3    90618    90636    90854      234     216    -6.61     0  3  -  0  0  -  - 95
+0052    -1    90942    90918    88705     2235    2211    -3.41     0 99  -  -  0  0  -  0
+        +1    90391    90562    91008      615     444    -4.24     0  0  -  -  -  -  - 99
+        -2    91081    91045    90929      150     114    -8.06     0  -  0  0  -  0  0 99
+        +2    90794    90851    91111      315     258   -10.25     0  -  0  -  -  -  - 99
+        -1    91176    91107    90943      231     162    -6.44     0  -  0  -  0  -  0 99
+        -2    91234    91195    91082      150     111   -15.52     0  -  -  0  -  0  0 99
+        +2    91112    91148    91240      126      90   -14.15     0  -  0  0  -  -  0 99
+        -3    91307    91022    90897      408     123   -10.76     0  -  0  0  -  -  0 99
+        +1    91213    91219    91311       96      90    -8.63     0  0  -  0  0  -  0 99
+        -1    91359    91287    91177      180     108    -8.04     0  -  -  0  0  -  0 99
+        +3    91077    91260    91376      297     114   -13.64     0  -  -  0  -  -  - 99
+        -3    91499    91415    91308      189     105   -23.43     0  0  -  -  -  -  0 99
+        +2    91445    91484    91633      186     147    -9.40     0  0  0  -  -  0  - 99
+        -2    91669    91489    91373      294     114    -6.73     0 69  -  0  -  0  0 30
+        +1    91312    91663    91773      459     108    -6.64     0  0  0  -  1  -  0 98
+        -3    91814    91730    91614      198     114    -8.78     0  0  -  -  0  -  0 99
+        +2    91667    91745    91846      177      99   -12.13     0  -  0  0  0  -  - 99
+        +3    91710    91752    91871      159     117   -18.12     0  -  -  0  0  -  - 99
+0053    +3    91872    91917    92009      135      90     1.94    84  0  - 84  0  -  0 15
+        -3    92054    91988    91890      162      96   -12.17     0  0  -  5  0  -  0 94
+        -1    92121    91617    91495      624     120   -11.42     0  0  0  -  0  0  - 99
+        +1    91774    91774    92142      366     366   -15.94     0  0  -  -  -  -  - 99
+        +2    91976    92039    92176      198     135   -11.26     0  -  0  -  -  -  - 99
+        -3    92270    92210    92055      213     153   -15.62     0  -  -  -  -  -  0 99
+        +1    92143    92182    92274      129      90   -16.37     0  0 97  0  -  0  0  2
+        +2    92186    92228    92362      174     132    -5.63     0  -  0  0  -  0  - 99
+        +3    92169    92307    92408      237      99   -27.53     0  -  -  0  -  0  - 99
+        -1    92697    92679    92437      258     240   -13.03     0  -  0  -  0  0  0 99
+        +2    92363    92615    92725      360     108    -9.85     0  0  0  0  -  0  - 99
+        +3    92499    92673    92795      294     120   -15.35     0  0  -  0  -  0  - 99
+        +1    92593    92764    92874      279     108    -4.65     0  0 11  -  0  1  0 85
+        -3    92942    92909    92709      231     198   -12.59     0  -  -  -  0  0  0 99
+        +2    92729    92894    92998      267     102   -13.60     0  -  0  0  0  0  - 99
+        -1    93162    92835    92698      462     135    -5.66     0  0  -  -  0  0  - 99
+        +3    92847    93246    93347      498      99   -16.99     0  0  0  0  - 64  - 34
+        +2    92999    93218    93430      429     210    -6.19     0  0  0  -  -  4  - 95
+        -2    93454    92257    92060     1392     195    -4.44     0  -  -  -  -  0  0 99
+        -3    93548    93458    93336      210     120   -18.59     0 37  -  - 59  0  0  2
+        +1    93064    93421    93576      510     153    -2.46     1  1  -  0 36  -  - 61
+        +3    93393    93474    93596      201     120   -10.31     0  -  -  0  7  -  - 92
+0054    -1    93660    93540    93307      351     231     2.31    99  0  -  - 99  -  -  0
+        +2    93527    93569    93664      135      93    -5.67     0  -  0  -  0  -  - 99
+        +3    93597    93609    93731      132     120   -12.34     0  0  -  0  -  -  - 99
+        +3    93732    93837    93998      264     159    -5.05     0  -  0  0  0  0  0 99
+        -1    94134    93819    93691      441     126    -5.73     0  -  -  -  0  -  - 99
+        +3    93999    94002    94175      174     171   -13.17     0  0  -  0  -  -  0 99
+        -1    94437    94287    94135      300     150    -9.09     0  0  0  -  0  -  0 99
+        -3    94526    93827    93711      813     114    -5.30     0  -  -  -  2  -  0 96
+        -1    94539    94530    94438       99      90   -21.18     0  0 98  0  0  0  0  1
+        +2    94106    94358    94567      459     207    -1.90     2  0  2  -  -  0  - 97
+        -2    94567    94315    94160      405     153    -2.57     2  0  0  -  0  2  0 97
+        +1    94006    94153    94575      567     420   -14.21     0  0  -  -  -  -  - 99
+        +1    94603    94633    94734      129      99    -1.98    12 12  -  0  0  0  0 86
+        -1    94956    94809    94603      351     204    -8.21     0  -  -  0  0  0  - 99
+        +3    94554    94746    95042      486     294   -11.64     0  0  0  0  -  0  - 99
+        +3    95043    95430    95585      540     153    -9.73     0  0  0  0  0 99  -  0
+        +2    94697    95165    95716     1017     549    -3.76     0  0  0  -  0 99  -  0
+        +1    94747    95713    95847     1098     132    -9.97     0  0  0  -  0  0  - 99
+        +2    95717    95822    96214      495     390    -2.22     0  -  0  -  0 99  -  0
+        +3    96006    96063    96266      258     201   -16.28     0  0  -  0  0 48  - 51
+        -1    96294    95166    95059     1233     105    -4.22     0  0  0  0  0 97  -  1
+0055    -2    96382    95608    94568     1812    1038     0.87    99  -  -  -  - 99  -  0
+        -3    96410    96386    96288      120      96   -12.23     0  0  0  0  - 17  0 81
+        +3    96267    96390    96644      375     252    -9.65     0  0  0  0  - 12  - 87
+        +2    96215    96401    96775      558     372    -5.62     0  0  0  -  -  0  - 99
+0056    -2    96805    96523    96383      420     138     1.19    59  0 28  0  - 59  - 12
+        +1    95848    96802    96915     1065     111    -3.81     0  0  0  3 73  -  - 22
+        -1    97047    96705    96526      519     177    -4.66     0  0  0  -  0  0  0 99
+        -2    97075    96934    96806      267     126   -13.38     0  -  0  0 97  0  -  1
+        +3    96750    97104    97280      528     174    -6.37     0  0  -  0  -  - 10 89
+        -3    97313    96932    96810      501     120    -7.15     0  -  0  0 98  0  0  1
+        -1    97365    97353    97252      111      99    -6.95     0  2  0  -  0 71  - 25
+        +1    96937    97210    97386      447     174    -4.98     0  0  0  -  -  1  - 98
+        +2    97214    97436    97615      399     177    -3.19     0  0  0  0  0 93  0  5
+        -3    97739    97583    97323      414     258   -12.32     0  -  0  0  - 39  0 60
+        -2    97810    97255    97163      645      90    -1.97     0  0  -  0  0  0 99  0
+        +1    97387    97732    97887      498     153    -5.19     0  0  0  0  2  -  - 97
+        +2    97616    97766    97927      309     159    -5.45     0  -  0  0  2  -  - 97
+        -1    98025    97467    97366      657      99    -6.17     0  -  4  0  0 75  0 20
+        +3    97281    98046    98243      960     195     1.09     0  -  0  0  -  0 99  0
+        -3    98363    98231    97866      495     363    -1.65     0  -  -  0  -  -  0 99
+        -1    98448    98376    98221      225     153    -9.84     0  0  0  -  0  0  - 99
+        +1    98173    98620    98715      540      93    -9.69     0  0  0  0  0 98  0  1
+        +2    98042    98609    98737      693     126    -7.20     0  -  0  0  0 12  0 87
+        -3    98828    98735    98565      261     168   -12.73     0  -  0  -  0 40  0 59
+        -2    98953    98047    97871     1080     174    -7.53     0  -  -  0  -  0  0 99
+        -3    98963    98957    98829      132     126    -8.36     0 99  0  0  0  0  0  0
+        -3    99251    99152    99015      234     135   -14.02     0  0  -  0 91  0  0  8
+        +3    98613    99096    99287      672     189    -4.28     0  0  -  0  3  -  - 96
+        -3    99380    99374    99252      126     120   -13.28     0  0  -  -  0  0  0 99
+        -3    99599    99569    99420      177     147   -10.73     0  0  0  0 99  -  0  0
+        +2    99314    99605    99703      387      96   -20.36     0  0  0  -  0  0  - 99
+        +3    99780    99906   100088      306     180    -8.09     0  1  0  0  0  -  0 98
+        +2    99704    99971   100129      423     156    -9.38     0 50  0  -  0  -  0 49
+0057    +1    98719    98734   100467     1746    1731    -4.04     0  0  0  -  0  -  0 99
+0058    -1   100479   100239    98455     2022    1782    -3.92     0  0  0  -  0 51  0 48
+        -3   100661    99935    99789      870     144   -15.78     0 97  0  0  2  -  0  0
+        -1   100710   100605   100480      228     123    -7.44     0  1 11  0  0  -  0 87
+        +2   100319   100604   100735      414     129   -15.69     0  -  0  0  -  -  - 99
+        -2   100801   100714   100616      183      96   -11.69     0  -  0  0  0  0  - 99
+        +3   100608   100641   100814      204     171   -11.88     0  -  -  0  -  -  - 99
+        -1   101034   100887   100753      279     132    -5.11     0  -  0  -  0  -  0 99
+        -3   101060   101012   100911      147      99   -11.25     0  0  0  -  0 28  0 71
+0059    +3   100995   101196   101315      318     117     4.34    35  0  0 35 64  0  0  0
+0060    -2   101326   100999   100802      522     195     0.06    52  -  0  -  0 52  - 47
+        -2   101890   101428   101327      561      99   -11.67     0  5  0  0 91  0  0  2
+        +3   101316   101385   101894      576     507   -10.64     0 99  0  0  0  0  -  0
+        -3   102008   101966   101745      261     219   -10.96     0 99  0  -  0  -  0  0
+        +3   101895   102051   102173      276     120   -17.78     0  1  0  0  0 79  - 18
+        -1   102258   101424   101035     1221     387     0.04     2 95  0  -  2  -  -  2
+0061    +1   100855   102385   102570     1713     183     2.77    75 75  0  -  0 24  -  0
+        -1   102627   102366   102268      357      96    -9.32     0  6  2  -  0 87  0  3
+0062    +2   100736   100811   102931     2193    2118    -7.68     0 53  0  0  0  8  - 37
+        -1   103017   102912   102748      267     162   -11.85     0  0  0  -  0 13  - 86
+0063    -2   103084   102856   101891     1191     963     3.08    99  -  0  -  - 99  -  0
+        +1   102571   102913   103152      579     237    -9.49     0  0  -  0  -  -  0 99
+        -2   103567   103441   103085      480     354     1.02     0  -  0  0  -  0 98  0
+        -2   103753   103723   103625      126      96    -9.79     0  -  0  0  0  0  1 98
+        -2   104110   103891   103766      342     123    -7.95     0  0  0  0  -  0  0 99
+        -2   104380   104221   104111      267     108   -12.66     0  -  0  0  -  0  8 90
+        +2   102932   104441   104563     1629     120    -2.81     0  -  0  0  0  0 98  0
+        -2   104593   104524   104396      195     126   -12.82     0  -  0  0  -  0 74 25
+        -2   104980   104692   104594      384      96    -8.16     0  0  -  0  -  0 99  0
+        -1   105105   105054   104815      288     237    -6.96     0  0  0  0  0  - 22 77
+        -2   105133   105100   104981      150     117   -12.23     0  0  0  5  0  0 93  0
+        +1   104515   104791   105336      819     543   -10.16     0  0  0  6  -  - 68 25
+0064    -3   105380   103550   102867     2511     681     0.56    97  -  -  0  -  - 97  2
+        -2   105454   105268   105134      318     132   -10.16     0  0  0 88  0  0  3  7
+0065    +3   102801   103074   105521     2718    2445    -5.73     0  -  0  0  0  -  5 94
+        -3   105578   105509   105381      195     126    -4.04     0  -  0  0  0  -  0 99
+        -3   105815   105779   105579      234     198    -9.24     0  0  0  0 98  -  0  0
+        +1   105436   105646   105831      393     183    -0.32     0  0  0  0 99  0  -  0
+        -1   105846   105207   105106      738      99    -8.67     0  0 23  0  0  - 24 51
+        -2   105958   105844   105620      336     222   -15.28     0  -  0  0 99  0  -  0
+        -3   106004   105932   105816      186     114    -6.92     0  -  0  0  -  0  0 99
+        -3   106130   106106   106005      123      99    -7.20     0  0  0  0 15  0  0 84
+        +2   104687   105518   106162     1473     642   -12.52     0  -  0  -  -  -  - 99
+        -2   106327   106159   105965      360     192   -12.37     0  0  0  0 94  0  -  4
+        +1   105832   106438   106572      738     132    -3.96     0  0  0 41 53  -  2  3
+        -3   106670   106352   106224      444     126    -7.50     0  0  0  0  0  -  0 99
+        +3   105534   106311   106883     1347     570    -7.96     0  -  -  0  0  -  - 99
+0066    -1   107034   106200   105847     1185     351     0.64    89  0  -  0 89  -  -  9
+        -3   107288   107279   107133      153     144   -11.78     0 85  0  -  0  2  0 11
+        +1   106573   107197   107382      807     183    -6.40     0  0  0  0  0  0  - 99
+        +2   106442   107306   107410      966     102    -6.28     0  -  0  0  0  0  - 99
+        -2   107428   106951   106526      900     423    -2.02     0  -  0  -  0  0  - 99
+        -3   107642   107432   107334      306      96   -21.92     0  -  -  0  0  0  0 99
+        +2   107474   107666   107782      306     114    -8.97     0  0  0 95  4  0  -  0
+        -2   107959   107830   107627      330     201   -12.95     0  0  - 99  0  0  -  0
+        -3   107999   107867   107772      225      93    -5.25     0  0  - 98  1  0  0  0
+        +1   107383   107995   108099      714     102     3.31    10 10  0  0 89  0  -  0
+        -2   108163   108148   107960      201     186   -11.58     0  -  -  0 35  0  - 64
+        -2   108316   108256   108164      150      90    -3.82     0  -  0  0  0  0 99  0
+        -1   108354   107187   107083     1269     102    -4.23     0 12  0  -  0 74  - 12
+        +3   107943   108213   108416      471     201    -3.34     0  0  0  0  -  - 99  0
+0067    -3   108488   108365   108069      417     294     5.32    99  -  -  0  -  - 99  0
+        -1   108504   108480   108355      147     123   -11.64     0  0 91  -  0  0  0  8
+        -3   108767   108611   108498      267     111   -15.57     0  0  0  0  -  1  0 98
+        +2   108116   108779   108913      795     132    -1.68     7  6  7  0  0 19  - 65
+        -1   109020   108639   108505      513     132    -9.93     0  0  0  0  0 14  0 85
+        +3   108417   108870   109241      822     369   -12.12     0  0  -  0  -  2  - 97
+        -3   109388   109343   108978      408     363   -10.92     0  0  0  -  - 80  0 19
+        -1   109473   109155   109021      450     132    -7.75     0 14  0  0  0 72  0 12
+        +3   109578   109635   109742      162     105   -14.49     0  0  0  0  0 99  0  0
+        +1   108202   109693   109800     1596     105    -3.06     0  0  3  -  0 96  0  0
+        +2   108914   109658   109828      912     168    -0.31     0  -  0  -  0 99  0  0
+        -3   109946   109916   109608      336     306    -8.30     0  -  -  -  0  0  0 99
+        -2   109978   108838   108317     1659     519    -0.29    18  0  0  -  - 18  - 81
+        +2   109829   109937   110044      213     105   -10.93     0  6  0  0 90  -  -  3
+        +1   109801   109825   110112      309     285    -5.99     0  0  -  0 99  -  -  0
+        -1   110133   109620   109474      657     144    -9.32     0  0  0  -  0 98  -  1
+        -2   110224   110158   110066      156      90   -14.02     0  -  0  4  -  0  5 90
+        -2   110503   110347   110225      276     120    -7.21     0  0  0  0  0  0 99  0
+        +3   109743   110655   110762     1017     105    -5.55     0  0  2  0  -  - 93  3
+0068    -3   110771   110498   109947      822     549     1.10    99  -  -  0  -  - 99  0
+        -2   110824   110794   110660      162     132   -10.97     0  0  0  -  -  0  - 99
+        -3   111020   110873   110772      246      99    -5.64     0  0  0  2  -  -  0 97
+0069    -1   111168   110907   110791      375     114     3.17    97  0  0  0 97  -  0  2
+        +1   110422   111004   111207      783     201    -3.61     0  0  0  1  -  -  - 98
+        -3   111269   111146   111021      246     123    -5.61     0  0  0 29  9  -  0 61
+        +3   110763   111204   111314      549     108    -7.26     0  3  0  0  1 16  - 78
+        +2   110993   111308   111415      420     105    -4.65     0  0  0  -  -  0  0 98
+0070    -1   111531   111477   111370      159     105    -0.10    39 16  -  0 39  0  0 43
+        -3   111599   111404   111270      327     132   -12.41     0  0  0  -  -  2  0 96
+        -3   111755   111746   111645      108      99   -10.36     0  0  0  0  5  0  0 94
+        +1   111208   111652   111768      558     114    -5.79     0  0  0  0 60  -  - 39
+0071    -1   111810   111627   111532      276      93     0.50    58  1  -  3 58  0  - 37
+        +2   111785   111800   111898      111      96   -11.62     0  -  0  0  -  -  0 99
+        +3   111315   111741   111902      585     159    -6.78     0  -  -  0  -  -  - 99
+        -1   111936   111918   111811      123     105   -19.89     0  -  -  -  0  -  0 99
+        -2   112090   111946   111836      252     108    -9.99     0  -  -  -  -  0  0 99
+        +1   111997   112069   112194      195     123   -11.15     0  0  -  9  0  -  0 90
+        -1   112224   112221   112039      183     180    -9.77     0  -  -  0  0  -  0 99
+        +1   112303   112306   112401       96      93   -11.81     0  0  0  0  0  0  0 99
+        -1   112563   112494   112225      336     267    -8.92     0  -  0  0  0  0  0 99
+        -2   112570   112192   112091      477      99   -12.84     0  0  -  4  0  0  0 95
+        -3   112634   112052   111957      675      93    -4.54     1  -  0 17  -  0  1 81
+        +1   112402   112534   112686      282     150   -11.15     0  0  0  0  -  -  - 99
+        -1   112779   112752   112612      165     138   -17.94     0  - 15  0  0  -  - 84
+        -1   112962   112941   112780      180     159   -17.53     0  -  0  0  0  0  - 99
+        +3   111903   112821   112982     1077     159    -8.16     0  -  0  0  -  0  - 99
+        -3   113090   113003   112845      243     156    -7.49     0  -  0  -  -  0  0 99
+0072    +2   112169   112982   113158      987     174     0.47    69  - 69  -  -  0  - 30
+        -2   113188   112933   112619      567     312    -5.82     0  -  0  0  -  0  - 99
+        -1   113361   113310   113155      204     153    -9.73     0  0  0  0  0  -  - 99
+        -3   113405   113321   113226      177      93   -13.62     0  0  0  0  0  -  0 99
+        +2   113159   113258   113428      267     168    -7.51     0  0  0  0  -  -  - 99
+        -2   113428   113413   113294      132     117    -1.84     9  9  0  0  -  9  - 80
+        +3   113079   113274   113474      393     198   -12.59     0  0  -  0  -  -  - 99
+        +2   113429   113444   113542      111      96    -7.11     0 21  0  -  0  9  4 63
+        +1   113125   113572   113889      762     315    -3.57     0  0  -  0 97  -  0  2
+        -1   113937   113874   113383      552     489    -2.24     0  0  -  -  0  -  - 99
+        -2   114358   114121   113903      453     216    -6.94     0  0  0  0  -  0 99  0
+        +1   113899   114289   114405      504     114   -21.03     0  0  0  0  0  - 95  4
+        -2   114565   114493   114359      204     132    -6.31     0  -  -  0  0  0 98  1
+        -2   114685   114664   114566      117      96    -8.20     0  -  0  0  -  0 98  1
+        -3   114812   113558   113439     1371     117    -0.79    28  0  -  -  0  0 28 69
+0073    +3   113475   114678   114848     1371     168     0.26    60  -  0 60  -  -  - 39
+        -2   115021   114871   114686      333     183   -10.74     0  -  0  -  -  0  - 99
+        -1   115053   114885   114715      336     168   -12.79     0  -  0  -  0  0  - 99
+        -3   115091   114986   114882      207     102   -12.71     0  0  0  -  0  0  0 99
+        -1   115239   115173   115054      183     117   -11.99     0  4  0  0  0  0  - 95
+        -1   115365   115350   115240      123     108    -7.96     0  0  0  0  0 68  - 30
+        +3   114912   114924   115457      543     531   -12.31     0  -  0  0  -  -  - 99
+        -2   115660   115390   115022      636     366    -2.25     0  -  0  0  -  0  - 99
+        -1   115722   115530   115372      348     156   -11.48     0  0  9  -  0  0  0 89
+        +2   114458   115709   115849     1389     138    -2.52     0 12  0  -  - 87  0  0
+        -2   115975   115768   115661      312     105     3.52     6 93  0  -  -  6  0  0
+        -3   116144   115493   115299      843     192   -15.89     0  0  0  -  -  1  0 97
+        -2   116443   116410   116291      150     117    -8.42     0  1  0  0 98  0  0  0
+        -3   116537   116294   116145      390     147   -11.32     0 68  0  - 27  -  0  4
+        +1   115039   116197   116658     1617     459    -1.19     0  0  0  0 99  -  -  0
+        -1   116694   116586   115729      963     855    -0.41     2  0  -  -  2  -  - 97
+        +3   116187   116655   117092      903     435    -6.53     0  -  0  0  -  0 99  0
+0074    -3   117131   117071   116538      591     531     1.02    99  -  0  0  -  - 99  0
+        -1   117195   117192   117049      144     141    -8.39     0  -  3  -  0 85  - 11
+        +1   117085   117118   117261      174     141     0.38     6  6  0  0  - 89  -  3
+        -1   117291   117288   117196       93      90    -6.99     0  -  0  0  0  0  0 99
+        +2   116123   117029   117376     1251     345    -6.65     0  -  0  -  -  0  - 99
+        +1   117262   117277   117405      141     126    -7.10     0  0  -  0  -  1  0 98
+        -2   117442   116698   116603      837      93    -8.23     0  -  0  0 12  0  2 84
+        +3   117093   117402   117572      477     168    -2.61     0  0  0  0  -  - 99  0
+        -3   117623   117554   117132      489     420    -3.97     0  -  -  0  -  -  0 99
+        -1   118359   117666   117559      798     105    -8.20     0  3  0  -  0 19  - 76
+        +2   117377   118271   118447     1068     174    -3.05     0  0  0  0  -  0  0 98
+0075    -2   118525   117733   117443     1080     288     0.39    68  0  8  -  - 68  - 22
+        +1   117406   118825   118932     1524     105    -2.67     6  6  -  -  0  0  0 93
+0076    -1   118971   118776   118399      570     375     3.92    99  0  -  0 99  -  0  0
+        -3   118994   118451   118236      756     213   -11.12     0  0  -  0  -  0  0 99
+        -3   119381   119351   119235      144     114    -8.53     0  0  0  0  0 38  0 61
+        +2   118889   119165   119410      519     243    -3.04     0  0  0  0  0 98  -  1
+        -2   119536   119230   118751      783     477    -6.88     0  -  -  -  -  0  - 99
+        +1   118933   119410   119592      657     180    -3.66     0  0  0  0 53  -  - 46
+        -1   119598   119109   118972      624     135    -6.70     0 21  0  -  0  1  - 76
+        +3   119061   119121   119618      555     495    -7.98     0  -  -  0  -  -  - 99
+        -1   119886   119766   119638      246     126    -7.34     0  -  0  -  0 58  0 40
+        -3   119918   119840   119613      303     225   -10.61     0  -  0  -  - 55  0 44
+        +2   119411   119765   120034      621     267    -3.97     0  0  0  0  -  0  - 99
+0077    -2   120169   119740   119582      585     156     1.13    84  -  0  -  - 84  - 15
+        +3   119688   119745   120200      510     453    -9.82     0  0  -  0  -  -  - 99
+        +2   120218   120290   120382      162      90   -16.41     0  0  0  0  0  -  0 99
+        -1   120453   120003   119887      564     114   -12.70     0  0  0  0  0 90  -  9
+        -3   120554   120038   119919      633     117   -12.76     0  0  -  0  0 92  0  6
+        +1   119749   120217   120573      822     354    -8.74     0  0  -  -  -  -  - 99
+        -2   120748   120457   120365      381      90   -12.44     0  0  -  0  0  0  0 99
+        -3   120830   120752   120636      192     114   -11.01     0 21  0  0  1  0  0 77
+        +3   120891   120897   121067      174     168   -12.39     0  0  0  0  0  -  - 99
+        -1   121080   120780   120628      450     150    -6.09     0 10  0  0  0  -  - 89
+        +2   120515   121097   121231      714     132   -11.83     0  0  0  -  0  0  0 99
+        -3   121256   121220   121035      219     183   -13.17     0  0  0  -  -  -  0 99
+        -2   121345   121183   121064      279     117    -7.19     0  0  0  -  -  0  0 99
+        -3   121403   121349   121257      144      90    -8.92     0  0  0  3  3  0  0 91
+        -1   121470   121203   121090      378     111   -10.53     0  0  0  -  0  0  0 99
+        +1   120901   121378   121578      675     198   -13.18     0  0  0  0  -  -  - 99
+        +3   121200   121509   121628      426     117   -16.57     0  -  0  0  -  0  - 99
+        -3   121676   121658   121551      123     105   -19.28     0  -  0  -  -  0  0 99
+        -1   121803   121680   121561      240     117   -18.53     0  -  0  -  0  0  0 99
+        -2   121810   121531   121436      372      93    -3.01     6  0  0  0  -  6  - 93
+        +2   121232   121883   121978      744      93    -2.16    11  - 11  -  0  -  4 83
+        +1   121939   122032   122139      198     105    -7.98     0  0  -  -  0  -  - 99
+        -1   122277   121962   121816      459     144   -12.08     0  -  0  -  0  -  - 99
+        +3   122097   122124   122294      195     168    -8.92     0  -  -  0  -  - 48 51
+        +1   122140   122233   122325      183      90   -12.00     0  0  -  -  -  -  0 99
+        +2   122315   122363   122473      156     108   -17.36     0  -  0  0  -  -  0 99
+        +3   122367   122529   122648      279     117    -7.93     0  0  0  0  0  0  7 92
+        +2   122474   122645   122782      306     135   -14.50     0  0  0  9  0  0  2 88
+        -2   122785   122641   122372      411     267   -16.19     0  -  -  0  -  0  0 99
+        +1   122383   122923   123021      636      96    -9.22     0  0  - 32 50  -  0 17
+        -1   123051   122607   122383      666     222   -10.35     0  0  -  0  0  0  0 99
+        +3   122649   123072   123215      564     141    -7.17     0  0  -  0  0  -  0 99
+        +1   123022   123157   123261      237     102    -6.76     0  0 98  -  0  1  0  0
+        +3   123216   123234   123335      117      99    -8.28     0  - 84  0  -  2  6  7
+0078    +2   123101   123152   123484      381     330     3.22    99  - 99  -  -  -  0  0
+        -3   123584   122357   122106     1476     249    -5.82     0  -  -  -  -  -  0 99
+        -3   123911   123833   123585      324     246    -5.14     0  - 99  0  -  0  0  0
+0079    +2   123485   123767   123925      438     156     1.62    92  - 92  0  -  0  -  7
+        +1   123826   123925   124017      189      90    -6.23     0  0  0  0  0 76  - 22
+        -1   124101   124035   123886      213     147    -6.55     0  -  -  0  0  2  - 97
+        +3   123585   124047   124142      555      93   -14.91     0  -  0  0  -  0  2 96
+        -3   124154   124115   123978      174     135    -1.86     7  -  0  0  -  0  7 92
+        +3   124143   124302   124394      249      90   -18.85     0  -  1  0  0 53  0 44
+        -1   124395   124326   124150      243     174    -9.69     0  -  0  0  0  0  - 99
+        +2   123926   124313   124405      477      90    -5.89     0  -  0  -  -  1  0 97
+        -2   124450   123430   123155     1293     273    -2.83     0  - 99  -  -  0  0  0
+        +1   124471   124498   124623      150     123   -12.32     0  0  -  0  0  -  - 99
+        -1   124632   124593   124471      159     120    -7.19     0  0  -  -  0  -  - 99
+        -1   124773   124746   124633      138     111   -13.96     0  -  0  0  0  0  - 99
+        -2   124849   124612   124520      327      90    -8.24     0  0  5  0  0  0  - 94
+        +1   124693   124801   124899      204      96   -11.00     0  0  0  0  3  -  0 96
+        -1   124905   124875   124774      129      99    -1.82    14  0  0  0 14  -  0 85
+        +2   124514   124676   124909      393     231   -14.23     0  -  0  0  -  -  - 99
+        -3   124964   124853   124707      255     144    -9.77     0  0  0  0  -  0  0 99
+        -2   125572   125044   124880      690     162    -6.43     0  -  -  0  -  0  - 99
+        +3   124482   125322   125657     1173     333    -6.89     0  0  0  0  0  -  - 99
+        -2   125797   125755   125573      222     180    -7.80     0  0  0  - 81  0  - 18
+        +2   124910   125870   125998     1086     126   -11.74     0  0  0  1 86  -  - 12
+        -3   126092   126071   125880      210     189    -5.88     0  0  -  0 99  -  0  0
+        -3   126428   126353   126237      189     114   -13.65     0 19  0  0  0  0  0 80
+0080    -1   126663   125130   124906     1755     222     0.49    74  -  0  0 74  0  - 25
+        +2   126140   126260   126844      702     582   -12.38     0  0  0  0  -  -  - 99
+        -3   127040   126566   126429      609     135   -11.00     0  0  0  0 99  -  0  0
+0081    -1   127098   126798   126664      432     132     7.41    99  0  0  0 99  -  0  0
+0082    +1   124957   127036   127152     2193     114     4.42    99 99  0  0  -  0  -  0
+        -3   127271   127169   127041      228     126    -8.49     0  -  0  0  -  0  0 98
+        +3   125658   126738   127280     1620     540    -1.74     0  -  -  0  -  0  - 99
+        +1   127234   127375   127503      267     126    -3.27     0  0  -  0 98  0  0  1
+        -1   127542   127392   127126      414     264    -2.56     0  -  -  -  0  0  - 99
+        +3   127281   128139   128237      954      96    -5.98     0  0  0  0  0  0 98  0
+        -3   128309   128261   127302     1005     957    -0.49     0  -  -  -  -  0  0 99
+        -1   128523   128397   128302      219      93   -16.08     0  -  0  -  0  0  - 99
+        -1   128658   128616   128524      132      90   -12.86     0  0  0  0  0  0  - 99
+        +2   127484   128765   128956     1470     189    -2.43     0  0  0  0  - 99  -  0
+0083    +1   128389   128875   129000      609     123     0.62    60 60  -  0  - 10  - 28
+        +3   128511   128868   129005      492     135   -10.41     0  -  -  0  -  6  - 93
+0084    -2   129010   128992   126704     2304    2286    -8.14     0  0  -  0  -  0  - 99
+        +3   129006   129066   129191      183     123    -7.89     0  0  0  0  0 98  0  1
+        -3   129218   129077   128931      285     144    -7.04     0  -  -  -  0  -  0 99
+        -1   129246   129021   128917      327     102    -7.55     0  -  -  -  0  -  - 99
+        +2   128957   129182   129427      468     243    -9.40     0  0  0  -  -  0  - 99
+0085    -2   129451   129178   129011      438     165     2.56    98  0  0  0  0 98  0  1
+        -1   129519   129483   129307      210     174   -10.03     0  0  -  -  0  -  - 99
+        -3   129554   129455   129351      201     102   -11.48     0  0  -  -  0  2  0 97
+        +1   129010   129457   129558      546      99   -11.82     0  0  -  -  -  0  0 99
+        +1   129712   129727   129828      114      99    -5.09     0  0  0  0  0 30  - 69
+        -2   129838   129643   129452      384     189    -9.01     0  -  -  -  -  0  - 99
+        -2   129985   129976   129839      144     135    -3.30     1  -  0  0  0  1  0 98
+        +3   129546   129933   130052      504     117   -12.53     0  0 51  0  0  -  0 47
+        -3   130079   129905   129801      276     102   -12.20     0  -  0  0  2  -  0 97
+        +2   129503   129953   130153      648     198    -5.36     0  0  0  -  0  -  - 99
+        +3   130053   130119   130217      162      96    -8.43     0  0  -  0  0  -  - 99
+        -1   130233   129771   129646      585     123    -7.70     0  -  0  0  0  0  - 99
+        +1   129937   130198   130311      372     111   -13.97     0  0  -  -  -  0  - 99
+        -2   130324   130237   130136      186      99   -17.00     0  0  -  -  0  0  - 99
+        -3   130388   130328   130218      168     108   -12.07     0  -  -  0  -  0  0 99
+        +3   130218   130449   130646      426     195   -11.72     0  0  2  0  0 78  0 19
+        -1   130887   130392   130234      651     156    -7.55     0  -  -  0  0  -  0 99
+        -3   130997   130568   130389      606     177    -7.86     0  -  2  0  0  0  0 97
+        +2   130256   130511   131110      852     597    -2.66     0  0  0  -  -  0  - 99
+        +3   130941   130941   131198      255     255   -10.40     0 99  -  0  0  0  -  0
+        +1   130453   130927   131331      876     402    -0.92     2  2  -  -  0  0  - 97
+        -3   131387   131387   131238      147     147   -17.70     0  -  -  -  0  0  0 99
+        +2   131348   131351   131446       96      93    -2.51     0  0  0  0 99  0  -  0
+        +1   131332   131344   131553      219     207    -3.19     0  0  -  0 60  0  - 39
+        -1   131646   131001   130888      756     111    -1.82     1 91  0  -  1  0  0  7
+        +3   131340   131577   131753      411     174    -5.64     0  -  0  0  -  0  0 99
+        -3   131801   131486   131388      411      96    -3.81     2  8  -  1  8  0  2 79
+        -1   131886   131796   131647      237     147    -8.55     0  - 12  -  0  4  2 79
+        +2   131447   131987   132145      696     156   -10.01     0  0  0 11  0  0 67 21
+0086    -2   132172   132172   130337     1833    1833    -6.73     0  - 99  -  0  0  -  0
+        +3   131811   132441   132767      954     324     1.43     0  0  0  0  -  0 99  0
+        +1   132415   132523   132792      375     267   -14.44     0  0  0  -  -  0 99  0
+        -2   132844   132325   132176      666     147   -11.19     0  0  0  0  0  0 99  0
+0087    -3   132860   132830   131802     1056    1026     0.63    99  -  -  -  -  - 99  0
+        +1   132835   132868   133032      195     162    -8.72     0  0  -  -  0  1  0 98
+        -1   133032   132717   132577      453     138    -9.10     0  0  0  0  0  0 99  0
+        +3   132984   133152   133256      270     102   -12.59     0  0 99  0  0  0  0  0
+        +3   133257   133404   133565      306     159   -13.61     0  - 40  0  -  0  0 59
+        +1   133480   133558   133704      222     144   -10.74     0  0 34  -  -  0  0 65
+        +3   133566   133620   133721      153      99    -8.59     0  - 99  0  -  0  0  0
+        -3   133772   133556   133038      732     516    -4.77     0  - 99  -  -  0  0  0
+        -1   133848   133776   133684      162      90   -10.68     0  - 11  -  0  0 83  5
+        -3   133880   133877   133773      105     102   -14.09     0  0  0  -  -  0  0 99
+        -2   133897   132994   132845     1050     147    -3.84     0  0  -  -  0  0  - 99
+        +2   132998   134012   134104     1104      90   -10.76     0  1  0  -  0  2  0 95
+        -3   134141   134033   133881      258     150   -15.83     0  -  0  -  -  -  0 99
+        +1   133996   134044   134145      147      99    -9.30     0  0  -  -  0  3  0 96
+        -2   134158   134053   133898      258     153   -11.22     0  -  0  -  -  0  0 99
+        +2   134105   134105   134296      189     189    -7.65     0  -  0  0  0  -  - 99
+        +3   134088   134229   134345      255     114    -9.29     0  -  -  0  0  0  0 99
+        +3   134424   134583   134684      258      99   -13.72     0  - 72  0  0  1  0 26
+        +1   134614   134647   134799      183     150   -14.16     0  0  0  -  0  0 26 73
+        -1   134811   134409   133990      819     417   -13.34     0  -  -  -  0  -  - 99
+        +2   134324   134741   134983      657     240    -4.05     0  -  0  0  -  0  - 99
+        +3   134685   134919   135014      327      93   -12.80     0  -  -  0  0  0  - 99
+        +1   134968   134995   135090      120      93   -14.38     0  0  0  -  0  0  0 99
+        -1   135327   134973   134851      474     120   -13.02     0  -  2  0  0  0  0 96
+        -2   135448   134452   134159     1287     291    -8.11     0  -  -  -  0  0  - 99
+        -3   135929   135581   134970      957     609    -6.77     0  -  -  -  -  -  0 99
+        +1   135760   135763   135951      189     186   -16.16     0  0  0  0  -  0  - 99
+        -1   136044   135996   135772      270     222   -14.68     0  -  0  0  0  0  - 99
+        +3   135015   136593   136709     1692     114   -13.84     0  -  0  0  -  0  0 99
+        -3   136712   136235   136005      705     228    -4.98     0  - 11  0  -  0  0 88
+        -3   136943   136904   136713      228     189   -16.12     0  -  0  -  -  0  0 99
+        -2   136981   135571   135449     1530     120    -4.07     0  - 28  0  0  0  1 69
+0088    +2   134984   134993   136987     2001    1992    -4.78     0  -  0  -  -  -  - 99
+        -1   137244   137184   136957      285     225    -3.56     0  -  -  -  0  -  - 99
+        +2   137123   137132   137260      135     126   -11.56     0  0  0  2  -  -  - 96
+        -2   137329   137248   137150      177      96   -11.77     0  0  0  0  1  0  0 98
+        -3   137453   137237   137139      312      96    -7.14     0  2  0  1  3  -  0 92
+        +1   137008   137446   137571      561     123    -4.12     0  0  -  0 34  -  - 64
+        -3   137621   137564   137454      165     108   -17.36     0  2  -  0 69  -  0 28
+        -2   137629   137617   137525      102      90   -17.34     0  -  - 67  0  0  0 32
+0089    -1   137646   137523   137245      399     276     1.55    98  0  -  0 98  -  -  1
+        -3   138119   138002   137730      387     270    -3.45     0  -  0  -  -  -  0 99
+        +3   137787   138039   138137      348      96   -11.83     0  0 93  0  -  0  -  5
+        -1   138363   138228   138115      246     111   -18.08     0  - 88  -  0  0  - 11
+        +3   138279   138570   138668      387      96   -10.00     0  - 36  0  -  0  0 63
+0090    +2   137588   137942   139042     1452    1098     2.67    99  - 99  -  -  0  -  0
+        +3   138819   139185   139289      468     102    -8.55     0  0 99  0  -  0  0  0
+        +3   139341   139548   139643      300      93   -15.96     0  0 99  0  -  0  0  0
+        +3   139644   139653   139751      105      96   -12.36     0  0 96  0  -  2  0  0
+        -3   139925   138812   138225     1698     585    -4.96     0  - 25  -  -  0  0 74
+        +3   139752   139950   140042      288      90   -15.55     0  - 98  0  0  0  0  0
+0091    +2   139043   139202   140140     1095     936     2.44    99  - 99  -  -  0  -  0
+        -1   140181   139929   139819      360     108   -15.98     0  - 98  0  0  0  0  0
+        -3   140357   140021   139926      429      93   -10.00     0  - 24  0  0 37  0 38
+        -1   140460   140412   140230      228     180    -7.76     0  0  -  0  0  0  - 99
+        +3   140043   140340   140507      462     165    -3.58     0  0  0  0  -  0  - 99
+0092    -2   140551   140512   137825     2724    2685    -4.11     0  - 99  0  -  0  0  0
+        +1   139999   140398   140559      558     159    -9.49     0  0  -  -  -  -  - 99
+        -3   140765   140633   140520      243     111   -18.53     0  -  -  -  0  -  0 99
+        +2   140540   140618   140785      243     165   -10.16     0  2  0  0 12  -  - 85
+        -1   140988   140604   140494      492     108   -15.27     0  -  -  -  0  -  - 99
+        +3   140844   141000   141179      333     177    -6.08     0  0  -  0  0  -  0 99
+        +1   140560   141088   141183      621      93    -1.77    13 13  0  - 22  0  0 64
+        -1   141402   141093   140989      411     102    -4.84     0  0  -  0  0  -  0 98
+        +1   141184   141190   141453      267     261   -10.70     0  0  0  0  -  - 82 17
+        +1   141454   141454   141606      150     150    -7.28     0  0  0  2  -  0  0 97
+        -1   141903   141825   141724      177      99    -7.85     0  -  0  0  0  0  0 99
+        -2   141958   141406   141242      714     162   -12.78     0  0  0  0  0  0 94  5
+        +1   141736   141769   142011      273     240    -5.49     0  0  0  0  -  -  9 90
+        -1   142218   142149   141982      234     165   -12.14     0  -  0  0  0  0  0 99
+        +2   141086   142130   142381     1293     249   -10.31     0  -  0  0  -  0  0 99
+        +3   141180   142323   142421     1239      96    -3.68     2  -  -  2  0  0  8 88
+        -2   142483   142222   141959      522     261   -10.97     0  -  0  0  -  0  0 99
+0093    -3   142526   142487   140766     1758    1719    -5.32     0  0  -  -  -  -  0 99
+        -1   142713   142491   142321      390     168   -10.76     0  -  -  -  0  -  0 99
+        +1   142357   142720   142821      462      99    -4.75     1  1  0  0  -  0  - 98
+        +3   142539   142764   143033      492     267   -10.35     0  -  0  0  - 94  -  5
+        -1   143058   142938   142801      255     135    -9.38     0  -  0  0  0 69  - 30
+0094    -2   143098   143056   142484      612     570     1.09    99  -  0  -  - 99  -  0
+        -1   143415   143403   143248      165     153    -4.05     0 58  0  -  0 33  -  8
+        -1   143571   143571   143458      111     111    -7.95     0  0  0  0  0 99  -  0
+        +2   142460   143489   143683     1221     192    -4.68     0  0  0  0  - 99  -  0
+        -3   143888   143819   143655      231     162   -14.45     0  0  -  -  -  0  0 99
+        +1   143197   143746   143892      693     144   -17.23     0  0  0  -  -  0  0 99
+0095    -2   143938   143578   143099      837     477     0.65    95  -  0  -  - 95  -  4
+        +2   143750   143822   143944      192     120   -13.31     0  -  0  -  -  -  - 99
+        -1   143985   143970   143857      126     111   -14.74     0  -  -  -  0  -  - 99
+        +1   143893   143971   144120      225     147    -5.00     0  0 88  -  -  -  0 11
+        -2   144229   144130   143981      246     147    -3.60     0  - 14  -  -  0  0 84
+        -1   144303   144111   143986      315     123    -5.94     0  0 81  -  0 13  0  5
+        -3   144344   143981   143889      453      90   -20.25     0  0  -  0  0  -  0 99
+        -1   144762   144504   144358      402     144   -10.51     0  0 34  0  0  6  0 58
+        -3   144860   144584   144345      513     237    -5.22     0  - 92  0  -  3  0  3
+        +3   144102   144816   144926      822     108   -10.12     0  0  9  0  - 84  -  6
+        +3   144927   145053   145172      243     117    -8.72     0  0 78  0  0  0  3 18
+        -3   145283   144956   144861      420      93    -5.48     0  0 19  -  0 11  0 68
+        -1   145479   145422   144835      642     585   -11.68     0  - 99  -  0  0  -  0
+        +3   145173   145734   145922      747     186   -11.77     0  0 99  0  0  0  0  0
+        -1   145959   145836   145480      477     354   -16.86     0  - 99  0  0  0  0  0
+0096    +2   143945   144212   145963     2016    1749     2.07    99  - 99  -  -  -  -  0
+        -3   145985   145880   145305      678     573    -3.74     0  - 74  0  -  0  0 25
+        +3   146058   146082   146261      201     177   -21.64     0  -  0  0  -  0  - 99
+        +3   146397   146721   146954      555     231   -17.15     0  -  0  0  -  0  0 99
+        -3   146996   146627   146202      792     423    -8.83     0  -  3  -  -  0  0 96
+0097    -2   147025   147016   144230     2793    2784    -2.16     0  - 99  0  -  0  -  0
+        -1   147072   147000   146782      288     216   -16.68     0  -  0  -  0  0  0 99
+        +2   145964   146987   147097     1131     108   -13.39     0  -  0  0  -  -  - 99
+        +3   146991   147033   147131      138      96   -12.90     0  -  -  0  -  -  - 99
+        -2   147346   147343   147062      282     279    -8.69     0  0  -  -  -  0  - 99
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/glimmer_w_icm_trans-table-11_genomic.fasta	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,1140 @@
+>orf00001 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCGAATGATCCGGCGGGCGAGTACGGGGCGTGGATTCACGAACTCGGTTTGTCCGAG
+GCAATCGCGCGAAAAATCGTCGCGCCTTTTGAGATTGACGTTTTGGAGATTACTGATCCT
+GAGCCGGAATTGATGGAGGGATTGGATCGGGAGGCGCGGCGTGGGCGGCGGCTTGCGTTG
+CTTCAGACCGGGCTTTTGGAGCACGCGGCCGAGCATAATATTTGCACCATGATGACGCTT
+CATCAGCAGGTTGAGGAGGCGGCGGCTTTCGCGGAGAAAATGCCGGAGACGGCGGCGGAG
+CTTTACCGGAATGAGGTGTCGGCGGAGGATTTTGCCCTGGCCGAGGAGCTCCCGGCCTCC
+GAGGTGGGTGGGGGGTTCTACGAGCTGGAGCCGGGGCGTCATGTGCCGCCGTCGCGGGTG
+TGGTCGCGGTGGCTGTATGGGGAGCATCCTGTGGCCGAACGGCGTTCTGTGCTGCGGGAG
+TTCGCGAACGGGATGGACGCGGAGGGGCGGCGGGTGCACCGGGCGTTCCTCGCTTCCGTA
+CGGGTCCTGGGTGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTT
+GCCGACGCACGCGGGTCTCAGGTGGAGATCGTGCAGAACATCGGGCGCGCGTTGCGCCAG
+AACCCGGATGGGCGGGCGAAGACGGCGCGGATCATCGTGCCGGTCTTCCTGCGGCCGGAC
+GAGGACGGGGAGGGCATGGTGGCGTCGGAGGCGTACCGGCCGCTCGTCGCCGTACTCCAG
+GGCCTGCGCTCGCACGACGAGCACCTGGTCGAGAAACTCATGCTGCGGGCGCGCGTACGG
+GCCGAGAGCGCGAGCGCGCGCAGCGCGGAGGAGGGCGGTGCGGGGCCCTCGCGGCTCCTG
+TCGGACTCCGGGACGGCGGCTGCGGCCTCCGAGGGCGTCGAGGGCCAGGAGCAGGGCGAG
+GACGGCGCCGAGGCGGAGTCGGTGCTGCTGCGGTTCTCCTCGCCGCGCGCGGCGTCGACG
+GTCGCGGCGTTCCTGCGGACGCGGGTGTACCAGCCCGAGTCGCTGGTGTGGCTGGAGGGG
+TACGAGGCCCTGCGCGCCTGGCGGGCCGAGCAAGGGGTGAGCGGGGTGTGCGCGGTCCCG
+TACGACGCCGAGGTCGCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGACCGCC
+GCGCAACGCCGCGCCCGCCGCGAGGGCACCCTCAGCGCACACCGCGTCGAGCTCCTCGAC
+GCGGAGGGCATGGTGTGGGAGCCGCGCGAGGAGGAATGGGAGCGCACGCTCGCGGGGCTT
+CGCTCCTACCGGACGGCGTACGGGCACCTCGCCCCCCACAGGCGCGAAACCTGGGGCGAA
+GACGAGGGTGAGGACGTCGTACGCGTCGGGGACCTGATGGCGAACCTCCGCCGCAAGGAC
+GGACTCGGGAAGGACGCGAAGCGGGCCGCCGCGCGCGCCGCGCAGCTGAGGGCCGTCGAT
+GCGGACTGGGACTGCCCGTGGCCGCTGGACTGGCAGCGCTGCTGCCGGAAACTCGTGCTC
+CTGGCCGCGGACGAGCCCGGCGGGCGCCTGCCGGAGATCGCGCCCGGGGTCTGCCTGGAC
+GGGGATGACCTCGGGGTGTGGGTCGCGCGGCAGCAGGAGCCGCGGGTGTGGGCGCGGCTC
+AGCACCGAGCAGCGGGCGCGGCTCGAAGCGCTCGGGCTGCGGCCCACCGAAGCGGCCCCG
+GGGCGGGGTGTGGAGGGCACGGGGGCGGCGGGGAGCATGAAGCGGACGGCGACGGCGCGA
+ACGGCTTTTCAGCGGGGTGTGGCGGCGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGGG
+AAACCCGTACCCCGCAAACACGTCGAGACCGTCAGCGTCGACGGCGAGGACGTCGACGTA
+CGCCTCGGCGTATGGATCTCGAACACCAAGAGCCGGTACGACGGGCTGAGCGAGGACGAA
+CGCGCGCAGCTCACCGCACTCGGAATGCCCTGGGCAGGATGA
+>orf00002 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAATCCACGCCCCGTACTCGCCCGCCGGATCATTCGCCATCGTCACGAGTGCCGGCGC
+CTCCCCGCGTCCCTCCTCGCCCTCGTGCCTGGCGGGACGGGCCGGGGCCAGGACGCGCGG
+GGTCGCGGTGAGGTACAGCCGGTGCGCCGCCGGAAAACGGGCGTTGTCGTGGATCGCCGC
+CCACGCCTTCTCCGCGCTGCCCGCCGTGCGGTGCGCCTCGTCCACGACCGCAAGGTCGAA
+GCCATCCATCCGCTGCCCGTACAAGCCAGCCCCGGCGAGAGCGGCCTCCAAGGGTCCGCC
+CTGCCCGTCCTCGCCCACGAGCGAGGAGTACGTCGCCAGCACGACCACCGGCCCCGATCC
+GGCCCAAAGCGCGAGCCGGATCGGGTGGGTCGTCGTCCGCACCCGCAGCTCCTCCAGGAG
+CAGATCCCTGGGCAGCGAGCACACCCCGACCATCGGCGCCGTGTGCCCCACCGCCCGCCA
+CGACTGCGCCGTCTGCACCAGCAGATCCAGCGTCGGCACCATCACGAGAACCCGCCCCGA
+AGGGAACAACTCCAACGCCGCAGCAGCCGCGCTGATCGTCTTTCCCGTACCCGTAGCGGA
+CACCACCGTGGCCCGCGCCCCACGCTCCGTGCGGGCGCTTTCCCGGGCGGCTACCCGGAC
+CCATTTCCTGAGGTCCGACATAAGCTCTACCTGATGTTTCCGCAGCGGAACCCGGGAAAC
+AGACATTTGAATCTCCTCACGAGGCAGACGAGCCAAATCCCCAACTCAACATATGCATCA
+ATTGGGCTGCGTTGA
+>orf00003 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCTTCACGGCGCATTCTTCGACAGTCCGGTGAGGAATCTCCACGGCGTCCAGGTCAC
+CAACAGGGGCTGGATGAGCATCTTCGTCAGCAGTATCTCCTACACCGCGACAGTCAAAGC
+GTCAAGCGGTAG
+>orf00006 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCGCCGTCAGCCTATGGCGGGCCACATGCTGCGGCGGGTGCCGAGCCCGCCCTTACC
+GTCTCCGGGGTAGAGGTAGAGGTGGTCGACGCTGTTGAGAACAACGATGTCGGCGTTGCC
+GTCACCGTTGAAATCGCCGCTCAGCAGGGCGTGGAAGCCGCCCCAGCTCGCGTCGTCCCA
+CATCAGTTTGGCGTTGGCGAATGTACCGTCCGTCTTCCCCGGGTAGAGGGCCAGTTCGCC
+CTTCTGGGAGATCGCGGCGATGTCGTTGAGGCCGTCCCCGTTGAAGTCGGCGCTGGTGAG
+GAACTTCTTGTCCCAGGTGGCGTCGTGCCACACCTCGGTGCGACTGTCGGTGAGGATGCC
+GTTGGCCCCGGTCGCGTACGCGTAGAGGCGGCCGGTGGGCGCGATGGCAACGAGGCCGTC
+GCGCGTCCAGCCCTTGGCACGGTACGTCGTCGGCAGGTAGCTCGCGAAGGTCTTGTCCTT
+CCACATGCTTGCCGCCGGGCTGAGCAGGTCGCCGCTGGTTCCGGCGTAGTTGTGGAAGGC
+GCCGTCGTCCTTGAGAGCCGCGATGTCGGCGTTGCCGTCGCCGTTGAAGTCGCCGCCCAG
+GATGCGGGCCTTGGAACCCCAGGTGCCGTCGTGCGCCCACAGCTCGCGGCCATAGGTGAG
+CTTGCCGTCACTCGTGCCGTAGAAGGCGTACAAGTTGTTGTCGTCGAGGATCGCCGCGAT
+GTCGGGGTGCCCGTCGCGGTTGAAGTCGCCGGTGGTGAGGTGCTTGATCTGCTCCGGGGC
+GCGAGCGGCGAGCCTGTTCTTCGCGATCCAGTCGCCGAGATCGTCGACGCGCGAGGAGAT
+TCCGTCGGAGCGGGTCTCCGTCGCCTCGATACCGAAGCACCCTCCCTGGTAGGAACGGGA
+GTTGATGCCGACGAGTTCGGCGTTGCCGCCACTCTCGCGCAGCAGCGGGCCGCCGGTGTC
+CCCCGCACACAGGGCCTGTCCGTCCTGCCCGTGGAAGCTGATGTCCTGGCTCTGGACGGC
+GTCGATGCCGAGGGTGGCGGTGTGCAGGCGCAGCGGGGCCCACTCGGTCTTCGTACGGCC
+GAATCCGGCGGCGGTCAGGGCCTCGCCGGCGCTCGGCTGCTGAGTACCGACGGTGACGGG
+AGCCACCCCGGCGACGGGCTTGTCGAGCCGGGCGAGCGTCACGTCGCGGTCGGTGCGCGG
+AACGAGCTGGACGACCTCGCGGACCTCGCCGGTCCCTGTGGTGAGGTCGGTACGGCCGAC
+AGTGGCGGTCGTGCGGAGCGCGGGCGCTCCTGCGGGGATGTCGATGCTCGTGGCCGGGTT
+GTCGGCGAAGCAGCTTCGCGCGGTAAGGACCCATTGGGCGTCGACCAGAACCCCGGAACA
+GCCCCGGGTGCCCTTCCCGATGTCGAGGCGGACGGTGAAGGACCGTGCACCGTCCCGGAC
+CTCCGCGCCGGTGGTGGCACTCGCCGGAACGGCGGCCACGAGCGGCATCATGACGGACGC
+GGCCGCTATAGCGACTACCCGCTTTTTCTTGAAGCCCTTGTTCATGTACTACTTCCTCCT
+CAACGTCACTTGGTGGTGGATATCTCGACAAGTGCGTAG
+>orf00007 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCACGCGGAGTTGGAGGCCGAGGGCAAGTCAGTGGAAGTGGACGTGAAGAAGGACGAG
+TTCAAGGGAGTGGGCGAGGGAGTCGGCGACGCCCCCACGGTTCTCCTCGAACTCCGCGTC
+ACCGGCTGA
+>orf00008 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGACGCCGGGGCCCGCACCGTTCATCAACTGGGTGATGCGCACGCGGAGGTCATTGGAG
+ACCGCCTGGAACTGTCCCGTCCTCAGGAACTCCTGGATCGGGGCGTCGCCTTCCTCCACG
+ACAGCGGCGGCGGCTGTCCGCACGTCCGCCGACGTCGAGTCGGTGGCGAGCGTCTCGGCA
+CGCGCGCGCCGATCGAGAGCGGCGGCCTCCTCGCGGCCCTCGGCCACGTACCGCACGACG
+TCGTCGGCGGAGCCCGCGAGGGCGACCTCGGCGGCGCTGACGCTCCACGGGCCTCGTGTC
+TTGACGGTGTTGAGCGCGACCTTGCGTGCCTTGGGCGCGAGGGCGTCGGTGTTCTCGCCG
+GACGCGGAGATCTCCTCGGCCAGCTCCGTTGCCTCGGAGTCGAGCGCGGCGGCGGCGTCG
+GCCTGCTTCTTGCCCTCGGCGATGCGCTCGTCGTCCTGGTCCCGCAGCGAACGCGCTTGC
+TCGACGGCTCCGGCCGTGCGGGAGGCCAGCTCCTCGGCCTCGACCTCGCGGGCGAGCGTG
+AACGTGTCCTTGGCCTGCTGGACCGCGGCGCTCGCCGCGTCCGCGGCGGTCTTCGCGGCA
+GCGGCGTGCTTGGTGGACTCGGCCGCGGCGGTGGCTGCCTCGCCCGCGTGCTCCGCGGCC
+TCCTTGGCGGCGGCAGCCGCCTTCTCGGCGTGCTCGGCAGAGGCGTTGGCGGCGTCCCTC
+GCCTCACGCGCCGCCTTGGCCGACTTCGCCGCGAGCGAGTCGGCCCGGTTGGCGGCGGCC
+GTCGCCTCGGCGGCGTGCCGGTGCGCCTCGGCGGCGGCGGCCCTGGCCCGTGCGGCCTGC
+GCGTCGGAGACGCCGGCCTGGCCGCTCGCCTCGGACGCGGCCGACGCCGCGGCGTCGGCG
+TTCTGCCCGGCACTGGCGGCTGCCTGGGCGGCGCCGGCCGCCTCGACGACGGCGGTGGCG
+GCGAAGTCGGCGGCCTGGGCGGCCTTCTTCGCGCCCTTGGCGGCGTCCAGGGCGTCCTCG
+GCCGCGGAGCGGGCGGCGGACGCCTTCCCCGCGTCGGTGGCCGCTGCCGCGGCGGCGTTC
+CGGGCCCGAGCGGCGGCGTTGGCCGCGGCGGCTGCCGCGGAGGCTGCCTGGGCGGCGGCG
+TTGGCCGCGACGCGGGCGGCCCGGTTGGCGGCGCTGGCGGCGTCGATGGCCACCTGCGCG
+GCCCGTGCGGCACCGCGCGCGGCGTCGGCGGCACGACCTGCCGCGTTCGACGCCCTGACG
+GCGTCGTCCTTCGCGGCCTCGGTCTCCTTGGCCGCCTTCTGCGCCGCCTCCTTGGCGAGC
+TTCGTCGCCTTGATCGCGCGATCCGACGCTTCCTTGGCGCGGTCGGTCTCCACCCGCGCC
+TGCCGCCCGGCCTCGGTGGCCTGCGTGGCGAGATCGGCCACCGTGGCCTGCTCCTGGTCG
+CGGGCACGGGCAGTGTGCTGCCCGACCTCCAGGAACTCGCGGATGTCGTTGATGTCGCCG
+TTGAGCGCGACGCGGGCGGCCTCCTTGGTGGCCTGCCCGCCGGTGCTCATGATCTGGACG
+ACCTGCACCCTGGCATCGTTGTCAGCGGCGGTGTACTGCCCCTCGGAGAGGAACTTCCGT
+ACCTCCTCCATACCCCCGTTGAGCGCTTTGCGCCCGTCGGCCGCCACCTGCGGTCCGGCC
+GCGGAGGAGATGATCTGGGTGACCTGGACGCGCTGGTCCTGTTCCAGAGGCTCCTTCCAG
+CCGTCCTTCAGGAAGTCGGCGAGGCCTTCCTCGGGGCCCGCGAGGGCCTCCTCGGCCGCC
+TCGCGGACGGCGCGCCCGCCGAGCGAGAGGATCTGGACCGTGGCGACGCGGTCGTCCGCC
+GTCCGCGCGAGCGCCTCCTCCCCGTCCAGGAACTTCCGTACGTCGGCGTCCGAGCCGAGC
+AGGGCTGCCTCGGCGGCTGCCTTGACGCCCGGCCCGCCCTCCTCCCACGCCGTGAGCACC
+TTTCCCCGGTCGGTCGCCGGCAGGTACGCGACCGGCGTGTAG
+>orf00009 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCATCACCCAGTTGATGAACGGTGCGGGCCCCGGCGTCAAGGAGGCGGGCCAGGCC
+GCGCTCAACGACGGTTCCCCCGCGAAACTGCGGGACTTCGTCGACAGCGGCTACTACGTG
+CAGCGGGCCAACGACGAACGCGTCCAGGCGACGCAGCTCGTCGGTTCCGGGACACCGGAG
+GAGAAGGCCGCCGCGCGCATCGCCCTGGAGGGACCGCCGCAGGTCCTGCACGCCTTCACC
+GAGACCGGCCGTTTCAAGGCCAAGCGGCAGGACCTGCTCACCGCGACCCACACGGCGCGA
+GTCCAGGGCCTGATAGCCAGCGCCGCCAAGGTGGCGGCCGTCGCCCAGCAGAACGCGGCG
+CTCGCCGGTGAGACGGCGGCGAAGGCGCGCAAGGCCGCCGCCGAGGCGAAGAAGTACGCG
+GACCAGGCGAAGGCGTCGGCCGAGCAGGCCGCGTCCTACAGCAAGGACGCCGACGCCTCC
+GCCGACGCGGCGCAGAAGTCGGCCGACCAGGCGGCGAAGTCGGCGAAGACGGCCCGCGCC
+GCCGAGGCCGACGCCCACGCCGCCGCCCGGGACGCGGACCACTCCGTCGCCCGCGCCGAG
+GCGTCCGCCGCCTCCGCGCACGGCTCCGCCAACTCCGCCTGGGCCGCCGCCGGTGCGGCA
+CGCGCCTCCGCCGAGGCGGCGGGCAAGGACGCCGACGCCGCGGCCGAGGCGATGACCGAG
+GCGCTGAACGTCGCCGCCGAGAAGCAGTGGGCGGAAATCCGCAAGGCGCTGGAGGACGAG
+CAGGACCGGGCCGACCAGGCGTCCCTCCAGGAGCTGGAGGAGTACTTCGCCGACCTGGCC
+AAGCAGCAGGAGAGCGGCGACACCGACTGGTGGGACCTCGCCACCCTGGGGCACACGGTC
+CTGGACACGGCCGGGCTGGTGCCCGGTTTCGGGGAGATCGCCGACGGTATCAACTGCGGC
+TGGTACGGAGCCGAGGGCGACAGCCTGAACGCGGGCCTCTCCTGCGCGGCGATGATCCCC
+TTCGTCGGCTGGGGCGCGACCGGCGGGAAGTGGGGCAAGCGCGGTGTTGACGCGATCGAG
+GCGTTCAACAAGGCCATGCGTGCGGAGGGGAAGGTCCCGCACATATGGTCGGCCAATCCT
+CGCAAGGGCCGCAACAACGTTCAGAACGCCTACAGCCACTGGAAAGACCACGGCGCCCAG
+TTCCCCGAGCTGAACAACGCGCTGGACTACGTCAAGAAAGCGCGGCAGTACGGGGACATG
+GCACTGGCGCAAAAGCCGGTGAAGGGCTATCGCGTCTTCTCGCAGAACGGCGGTGCGGTG
+GCGATCTTCGACGAGAGCAACGGCGCTTGGGCCGCCTTCACGAAGGACGGGATCCCGCAG
+ACCATGTACAAGCCCGAGCCACGCAGCCAGAGCAATCCCAACGGGTACGCGACCACCATC
+GAGGACTGGCTCGCCGAGCCCGGCCGCGGCACAGAGATACGCTGA
+>orf00014 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGCCACCAGCGGCACCGAAGCCGTCACCGGCCTCTCCCTCCCCGAGGCCCGCCGC
+GTCGCCGTCGCCGCCGCCGGCCTCAACCCCCCACTGGCCGAGGCCACCCCCGCCGCCGTC
+CTGGACCGGCTCCGCATCGTCCAGCTCGACTCCATCAACGTCCTCGCCCGCGCCCACCAG
+CTCACCCTGGCCGCCCGCCTGCCCCACGCCACGTTCGCCGGCATCGACGCCGCCCTCGAC
+CAGGCCTCGCCACCGCTCGCCTTCGAATACCCCGCCCACGCCCACGCCCTGGTCCCGCTC
+GGCGACTGGCCCCTGTGGGCCTTCCGCCGCCGCGCCTCCCGCGCCCGCCCCGAATACCCC
+CCGCCCGCCGAACGCGAACGCATCCTCCACCTCGTCCGCTCCCGCGGCCCGCTCACCCAC
+CGCGACCTGCGCCCCGAGGGCGAACAACCCTCCACCGGCTGGAGCTGGGGGCCCGTCAAA
+CGCGCGGTGGAGTTCATGCTCTGGGCCGGAGACCTGATCTGCGTACGCCGCACCCCCACC
+TGGCAACGCCTCCTCGACCTCCCCGAGCGCCACCTGGCCACCGCACTGCACACCAACCGC
+CTCACCGACGAGGAATGCCTCACCGCCCTCCTCACCCACGCCGCCCGCGCCCTCGGCATC
+GCCACCACCGCCGACCTCGCCGACTACCTCCGCATCTCCACCCGCACCACCGCCGCTCTC
+CTCCCGCACACCCCACTGCTGCCCGCCACCGTCGAAGGATGGACCGAACCGGCCTGGGCC
+CACCCCGACGCCCTCACCCCACCCGCCCCGGCAGACGACCCACCCGTCTTCCTCGGCCCC
+TTCGACAACCTCATCTTCAACCGCCCCCGCACCCAACGCCTCTTCGGCTTCACCCACACC
+CTGGAGGCCTACAAACCCGCCGCGAAGCGCGAGCACGGCTACTACGTCTGCCCCCTCCTC
+CACCACGACCAGCTCATCGCCCGCGCAGACCTCACCCGCACCACACACGCCGTCACGATC
+ACCCAGACAAGCACCGAAACCAACGCGCCCGGGAACGCCAGCGCTCTTATCCACGAAGCT
+CTGCAACACCTCACCCACGCCGCACAGTGA
+>orf00016 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCATCTCGGCGTCGCGGTCCGCCTCCCGCAGCCGTACTTCCTCATGGTCCTGCCCCT
+GGACCCGCCCCTGCCCGGCCTCCACGTCCCCGTCGGGATCATCGGCGCGAAGACCGTGAA
+CACCATGACGGACATCAGCATCGCCATCCACCCCACCCACCCCGTCGCCGTCCGCCGCGA
+GCAGCCCGTCGCGCGCCTCGTGCTGCTGCACCCCGACACCCTCCGCGCCACCAGCACCAC
+CACCCCCCTCACCGCCGCGCCCCCCGCACCCGCGTCGAGCCCACCCGACCCCGCCGGGCC
+GGCCGCACCGGTCGCTGCGCCCAACACCACGATCCTGGACGCCTCATGACCCCCACTCCC
+GCCGCCGCGACCCCCACCCCGCAGGCCCCGAGCGGCTGGCCGGTCCTCGCCCGCCGCCCC
+GTCGCGCCGCTCCTCGCGCTCGCGTTCGCGGCCCGGACGACCGCGGCCGTACTTCCCATC
+GCGCTGCTCCTGGCGCTCGCCGACCGCTACGGGTACGCGCGCGCCGGACTCGTCGGCGGC
+ACCACCACCCTCGTCCTGGCCCTCCTGGTCCCCCTGCGTGGCCGCGCCCTCGACCGCTTC
+GGCCACCGCCACGCCCTCCTGATCATGGGCACCGCCACGATGACCCTGACCGCGACCGCC
+GCCGGGAGCGTCGCCGCCCGCTGGCCCTGGTGGACGACCCTCCTCCTCGTCCTCGCCGCC
+AACCTCACCAACCCGCCCCTCAACGCCGCCCTGCGTTCCTCCTGGCGGCGCCTGGTCACC
+ACACCCACCCAGCTCAAGACGGTCCACTCGGCCGACAGCATCCTCGAAGAAGCCGGCTTC
+GTCGTCGCCCCCCTGACCGCCGGAGTCCTCATCACCTGGCTCGGCCCCGTGGCCGCCTAC
+GAAAGCGCCACCGCCCTCTACCTCACCGTCATCGCCCTCTACCTCACCGCCGCCCGCCTC
+TGGGGCCTCACCCCCACCAAACCCCCCGCCGCGCAGGCCGGGCGGAGCGAGCGCGCGCGG
+CGCGCGCACCGCTGGCTCGGGCCACTCGCCCAGCCCCGCATCATCGGGATCATGATCCCC
+ATGCTCGTCATGGGCACCCTGTTCGGCGGGACCAGCATCTACGTCCCCGCCTACAGCCAG
+CACGAGCACGCCACCACCCTCATCGGCCCCCTCCTCGCCGCCACCAGCGCCGGCGGCGTC
+CTCGGCGGCCTCCTCTACGCCCTCCTGCCCACCCAGCGCCTGGCCCCCTGGACCCTCTAC
+CGGCTCCTGACCGCAGGGTTCGCGCTGCCCGCCTGCTTCCTCCTGGCCGCCCGCCCCCCC
+TGGGCCCTCGCCCTCCTCCTCCTGCTCAGCGGCTTGTTCGTCACCCCGCTGTTCATCACC
+GCGTTCCTCCTCATCGACACCCACGCCACCGACGACGTCCGCACCGAGGCCAACACGTGG
+GTAGGCGCGAGCACGGACGTGGCCAACGGCGTCGTCGCCGCCGTCATCGGCGCCCTCACC
+GCCCACAACAGCTTCACCACCGCCCTGACCGTCCTCACCGCCTGCGCCGCCCTCGGCCTC
+CTGACCGCACTCCTCCTCCCCGCCCCCGAGAAGAGCACCGTGCCCGAAACCTCCCCACAC
+GTGCCCGCCAACGACGCACCGGCCACGACCGCGTGA
+>orf00017 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCACTCCACGGTGCCCTGTCCGTTGGGCAGGAACATCGCCTCCCACTGCCCGCTGGA
+GTTGCGGAAGTCGTAGCGGCGCAGCCAGCTTCCGCCCTGGTCGGGAACGGCGATCCAGTC
+GGGGCCGCGGCGCCACATCTGCCCGCCGCCCGCGCGGCGGCTCACCGCTCTGACGTCCTC
+GTCCTCGGGCACGGCGACGTCCGTGTCCGACAGCGGCGTCAGGGTCGCGGTGACCGGGGA
+GCGCACCACCCAGCCGAGATCCTGGCCGAGCGCCCACGGCGGGCAGTCCGCGGGCAGCCG
+GGCGATCCGCGCGTGCCGGAAATGCGCCGCGTACAGGTCGCGCTCCGACCGGGCGGCCGC
+CCGGTCGGTACGCGGCTTGTCGGGCGGCAGGCTCCACGGGTAGAGCGCGGTGAACGCGAC
+ATCAACCATGAGGGCTCCTCGAAGTGCGCGCGGCGAATGGACAACGAGTCAGGACCAGCG
+GGGGACATGGGGGCGCCCGCCCCGGGCGCGGCGCGATCGGCGGCGCGTCGCGCCAGGAGC
+GGGCGCGGGGACGGGGGCGGGTCAGGTGGTGAGGCGCTCGGTGCGGCGCTGGCGTTCCTG
+CTCGGGCAGGGTGTCGAGGTCGAACATCGTCACCGAGCAGGGGCCGAAGCCGACGTAGAG
+GGGCTCGGTGTCGAAGACGCCCTCCTCGCGGTCGAGAGGCGCGCTGCCGAGGTCGATGAC
+GGTGAGGGTGTTGGGGTCGTAGTCGAGCTCCGGGGCCACCGCGCGCAGGTTCGTGCGGGA
+GAAGTTCGTGACGTACGCGGTGGAGTCGGCGGGGTCGACGACGAGGCCGCGGGGGCCGCC
+GCCGACGGGGATGTGCCGGGTAACGGCGAGGGTGTCGACGTCGATGACGTAGACCCGGCT
+GATGGACTCGACCGTGATCAGCGCGTGGCGCCCGTCCGGGGAGAAGGCCACCCCACGGCC
+GCCGATGAAGCCGACGTCGACACGGTGGGTCTCGTGGGTGGCGGTGTCGATCACCGTCAC
+GTAGGTGGCCTGCGTGTTCGCGACGAACACCCTGCGACCGGAGGGGTCGATGCCGAGGCT
+GTAGGGGTGGGCCTTCGCGTCGACGGGAATCCGCGCGACCTCGGTGACCCCGGCGGCGTC
+CTGCCGTTCCACCAGCGCCGTGAGGTCGAGCTTGCTCACGTAGCCGGCGCCCCACACGCA
+CACCCACGCACTCCGGCCGTCCGCGCTGATCCCCATGTGCCGCGGGTCGCGGCCCACCGG
+CACCTGGTGGATCTCGACGTTCAGCTCGAGGTCGACGATGCTGACGGTGTCGGAGCCGGA
+GTTGGAGACGAGCAGGTACGTGTCGCCGGGCAGCAGCCCCTGGCCGCGCGGGCCGTGCCC
+GACCTCGATCCGCCGCACCTCGGTGTGGGCGACCGGGTCGATCTCGCTGATCGTGTTCTG
+CGAGGTGTTGCACACGAACCCGCGCCCGGACCTCGTGAACTTCACGCCGCCGCGCGGCGC
+GTTGCCGACCCGGATCTGGTCGATCCGCCGGTGCTCGCCAGGCCCGGCCTTCGCCACGAC
+CGAGATCGTGCCGTCGTCGGTGTCGGTCGAGAAGAACTCGACGTTACGTGCCATGCCGTA
+CTCCCTGTTTCCGATTTTCCCGTGGAAGGGACTGCGCCGCTGTATCTCAGCCGCGATGGA
+GCGAGTAGTTCAGGTTCCAGGAAAGGGAAATACGCACCTCGTCGTCCTGGAATTCGGGCA
+CCTCGTGACGCAGCCACCCCGGAATGA
+>orf00020 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCAGCAAAAAGAACACCACATGGACGTGCGACTCCAACAAGATCAACGGGGTGAACTC
+GACGTGGGGCAACATGAAGGTGTCGTACACCCACAGCACCTCGGGCACCCCCGACGGCCG
+CGCCCGTGGGATCATCACGGCCTACTACCTCAACGACTGCGGTTGCTTCGCCGCTGA
+>orf00021 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTGGAGGGTGTCGTAGAGGAGTGCGGCGTCCTGTGCGGGGGTGCGTGGGGTGCCGGT
+GCGCAGGGCGATGTGGTGGGTGAAGAGGGCCCAGGCGAAGGCGGCGGGGTTGGGGCGGCC
+GATGACGCGGGGCCAGTCGGTGGCAAGGAGGGTGAAGACGTGGGTGACGAGGATGTGGGC
+TTCATCGGTGGGGAGGAGGGCGCCGGCGTAGTCGCGGTAGGCGAAGTGGTTGAGGTCGTA
+GAAGGCGTGGAAGGCGGCGGCGGTCGCGGCCAGGGTGCGGGAGGTCATCGCCGTCTCAGC
+CGAAGTGCTCGGCGCGCAACGGCGAGGGCGTCGAGGTGCGTGCCTGGGCGACGGCGTGGT
+GGTGGGCGGCCTGCCAGAGGGGGCGCATGTCGCTGGGCAGGCTGA
+>orf00022 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCACGGTGGAGGCGAGGGCGTCGCCGAGGGTGTGGGGGGTGTGGCCGCAGGAGAGGAG
+GAGGCCGGCGAGGTAGTCGCGCAGGTAGGCGACGGGATCGGTCTCCGGGGGCGGTTCGAT
+GCCGGCGGCGACGTTGTAGAGGGGCAGGAGGAGGCGCTCGGCGATGCCGAGGACGCGGGC
+GAAGTCCCGCACGTGGGGCCAGTGCAGGGGCTTTTCCCCCGACAGGAGCCGGGAGACGTA
+GGAGGGGTGCCTTCTGATCGCCTCGGCGACGGCGCGCTGCGAGGCCGCGGAGCGGCGCAT
+CGTGTGGGAGAGCGCGGCGCGCAGGCGGTCGGCGGCCCGGCGTTCGGAGCACTCCTGGGC
+GCGGGGCAGGGAGGGCTCCTGGCCCGGCGGGCCTTCGGAGTCCGTCGCGGCGAAGACGGG
+GGTCGGGTTCCACGGGTCCATGTAGGGGGCGAGGACGCGGTCGAGGTGCTTCTTGTCGTA
+CTTCTTGCGGACGTGGTCCGCCGAGACGGAGAGGTGGGCGGCGACGGTGGCGTGGGTTTC
+GTGCAGAGCGCGGGCCCGGGCGACGGTGGCGGCCTCCACGACGGTCAGCGCGCGCTGCAG
+GCACGCGACGGTGGTGAGGAGGTCGCCGGTGGGGGCCGTGGTGCCGTAAGCCTGGTGCAG
+CAGCGCCGCGGCGTGGCGGGCGACGGTGTCGGTGGCGGCGTGCAGCACGTCTTCGCAGAA
+GGCGCGCGTCTGCCGGTCCTCTTCTTCTTTCTGCCGCTGGGCCGGGGTGCGGGTACGGCA
+GTGCGCGCAGCGGGCGGCGGGCCGGCCGGAGCGGGCGGGCTCGGGTTCCAGCGGTGTGCC
+GCAGTCCTGGCAGGAGCGGGGCGCGGGCGGGCGAACACTCATGTGTCGGGTCCTCAATCC
+GGGGGTTCTTACTGCGTCGGGGTGGGGGTTTTTCCCCACCCTGACGACGCATCACGCGGC
+CGGGCGGCCGTGGCAGGGGCCTCGTGA
+>orf00025 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCGCGAGTCCTACTCCCTCCGCTCCTCCGGAACGCCGTCGTCCAGGACGATGCGGAT
+GGCGCCGGCTATTTCGTGGTCGCCGCCGGTGGCCTCGGAGAGCTCGTTCGCCATCCTGGT
+GTAGGTCGTCACCGCCATCGCCCAGTCCCCGTCCGGGGACTCGGCGTCGGCTCGCGTGTC
+CCACAACGTGATCAGCAGCGCGATGAGTGA
+>orf00028 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCTTCATCCAGCGTCCGCAGACGCTCGGTTCAGGTGGGGATCGCGACGGCTGTTGTG
+TCGGCCGTGGCGGTGTGGGGAATGCCGGCCGCGTACGCGGCGGCTCCTGACGCTCCGTCG
+CAGCTGGTGGCGCTGACGGAGAGCACGGCGCCGTACGTGACGGCGAAGGTGGTGGCGCCG
+TCGGGGAGCGGGAAGGTGACGGCGAAGTTCTACGCCGGCACATATGCGGCCAACGGTGAC
+AACGACCTCGCGGACGGCAAGGAGGTGACGGTCGATTCGGGTGAGGTAGCACGGCTGAAG
+CTGCCCGACATGCGGATCGGGACGCAGTTCACCTGGCAGGTCAAGGCCTGCGTCGACGAC
+GACTGCTCCGACCTCTCCCCCCTCCAGACCACCCGGGTCAGCCCGATGACGGGCGCGGGC
+GAGAGGCCCGGGGCCACGCGCCTGCAGTTCTCGACGGGCGACTCGACGGCCGCGCAGGTC
+GATGTCGGCTCGGGCAATCTTCTGGTCAACGCCTCCGGGCTGACCTTGCCGGGGGTCAGT
+GGTGACGTGGGCCTGGGGGCGGCGTACAACAGTGCGGCGATCGGCACGGATGCGACCTCG
+GCGAAGTCGCCACTGGGGTACGGGTGGCGGCTGACCCCCTACGAGGTCGAACTGAAGGAA
+CGCGGGGACGGCTCGGTCACCTACTACGGCCAGGGCGGGATCACCGGCCTGTTCGTGAAG
+TCGGGCAGCGGGTTCACGACGCCGGGCGGGTTCAAGGCCGACCTGAAGAAGAACAACGAC
+GGCACCTACACCCTCACCGACCACGGCTCCCAGTCGAAGCAGACCTTCACCAGCGCGGGC
+AAGCTGACGAAGATCACCGACCGCAACGACAACGCCACCACGCTCTCGTGGAACGGCGAC
+CTGCCCGACACCATCGTCACCACCCGCGGCACCAAGACGCAGCGCACGGCCGTGTACGCC
+TCGGCGAACGGGCGGGTCACGACGCTGACGCAGACCGCCTCGGACGGCAAGAAGCGCTCC
+GTCACCTACACCGTCGATGCTGCCGGAGACCTGGTGTCGATCAAGGACACCCTGGGCCGC
+ACCACCAGCTTCACCTACACCGGGCACAAGATGACCTCGGTGACCAATCCCGGGGGTGGG
+GTGACGCGTTTCGAGATCGGCGCGATCGGCGCCACGAAGATCACCCAGGAGAACAAGGCC
+GCCGGCTCGCCCGGAGACTCCGTCACCCGCCTGTCCTACGCGGACCCGGACAAGACGGTG
+ATGGCGTCCCCCAACACCGACCAGACGAAGACCGTGACCGCCGTTCCGCACACCACCTAC
+GAGCTGACCGACAACAACTCGGCGCGGGTGGCGAAGGCGACGGACGCGGAGGGCCGGGAG
+CGCTCGAAGACGTACACGGCGAACTTCGACACCGCCTCCTCGACGGACGGCTCGGGCGCG
+AGCGCGGGCACGACCACGAACACCTTCGGCGCCAACGACGGCGAATCGCTGACCAAGTCG
+CAGGGTGCGGACGGCTCGACGTTCTCCGCCGCGTACGGCAACACGGCGGCGGGCTCGAAG
+TTCTCGCCCTCGGAATCGACGGACGGGCAGTCGAACAAGTCCGCCTACTCCTACAACGGC
+GCGGGGAACCTGGCCTCCTCGAGCAACGCGGAGGCGGCCGAGGCGAAGGTCGACTACAAC
+GACGACGGCACCGTCAAGACCAGCACCGACCCCGGCAACAGCACGGACACGTCGTACACG
+TACGACGGCGACAAGCAGCTCACCAAGGTCGACCCGGCCGGCGGCTCGCTCAAGTCCCAG
+TCGTACACGTACGACGCCTGGGGCCGCCTGGCCGTTGCCACGGACGGCCGGGGCCTCACG
+ACCACAACGACGTACGACGACGCCGACCGCGTGACGAAGGTCGACTACTCGGACAGCACC
+CCTGATGTCTCCTACACCTACGACGCTTTCGGCCGTACGAAGACCCGCACCGACGGGACG
+GGGACGGTCACCTATGGGTACGACGATCTCGGCGCGATGACGTCGCGGACCGCGACGTCG
+GGCGGGGGCACGCTGGCGTACTCGTATGACAAGAACGGCAACCGCCTCAGCACCACTGAC
+GCGCGCGGCACCACGCAGTACAAGTACGACCAGGCCGACAAGCTCACCCAGGCGATCACC
+GATGCCCCGTCGACCAAGACGAAGATCGGGTTCAGCTACGACGATCGCGGCCGGCGCACG
+GACACGTACTACGGCACCAACGACGCGAAGACGATCTTCAAGGCGCGCGTGCACCAGGAC
+TACGACAAGTCCGGCCGCATCAGCCGCGTCTGGGCCGACCAGGGCCCGGCGACCGACACG
+ACCCGCCAGTTCGACGCCACGTACTGCCGCAGCCTCGGCTCCACCTCGTCCTGCTCGACC
+GAGAAGGCCGACAACACCGACCTGATCCAGTGGAGTAAGGACAACCTGAGCGGCAAGACC
+ACCAAGTACACGTACGACAAGGCCAACCGGCTGACGAAGGTCGCAACCGACGGGGGTGGC
+AAGACGTACACCTACACGTACGACGCCCGCGGCAACCGCAAGTCCTCGTCCGACGGCAGC
+GCGGATCAGTCCCTGGCTTTCGACGCCGCCAACCAGATCACCAGCGACGGCTACACGTAC
+GACGCCCAGGGCAACCAGACCAAGACCGCCAAGCTGTCCACGCTCACCTACGACGGCGCC
+AACCGCATGACCGGCGCCAAGACGGCCAAGGGCACCAGCAACTACACCTACGCCGGCGAG
+GACGCCACCGAGCTCGTCTCCCAGACCAGCGACGAGGGCGAGAAGACCGACTACGTCTAC
+GGCGCCCCCGACCAGTACGGCATGCCCGTCATCGAACAGGTCACGCTGAAGGAGGGCACG
+GCGTACATCGACCACGACCCCACCACCGGCCAGCCCCTCTCGCTCCGGACAACGAACGAG
+TACGAGGCGTACTACATCGTCGACGGCATCGGAAACCCGGTCCAGTTCATCAACCAGTCC
+ACGGTCCAGTCCACGATCTACGACTACGACCCCTACGGCACCGTCCAGACGACGAAGGAA
+ACCGGCACCGCCGGCACCCAGAACCCCTACCGCTTCGTCGGCGGCACCTACGACAAAACC
+ACCGGCTACGTAAAATTCGGCCAGCGCTGGTACGACCCCACCACCGGCCGCTTCACCACA
+CAAGACAAACTCAGTTTCTTCGCGAATCCCGCACGCGGAAACCGCTACGCGTACGCAGGA
+AGTGATCCTGCCAACGCGGCAGACCCAACCGGCCAGGATTACTACGACTGCGCCTTCGCG
+GGACTCGTGTTTGTCGGGGCAGCGGGAACGGCAGTTCTCAGCAGCGGAGGCACAGCCCTT
+TTCGGTGGCGCCGCTGCGGTAGGAGCCGGTGGTCAGTCGTACAGGGCTTGCCCCAAGGAA
+GCCAAAGAGGGTCCCGGGCGGAAGAACTCGCTGAAGGCAGCAATAACCCCGATATGGAAA
+ATTCTGTAA
+>orf00031 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCGGGTGGAGCCCGCGAGGACCTCCACCTCGAGTGCGGCGTCGGTGAGGTGGAGGGG
+GCCGGTGTCGGGGTCGTGGGTGGTGCCGGTGTCGTGCCCGGGCAGGTGGTGGCCGAGTTC
+GGCGGCGAGCGCGGCGGGGAGGTGCTGCGAGCGTACGGTCCGCCCGTCGGCCAGGAGGAC
+GAAGAGGTGCGAGGGCCGTGA
+>orf00032 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCGGGTTGCTGCGTCGGCGTGCCCTCACCGGCGCCGGCCGCCGGGCCGGAGCGTCGC
+GTCGTGAGGAGAGGTCGCGCTCGCCTCAAGGAGTAA
+>orf00033 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGCCTCGTCCGGGTCGCCGAGCGGCCGGGACAGCCCCTCCGCCTCCTCCCGCCG
+CTCTGCCGCGGTGGGGCGGCTGGTGCGCTCGCCCACCAGGTAGTCCGGATCCTCGGGCCC
+GCCCGGCTCCATCCCGCCGCTGTCGTCGTCCTCGCCCATGAAAGTGACGATCCGCCCGGG
+GGCCGGTGCGGGTGA
+>orf00034 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCGGACGGTGTCGAGGGGGACGGGCCGCCCGTAGGCCTCCTCGAAGTGGGACTGGGC
+GGCCTCGGGGGAGCGGTCGGTGAGGAGGTGGAAGAGGTGTCCGGAGCCGTCCGGGTCCGG
+GTTGCCCGAGGGGAACTCGATGCCCGAGCCGGTGCGCCAGGCGTTGGCGCCGGTCTCCCA
+CCACAGGCAGGCGGTGACCCGCGGGGCGCCGAGGCCCTCGTCGACGAAGGTCGGGTCGTC
+CAGGAGCGGGCGCAGCGCGGCGGGCACCTCGTCGATGACACCGGGCCAGACCTGTTCGTC
+GTCCGTGGCGTACGGGCTCATCTCCGACTCGTGGTCGAAGCCGCGGACGAGCACACCGAC
+CGGGGTGAAGAGGACGGAGAAGTCGTCACCCGAGCCGTTGTCCATCAAGGCCGCCTCCGT
+CCCAGGCCCCCAGGTGGTGGAGAAGGAATAGCGGGGGAACCGCGGGTCGCGGCAGATCGC
+CTGGTCCAGCACTGCCAGCGCGCGCAGGTGCGCGCGGAGTTCGGCGGGGTCCGGGAGGAG
+GGCAGCGGTCGTGTGCACGGTGTCCATGGGATCATGTAA
+>orf00036 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGTCACCCCGGACCTGATCAAAGAAGCGATCACCGACGCCACAACCGCTGTGATGCC
+GGTGCTCTTCGGCGGCCGGGCCATCGACCTCACCCCGATCCGCGAGGACCTCGCCCACCG
+CGGCATCACGGTCATCGAGGACGCCGCGCACGCCTTCGGCTCCCGCAACCCCGACGGCAC
+CGGATTCGTCGGCAGCGACAACTCAGTGCTGACCTGCTTCTCCTTCGGCGCCATCAAGAA
+CCTGACCTGCGGCCAGGGCGGCGCCGTCATTCCCCGCACCCCCGACGAAGCGCACACCCT
+CCGCCGCCTGAGACTGCTGGGAATCGAACAGTCCCAGAGCGAACGCGCCGAGACCACCAC
+CTACCAGGTAGGCGGCTTCGGACTGCGCTACCCGCTCTCGGCGCTCAACGCCGCGATCGG
+CCTCGCCCAGCTCGACCACTTCGACGAGACCGCCGTCACCCGGCGCCGCCTCTGGCGCGC
+CTACCGCACCGCCCTCTCCGGCCTTCGCGACGTGCCCCTCATCGACGTCGGCGCCGACCG
+CGCCGTCCCGCACCTGTGCCAGATCCGCGTACCGCGACGGGACGAAGTCTTCGCACACCT
+GCGCAAGGCGCACATCGGCGTCGGCGTGCACTACCCGCCCAACCATCTCCAGCCCGCCTT
+CGCACCCTGGAGCCGGTCGCTGCCCGCAACCGAACAGGCCGGCGAGGAGATCCTGAGCCT
+GCCCTTCCACCAGCACCTCACCGAGGCCGACATCGCCCTCGTCGTGCACGCCCTACGCGC
+CGCGCTCGAAGCGACAACCATCACTCCCCAGGCCTAGGCCGCGGCGGACACTCATTCCGA
+TGCGGCGGTCAGCAGCACGTCCACCAGCCTGTCCGCCGCATCCGGGCGACCCTGAGCCCG
+TGCCGCCACAGCCATGGCCTCCCTGCGCAAAGGATCTTCCAGCAGGGGGGCCACCGCCGC
+GCGGAGCCGTTCCCCGCCGACCTCTCCCACGAGCGCGACGGCCGCGCCGGACTCCTCCAG
+GTGCCGGGCATTGTGGGCCTGCTCATTCCCGGCCGCCGACGCGAGTGGAATGAAGACCGC
+CGGCTTGCCCAGGGCAGTCAGCTCGGCGAGCGTCCCCGCGCCACTGCGCGAGATCACCAC
+GGAGGCCAAGGCCAGCACATCGGGCAGCTCCGCGCCGACAAAGGGCGTCACGTGGTAGCG
+GACCGCCAGGTGAGCAGGAAGCGTCGCCGCACGCGCGGCCAGCGACTCGTAATGCGCAGG
+ACCACACTGGTGCACCACGTTGGCCCGCTCCAAGAGCCACGGCAGCTCCCCGCCGACGAC
+CTCGTTGATCTGCTGCGAGCCCTGCGCCCCGCCCGTGACGTAGACCGTGGGCAGGGCCAG
+ATCGAAGCCCAGCCCCAGGGCCGCCACGGCCTTGCCCGGATGCCCGGTCAGCACCTCTGG
+ACGCACCGGATTTCCCGTGACCACCGCGAGAGAGCGCACACTCTCCGGCAGAAGCGGCAG
+CGTCGACTCCGAGGAGACCGCGATCCGAGAGGCGCTCCCCGCGAGCCTCCGGTTGGCCAG
+CCCCAGCCGCACCGTCTGCTCATGCAGCACAAGCGGAACCCTGCACATCCGGGCAGCGAG
+CCCCGTCGGCACAGCCACGTACCCGCCCGTCGCGAGCACCACATGTGGCCGGAAACCCGC
+GACCGCCTTGCGCGCCTGCGCCACACCGAGCGGAACGCGCGCCATGTCCCGCACATTCGC
+AGGCGAGACCATCCTCAACGGATTCGACGAGCGCCTCACCTTCCCCGTGGCCACCGCCGT
+GAACGCGATCCCCTCTGCCTCGGCAACACGCGCCTCCAAACTGTCGGCGCTGCCGATCCA
+CAGCACATCGAGAGAACGCCCCCGCGCCCTCAACAGCTCCCGCAACGTACGCACAGCGGT
+CAGGGCCGGGTAGGTATGCCCGCCCGTGCCTCCCCCCGTCACGACCAGACGGAGAACCAG
+AGGGGGGTGAGAGGTGATAGCCACACAGGAACTTTAACGGCCGACCTCGAGAACGACCGC
+CGCTTCCAGCTTGGTCGCCGGGTCAGCGGAGTCTGCCGCGCGCCCGGTCCAACTCCGCGT
+ACGTCACCACGCCCGCTTCGGGCAGGCCCGCGTCCTGCCATGCCGCCTTCGCCGCCTCCT
+CGCCACCGCTCGCCTCCTCCAGCAGGAGGTTTTTCGCCGCGTTCACCGGGAGGGCCCCCT
+CGCCAAGATCCACGAGGTACACGACCATCCGGACGCTCCGGTTGCGATTCACCTGCTCGA
+TGTACCGGTAGACGAGCACCAACACCTGTCCGTAGCGCGGGGGCCTACCCTCGCGCGCGC
+GGAGGTCAAACGGCGCCGCGCGAGGCGGCCCTTGCCCTCGTGGGGTCCGCTCCGCTCGCG
+CGGAGGTCACCCGCCGAGCTGACCGGGCCAGTCGGCTGCTGCGCCGTGGCCTACTCCGTT
+GAGCGACAGACGAATGCGCCGCATCGGCGGGTCGGCCACGGCGATCCGCGCGGTCATCGC
+ATCACCCACACGAATTTCCCTGGCAGGCTCTGCTGCGAGCAGTTCGGAGCTGTGAATCAG
+CCCTGCAATCCCATTACCAAGATCCACGAAGGCGCCGAACGGCACGACCTTGGTGACCCG
+ACCACTGACAATGCTGCCCACGCGCTCAGCCCAGACCAGCCATGGATTTTCCTGCAGGGC
+GGCCAAGGACAGCACAGCCTGCCCATGCAACTCGGTGTCCAGGGCCAGAACCTCAGCACT
+CACACGCTGCCCCAGCGATACCACTTCATGGGCAGAGGAGATCCATTGCCACGAAACCTC
+GGGCGGAGGAATGAACCCGACCGAAGTCTCCGGCGCTCCGTCGAGATCGACGAACACGCC
+AAAGGTCTCGACCCGGCTTACCATCCCAGCCACTACATCGCCTGGGCGGAGCAACTGGAG
+GAAGTCTTTCAAGACCTTTGA
+>orf00037 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTCGGCCACGGCCAGGCCCTGTTCCAGGTCGTTGTTGTGCAGGTGCGCGGATGCTTC
+CACCGCGAGCCGGATGCCGACCGCGCGGGTGTAGCGCTGGGCTGGCATGGTGTCGGCCTG
+CTGGCTCCAGGTGAGCGCGTCGTGTGTGCGGCCCAGGTCGCGGTAGATCTCGGTGGCGTC
+GGTGGCCAGGCGCTCGCGGGTGTAGTAGGCCATCCACGCCGGAGCCGTCTCCGTGCGAGT
+CCGGTCGAGGAGGTTTTCTGA
+>orf00040 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCACGGTGGGTTTCGCCCAGCTCGCCGACAATTTGGGCGGTGACACCGAAGCGGCCC
+TCGATGCCCTGGACCGCTTCGTCGACAGCTTCGCCCGCTCCGTGCCCACCGGCTACCAGA
+ACTCCTTCGCCCACCGCACCCGGCCCAGCCTCGTCGCCGTCGTGGTCCGCGAGGACCAGC
+CCGTCAACCTCGTCACCGCCTTCGAGGAACCCGTCGTGTCGGAAGCCGGCATCCAAGCCG
+CGTCGGTACGCAGCCTGGCCCACGAGTACGCGGCGGCCCGCAGCGCGTGGGGCGACGTCC
+CAGTGCACGCGGCGGCGACCCACACCTTCGCCTCCGGCAAGCCGGGCGCGACGGAGACCG
+TGGAGGCGCTCACCGAAGCCTTCGGCACCTCGGTCCCCTTCGACGAGCTGCGCTCGGGCC
+TGCGCGCGTGCGTCAGCGCCGTCCTGGAGGCCCAGGGATGACCGCGACCGGTCCCACCAC
+GGTTCTCCTGCTCCGGCTTGCCGGGCCCCTCCAGGCGTGGGGCGACCGCAGCGCCTTCAA
+CCGGCGGGAGACCCGTCCCGAACCCACCAAGTCCGGGATCGTCGGGCTGCTGGCCGCGGC
+CGCCGGGCGCCCGCGGCACGCCGCCATCGACGACCTGGCCGGACTCGGCCTGGGTATCCG
+GGTCGACCAGGCCGGCAGCCTGTTGCGGGACTACCACACCGTCAGCGACTACCGCGGCCG
+CCCGCTCCTGGCCGCCGCGGTGAACGCCAAGGGCACCCAGAGACTCACCGGCCCCGCCAA
+GTACACCCACATCACCCAGCGCTTCTACCTCCAGGACGCTGTCTTCCTCGCCGCGATCGA
+GGGCCCGGCGCACTTCATCACCACCCTCGAAAACGCGGTACGCCACCCGGCCTTCCCGCT
+CGCTCTCGGCCGCCGCTCGTGCGTCCCCGCGCAGCCGCTCGTCCTGGGGCAGCGCACCGG
+ACCGCTGGAGGAGGTACTGCGCGCGGAACCCTGGCACGTCACCGATGCCGTCCGGAAGCG
+GTGGGGACGCCGCAACGGCAACGCCGCCCACGTCGACCTGCCCCTCACCCTCGACGACCC
+GGCCGGCGACGACACGCGCGAGGACCTGCCCCTGTCCTTCGCGCCTACCAGCAGGGCCTA
+CACCAGCCGCCGCGTCCGGCACACCTACGCCGCCGCCCCCACCGGCCTCACACCCCACCC
+CGACCAGCCGCCATCCACCGGCGGCCACGACCCCTTCGCCCTCCTGGGCTGGTGATCCGA
+CATGCCCTACCTCTCCCGCATCCGCATCAACCCTCTGCGCACCGCGAGCCGCACCCTCCT
+CGCCAGCCCCCGCGCCCTGCACGCCCAGGTCCAAGGCGGCGTCCCGACCCTCCCGAACGA
+GTCCCGCACCCTGTGGCGCCTGGACGCGGACAACCCCCACCGCCCCGAGCTGTTCGTTCT
+CACCGCCGGAAAACCCGACTGGACCCACCTCGTCGAACAGGCCGGGTGGCCCGGCGCGGA
+CGGCGAGCACTACGCGGTACGGGACTACGCGCCCCTGCTCGGACAGCTGGCGCAGGGCCG
+GGAGTTCGCCTTCCGCCTGACCGCCAACCCCGTCCAGAACACCAACCGCCCCGACAAGCC
+CACCGAGCGCCAGCAAGAACGCCTCGACGGCGGCACACGACGCAGCTTCCGCCTCGGCCA
+CCGCACCGCCGCCTCGCAGCTCGGCTGGTTCCTGACCCGCACAGCCCGCTGGGGCTTCGA
+CGTCCCCGCCGCCTCCCACCTGGACGGCACCCGCGACGACCAAGACGAACCACCACGCGA
+CGTGCGTATCAGCACCCGCCGACGCCACTCCTTCGGCAAGCCGACCCGCGCCTCCAAGGA
+AGACCGGGTAATCATGCACATGGTGACCTTCGAGGGAAAACTCCGCGTCACCGACCCCAG
+CCTCCTCACCCAGCGGCTGCTGGCCGGGATCGGCCCTTCCAAGGCGTACGGCTGCGGGCT
+CCTCACCCTCGCCCCTGTGCCCGCGAAGGCGTGACGCCCGTGGCCGACATCTGGTGGAAA
+GCCGACCCCCACGACCTGCACCGTCTCACCGACCGCGTCTCCAGCGTCTACGTCGAACGC
+AGTCATCTCGACCGCGACGAGAACGCCGTCGTCATCATCAATAAGCGACAAACCGTCCGT
+GTCCCCGCCGCCATGGTGGCCGTCATGCTCCTCGGCCCCGGCACCCGCACCACCCACGCG
+GCCATCCGGCTGCTCGCCGACTCCGGCACCACGGTCTGCTGGGTCGGTGAACAAGGTGTC
+CGTATGTACGCTGCCGGCCTCGGCCCCAGCCGGGGCGCCGGCCTCCTGCACCGCCAGGCA
+TGGCTCGTCACCCGGCCCAAAGAGCGCCTGGCCGTAGCGCGAGCCATGTACAGCATGCGC
+TTCCCCGGCGAAGATGTATCGGCCCTGACCATGCAACAACTCCGCGGGCGCGAAGGCACA
+CGCGTCCGCAAGCAGTACCACCACCACGCGGAACGCACCGGAGTGCCCTGGAACGGTCGC
+GTCTACGTCGCCGGCGACGCCCACGCCGCCGGCGATGACCTCAACCGGCTCCTGTCCGCC
+GCCAACGCAGCCCTCTACGGCATCTGTCACGCCGTCATCACCGGCCTCGGCGCCAGCCCA
+GGACTCGGCTTCGTCCACACCGGCAAAGCCACCTCCTTCGTCCTGGACATCGCCGACCTC
+TACAAAGCCGAATACACCATCCCCCTCGCCTTCGACCTCACCGCCCAAGGACTCACCGAA
+GAACGCGACGCACGACTCGGCCTCCGCGACCTCATTACCCGTGACAAACTCCTCACGCGC
+ATCGTCACCGACGTGAAAAACCTCCTCACGCCCGAAGGAGCCGAGTTCGAGGACTCCGAA
+GCCAACCTCCTGTGGGACGAACAGGTCGGCGCAGTTTCCGGGGGAACCAACTACGCCGAC
+TCAGCAGATTTGTCCGTCTACGGAATAGGAGACAACCACATCGCGGTCATCGGTCCCGAT
+CTCGACGAAACCGGCCCCACCTCATGA
+>orf00041 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCCGGTGCTGAAGGCGTCGGCGACGGGCAAGTCCTTGAGCTCTGCGGCGAGTTTCTC
+GTCATCCAGCGCGGCCAGGTCGTGGGCCTGCCCGCTGACGAGAGCGGCGACCGTGTCGAG
+CTGGGCGTTGCCGTAGAAAAGCAGGTAGGCGGTGTCGCTGGCCTTCTTCCCCTGGCTCAG
+GTTGAGCCGGGTCAACAACGCGCCGGCGAGCCGGTCGGCCTTGTCACGCTCCAGCTTCGT
+GTCACGCACGATCCGCTTGGCGAGTTCGCTGGTCAGGCGCCTGGTGCGGGTCGCGCGGTC
+CGGCTCGGGCACCGTGGTGTCGAAGTGCTTGCGCGTCGCCCGCTTCCACGCCTGGGAGGA
+GACGCGCGAGCGCCGTGCGCCACCGTAGACGGCCTCTTTCGGGTTCCCCTGGTCGTCACG
+GTTCACGTTGGCGGGCGGGACCGTCTGGACGATGTGCACGTCGATGAAAAGGCGCTGTGG
+CATGAGGTCGCTCCAGGGTGA
+>orf00042 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCCGCGCAACACGAGCATCGCCCGGCCCAGCCCGACGCCGGGCTGGTGCATGGGACG
+GTCCTGGCTTTGCTGGTGCAGGCCGTACAGGGCGAGCGCGATGTGCTCGGCTTCCTGCTC
+GGCGGACATCTGCCCCTTGCGGGCGGCGAAGTCGTCGATGGGGCAGGTGTAGAAGGGGAA
+CATCTCCAGCACGGTGCCGGCGGGACGGGTCAGGCCCCGGCGCAGCACGGCGAGGTCCTC
+GCCCGGCGGCCGCTTCGCGGCCGCGGTGCCTTTCGTGGTGCGCCAGGTGCCGTCCGCGGC
+GATGTGGCGGTGCCAGATCCTCTGCGCGGCAGAGCGCTGTTCGGTCATAGCCGTGTCCAG
+ACGTGA
+>orf00043 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGCGCCGCTCCCGTGTCGGCGGATCTGCCGCAATGGCGGCGACGGGATGCCGAGCAT
+CCGCTGTCGGCCGGGACGCCGCGCTGGCAGGAGCGTCTCCCGCAGGGGCTGCTGGATTTG
+TGGACCTGGCAGTCCCGCCGGGCCCTGCTCGTTCCCGAGGCCACCGAGGAGGGCGTGCGT
+GTGACGCGAGTCCTGGTCGCGGCCGGGGACCGGATGCCGTACACGCCGGAGATCGAGCCG
+CACACCATGTGGCGCACGGAACCCACGGGTGGCCGCAAGCCCGCCAAGAACAAGGGACGC
+ATTGTGCCGCCGCGCCGGCCGTTGCGTCTTCAGCCGGGGAAGGCCGTGTGGCGGGGCCTG
+GACGCGCTCCTCGCCACGGAACGTGCGACGCGGGAGGCGGGGGAGGGGACGAGCGGGTTC
+GTGACGAGCAAGGTACTGGATCAGGCCGGAGGTCTCGTCGCCGAGCTTGGTGAGGGCTAC
+CCGCTGCGGGTGGAGCTCACGGGTGTCGCCTACGGCAATCAGTCGGCGGTCGTCGACGAC
+GTCATGCACGACGCGCTCCCCCTCCCGCTGGCCGCGCTCGAGGTGGACAGCTTCGTCCGC
+TCCGCTCTGCTGGAAGTGTGCGAGCAGGCGGAGCAACTGGCCGCCGCCGTCAACCATCTC
+TCCGCCGACCTGCGTCGCGCGCTTGGCACCGAGCCCATTCCGTGGGACCGGGGCCAGCGT
+CCCGGCGAACTCGTCCTGCACGCCCTCGATCCGCTGGTGCGGCGGCTGCTGGCCGGGATA
+CGGCATGTGGACGACCTCGAACGTATCGATGCCGGGCAGCTGGCGTGGGAGCAGCTCGCC
+TGGAGCCGGGCCTGGGCGGTCGCGGACCGGCTGCTCCAGGCCGTACCGGTCAGCGCGTTC
+GCGGGCCGGAGCACTTCTCAGGGGGAAGGGAAGCCTGAGCGGACCCACCGTGTCTCGCTC
+GCCGAGTCGTTCTTCCTCAAACGCCGCGCGGAAATTTTGCACCGGGCCGCCGCTGCCCGG
+CGCGAGAGCACCGCGGGCGTCGCAGAACCGGCCGGCCTGCCCACCGCATCCTGA
+>orf00044 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGGCAGATCCGCCGACACGGGAGCGGCGCCCACGGGGAGGTTCAGCAGCAGCGTCTC
+GAACAGGGTCCTGCCCGCCAGGAGCGTGACGCCCATCTGGCCAAGCGGGCCCGTCGGGTT
+CCCTGTGGTCTTGCCCGCCTTCGCCTGCGGGTCGCCGACCGCCCCGGTCTTGATCGCCGC
+CGTATCCCAGCAGTGGGTGTGCAGCAGCCAGAGCACGGCCTGCGCCGGCGTCAGAGCGAA
+CACGTCCCCTTCCGTACGCGAGGCGAACAGCGGGACGTTGTTCCCGGTCGCCGCGTGCGG
+CACGATCAGGGCGGCATTCTTCGTCTCCCCCCTCGGGGTGTGCAGCCCGGCCACCTGCGC
+AAATGGCCGCACCGGATCGAAGAGACCGAACGCCTCACGGTACGCGTCCAGATACGCGGT
+GAGCCGCGCGCGCTGCTCGGGCGTCCAGCGCCCGGCGGCGAACCATTGCGTCCATTCCCG
+CTCGTCAGCGGGACGGCCCAGCGCATCGACGACCACCGGAAGAAGCAGCTGCCGCAGTAC
+CGCCGGCCGCTGGGTGGCACTCTCCACCGCCAGGTCCCCGAACTCGTGCGCGTCCAGCAG
+CACCGTACTCAGCGAACGCTCCCGCGCCAGACCGCCGACCGCCGGCGGCACACGCAGCCA
+CCGCTCCTCGAGCAGGGAAAACCCAAACCCCATCAATCCCCCTTGAAACCTTCTCTGTTT
+AACCTACGCACACCCACCACGCGCGCGGGCAGGTTTCCCGCAATCCGATGCGAGAATCCG
+TTGACCGACAACCGACCCCACCCCTGGCGCTGTCCGCGGGGATGA
+>orf00046 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAGTCGACAGCGGACCGTCCGCTTCCAGGCGCGCGAGGATCGGAGGATCCCCCGCGA
+GCGCGAGGTCGACGCCGTCACGCTGATGTCGCCACCAGGACGGTCCGGGCGCCCCATCCC
+TACGAGCACGGGGCCGACCGAGGGCTTTCACGACCGGTGGATCGACGGGTAGGAGGGTAC
+CCGCGACCTGAGCGAGTGGATGCCCGGCTGCGGCCTCAACGGAGGATCTCCGCGTGCGCG
+GGGTCGACGCCAGACGGGTCCTGCCATATGAGGTCCAGCTTGGAGGATCCCGCAGGCGCG
+GGGGCAACCGGGCGATGCTGCCTGTCTCCTCGAAGCGGCCCGGAACATCCCTGGCGGCGG
+GTGGCACGCGTGTCGCCGCGGCGGTGGGGGGGTGGGGGCCTGCGGGTGCGGGTCAGCCCA
+TCTGGGTTCGGGCGGTGCCCTTGTATCACGGGGTCGGGGGTGGCGGGTGTCGTTTTGGTG
+ATTCTCCTTATCGTTTGTGCAGTTCAGAGGGTGTTGTCGGTGGTGCCGTTTACGATCCGG
+TTCTCGAATTCGTGTGTGAGGTGGGGGTTTTCGGTGGATGTGAATGAGCTGGCGTTGAGG
+TACGGCGCGGCGGTGGTGCGGGGGCTGGAGACGTTGTGGGGGAAGTCGCGGGAGAGGGCT
+GCGGGGAGGACGAGTCTTCTGCTGGGGCATCTGCTGGATACGGCGGCGGTTGCGGAGCTG
+ATGTGGGAGGAGTTCTTGGCGCCGGCGACGCGTTCGGCGCTGGATGAGGTGGCGGGTGGG
+GTGGGGTGTGGGCGTGGGTTGTTTGTGTGGTTGTGCGCGGTGCATGACTGCGGGAAGGCG
+ACGCCTGCGCATCAGCGGTTGTGGGATGAGGGGGCTGAGGCGGTTCGTGCTGCTGGGTTG
+ACGTGGCACGAGCCTTCGGCTGTAGCGGGGGCGAAGCAGCGTTGGCGGCACGACTGGGCC
+GGTGGGCTGATCGTTCGGGAGTTGCTGGGGGAGGTGGGGTGGAGTGGCGAGCAGGTGGAC
+TGGGTGTGGCCGCTGGTCGCCGGTCACCACGGGGCTTTCCCGACGCTGAAGGACGTGCGT
+GAACCGGGGTCCGCGAAGCGGCAGTTGCGCGGGATCGGGGTGTGGCGGGAGGTTCAGCGC
+GCACTGCTCGATGTGGTCTCGCGCGAGGTGGGCTTTGCGGGGCCGGCGGAGGTGGAGCCT
+GTGGTTGTTCCGTCGAGGGCATTGCAGTTGCAGGTGAGTGGTCTGGTGGTGATGGCGGAC
+TGGATCGCGAGCGACGAGCGGTACTTCGGTGGGGTCGATGACCTGCGAGAGGTGAGTGCG
+GAGGGTTCTCGTCGGCGGGCCGCGGGGGCGTGGAAGGCGCTGGGGCTGCGTGGTGGCTGG
+GGTGAGCGGGGTGTGCCGGGGCGGGAGGTTTTTGCGGGGCGGTTCGGGTGTGTGCCGCGG
+CCGGCGCAGCGGATGGTCGTCGACGCGATGGGGGATATGGGGGGTGCGGGGCTGGTGGTG
+GTGGAGGCTCCGACGGGGGAGGGGAAGACGGAGGCGGCGCTGTTCGCCGCGGAGGTTCTG
+GCGGCGCGGTTTGGTGCGGACGGTGTGTTCGTGGGGATGCCGACGCAGGCGACGAGTGAC
+CCGATGTTCTCCCGGGTGCGTGGGTGGCTGGGGGCGGTTTCGGAGGAGTTCGCGTCGCGG
+GTGGTGCTGTTGCACGGCAAGCGGGCGTTCAACCGGGAGTGGAAGGGGCTGGTGGAGGAG
+GGGGCGGGGGCGAGGGAGGCCTTTGGTGGGGTGGATGAGTTCGGTTTGGCTGGTGATCCG
+TTCGGTGTGAGCGGGGAGGGGGGTGGGGAGCTGGAGTGTCAGGCTCTGGTGGAGTGGTTT
+TTGGGGTCGAAGCGGGGTCTGCTGGCTCCGTTCGTGGTGGGGACGGTTGATCAGCTGCTG
+TATGCGGCGACGCGGACGCGGCATGTGATGTTGCGGATGGCGGGGCTGGGCGGGAAGGTC
+GTGGTGCTGGACGAGGTGCACGCGTGCGACGTGTACATGAGTCAGTTCTTGCACGAGGCG
+TTGCGGTGGCTGGGGCAGGCGGGGGTCCCGGTGGTGGTGCTGTCGGCGACGCTGGCCCCG
+GCGCAGCGGCGGGGCTTGCTGGAGGCGTATCTGGCGGGTGCGGCGTCCGTGGAGGAGTTG
+CGGGTCGAGGTGCCGGCCGCTGAGGGGTATCCGAGTGTGACGACCGCGTGGTCGCCGGCT
+GGGGGCGAGCCGCAGATCCGGGTTCGGGCGACGGGTAGCTGGCGGGCGGATCTCGGGGTT
+GAGGTGCGGGTGGTTCCTGAGGCGGTTCCGGGGCGGGGGAGTTCGCGTGAGGAGCGGGAG
+CGGGCGCAGGCTTCTGCGGATGCGCGGGTGGGGGAGTTGCTGGCCGGTGAGCTTGCCGGG
+GGTGGTACGGCGCTGGTGATCCGTAATTCGGTGGCGCGGGCGCAGAGCCTTTTCGAGGAG
+TTGCGGGGGCGTTTTGGCGGGGATGAGGTGCGGTTGCTGCACGCGCGGTTCACGGTGGCG
+CGGCGTGCGGAGCTGACGGAGGAGTGTTTGCGGCTGCTGGGGCCGGGGGCGGGGCGTTCG
+CGTTCGGGGCGGTTGGTCGTGGTGGCGACGCAGCTTGCGGAGCAGTCTTTCGATGTGGAT
+GCGGATGTGCTGGTCACGGATGTGGCGCCGGTGGATCTTTTGTTGCAGCGCGTGGGGCGC
+TTGCACCGGCACGAGGGCACGTGGAGGCCGGAGGGGCTGCGGGTTCCGCGTGTCTTCGTG
+ACGGGTTTCAGTCCTCGTGAGGGGCGGGAGCCGGAGTTCGTGTCCGCGAGTGAGGGGATC
+TACGGGCGTCATCTGCTGTTGCGGACGGCGGCCGTACTGCCCGGTGCGGGTGTGGGGGCG
+AAGGCGGGTGCGGGCGGGGTGTGGCCGGTTCCGGGGCGGGTGCCCGCTCTGGTCGAGGAG
+GTGTACGGGGATGAGGAGTCGCTCTTGCCCGAGGGGTGGCGTACGGCGGGTGAGGCGGCC
+CGGAGCGAGCAGGAGACGCAGGACCGGGAGCGGGCGCAGAACGCGCGGCAGTTTTTGCTG
+ACGGGGCCGGGTGAGCACGAGCGGCGGACGCTGGCCGGGTTGCATTACGGCGGGGGGACG
+GCGGGCGGCGGTGAGGACGCGTTGCGGGCGGCGGTACGGGACGGGGACGAGTCCGTGGAG
+GTCGTGCTCGTGCGCCGCGACGGGGACGACGGAGCGTTCCGGACGCTTGCGGGGCGGGCG
+CTGAGTGTCAACGGGGACGTGGCTCCAGAGGTGCTGGAGGAGGTACTCGGTTCCGTGGTG
+CGGCTGCCCGCGAAGTTCACCAAGGCGGCCGCAGGGCTGGCGCCGCTGCCGGGCTGGCAC
+GGGCATCCGTGGCTCGGCCGCAGCCGTGCTCTGGTGCTGGACGCCTCGGGTAGGGCCCGG
+CTGGGCGATTTCGCGGTGGCGTACGACGGCGTGCTGGGGTTGCGGCAGGTATGA
+>orf00047 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTACGACGACGCCTTCGTGTCGGTCGAACTGCTCTCCGCGCAGGTGAAGCTGACCCAG
+CCCTCCGAGATCGCCCTGTATTTGCGGGCGTTCGAAGAGCTGCGGAGCATGGCCGTCTAC
+GGCGCGGACGCGCGCGCTCTGGTCGTGCGGGCGATCGACGCGTTGCGGTAG
+>orf00049 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAGGAGGACACGGTGCCGGTATGCCTGGGTGATCTCGCGGACGTGAGTGAGGTCGTC
+GAGGTCGGTGGCAGCGAGTTCCCTGTCGAACTGGTCGAGGTCGCTGGGGTAGCCGTGCCG
+GCGTAG
+>orf00050 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACTGCAGGTCAGCAAGTGTCGGCCCCGCGAGCGCGGGGATCCTCCAGCTCGTCGGCG
+AGCTTCGCGTGCGCGGCCTCGGTCGGCCCCGCGAGCGCGGGGATCCTCCGATGTGCGCTG
+GATGCAGCGTGCGATCGGCCTTGTCGGCCCCGCGAGCGCGGGGATCCTCCGGCGGGCTGG
+TACTTCCGGCCCGTAGACCGGATGTCGGCCCCGCGAGCGCGGGGATCCTCCGGGAACCTG
+CTACGCCGACCGCGAGTTCGACGGGTCGGCCCCGCGAGCGCGGGGATGCTCCCTCCGGGG
+CGACGGGCCGGGCGTGACGAACGAGGTCGGCCCCGCGCACGCGGGGATTCTCCGGTTGTC
+GAACATCGAGCCGTACGGGCTCGTCTGTCGTCCCCGCGTGCGCGGGGATCCTCCGGGCTA
+CGCGCTCCTCTTCGACCAGGACTTGGGGTCGGCCTCGCGTGCGCGGGGATCCTCTGCTGC
+TGGTGGGTGACGGCACGTGTATACACGTGGACCCCGCGCTCGGGGAGCGGTCACTCGGCC
+TGTTCCACGCATCACCGTGTCGCCTTACGGGATCGCACGACGCGGGGCCCGGTCCGCGCG
+GGCCCGGCGACGTGCGGCCGCCTCGATCTCGGCACCGGTGCGCCGCTCCGCGTCGACGTC
+CTCGCGCGCCGAGAGACGGGGCACTTCGTCGGGGAAGGCGTGGTGGGACAGGGCGCGCAT
+CGCGGCCGCCTGGCGCTCGCCGGCGCGGCGGTCGGCCTTGAGGACGTCGTGGTCGACGCG
+CTGGGCGGGGGCTGCCTGCTGGTGGGCGCGGAGCGCAGGGCGGTATCCGGGCGAGGCGTT
+CTCCCGGGTCCGTACGGGCGTGGGTGCGGCGGTGCCTTCGCCGTCGGCAGTGGCCGGGGC
+CGGGGTGGGCGCGGGGCCGGTGCTGGGGGCGAGGACCCGTACGGCCCGGACCACGGTGCG
+CCCCGCCGCCGTGTTTGCGGCCTCAATGATCTGGGCCTTTCGCAACCGGGTCTCGGTGGC
+CCAGACAGCCGAGCTTGGCCGCAGGATCAGGCACCCGCTGGCAGCGTTGTAGCCGACGGC
+GGCGACGGATCCGGCGAGGTCGGGTGCGATCGCCGTCCAGCGGTCGCGGAGCGTGGCTCC
+GGCGGCGGGGAGTTCCCAGGCGCGCTCGGCGAGCAGCGCTTGGAGGGCGGCGCCGAGCCC
+GAGCGGCTCGCGCCCGCCGGGCTCCGGTGCGGGTGGAGCGCGGCGTCGTGCTCGCGGGGC
+GGCCGCCGCCGTTCTTCCGCGCGGCCTTCATCGCCGCCCGCAGTGCGACCCGGGCGAGGT
+CCGCGCCGGAAGTCTTGTTCTCGGTGCTGCTCATGCGATCCCCCAGGGGCTCGTGGTGAG
+GGTGAGGTGGTCGCGGCCGGTCACGCGGTGGACGGTGGCGACGAGCGCGCGGGTGAACAG
+CCGCTGCGCGGAGTGCTCGCCGTAGCGGGCGATGTGGTCGAGAACGACCTGGTGGTCGTA
+GGTGGCGCGGGCGCGCCAGTCGAGGATCTGCTCGCGAGTCAGCTCCTCCAGCACGAGCTC
+GTCGACGACCTCGCGGACCTGTCGCCCGGCAGGCGCCACAGCGGGGGCGGCCGTACGGGA
+CGCCAGCACCCGAGCCCGCGGCGCCGGGAGCGCGCCCAGGGCGGGAGCGGTGGGCTCCGG
+CTGGTCCTGGCGGGCGGCATCGGCGCGTGCGCGGGCCGCGGCCTGCCGCGCCCGGACCCG
+CTCCCACTCCCACTCGCGCGCCCACCCGGCGGCCCTTACGTCCTCGTGCAGCTGCCGCAC
+AGTCGCCGCGCGCCGCTCCTCCTCCCCCGCGTACGGGAGCCGCTCCTCGACCTCGGCGGC
+GATCCGGCGACGCTGCGCACGGCGATCGACCTGCCGGTCCTCGCACCGCGGGCACGCCTG
+CCCGGAGTCGAGCAGGATGCGGTCGTCGCAGCGCACGTCCCCGCACTGCTGGCGCTGCGG
+CAACCCCCGCGCGAGCAGCCAGCCCGCCGGATCCCGGATCACGCCGCCCGTACGGATCTG
+CTCCCCCAGGCGCCGGAACAGCCGGGCACCGAGGACCTGCGGCGCATCCGTACGGCCCAC
+GAGGCCCTGCAGGACGGCGAGCTCGGCGTGCGCGGCCGCCTCGACGACGCGGCGCAGCCC
+CGGCCTGGGCAGCTGCGCCCACATCCAGTCCACCGGCTCCAGGACCGCCCGCAGATCCTC
+CGGCGGCAGCGGCGCTGGAGCCTGCTTCGGTTGCTGACGGCCTTGAGCGCAGCCCTGAGG
+CTCCGGCACCAGGGTCACCGCCGGGCCCGGCCCGCGCTTTTCACTGCTGCTCGACGAGGG
+GGACTCCTCACGCTTTTCCCCGCGCAGCGGGCCCTCCTCACGCGCGCTCGCGCGGTCCGG
+CGACGGCGGGGTCCCCCCACGGCCTTCGCCGGAAAAACCCGAGGAGTCCTCAACTTGATC
+AGCAGGAGTAGCCCCAGAAGCGTGAGAGGCGTGAAGGTGTGCAGCATCGGCGCGGTCTGC
+CGAATCAGGCTCCTGGCCCATCCCGGTACCCTGAACCCCAGTAACCACAGGGGACACAGT
+CTCAACCGTCGTCTCAAGATCGCCGGATGCAGTAACGGCGAGGTCTGA
+>orf00051 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCCCTGGCCACCGGCAGCAGCCGGACCCGACTGCGCGCATGCAGACCCGACGCCGT
+CTCCCGCCGGTCCACCGACAGCACGCCCTGCTCCTGGAGCCGCTTGAGGCTCTTCGCCCC
+GGCCGCCGCCGTGCAGCCCATCAGCCGCGCCACCGTCGCCGCCGGACGGCCCCGCCCGGT
+GTCCACGCTGCCCGAGCACAGCTGCAGCCACCCTCTGGAGTTCGACGACAGCACCATCAG
+CAGCAGCCCGAGCCGGTCCGTCGCCGCCCCGCGCCCCGTACGCCCCGCGAGCATCCCGGC
+CGGGGTTACCCGGCCGTCCCGGTGTTCCCAGCCCGGCGCGAACAGCACCTCGATCAGCGC
+TAG
+>orf00053 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCCCATCCGCCACTGCGCGTACAGGAACAGACGGCACCGCACCACAAATCGCATAGG
+GGCACCGTTCACTCCGGCGCACATCCGCGATGA
+>orf00054 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGAGGGCATCCGCTACGAACCCGGCACTCTCGCCTACGTCGTCCATGTCCCGGAGGGC
+GAACCACTGGTCCGCGTGTTCTATGAGCTCTACGCGAGCTACGACGCGTTTCAGATCCAC
+GAGGCGCAGCCCCATACGCAGCGGATGCTCAGCGAGCGAGAGCAGTACCTCGACGGCAGC
+GAGGTCACGTTTCTCAACGAGCTGATGGGCAAGCGCCCGACGGAGACGACATGA
+>orf00055 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGATTCGCCGGGCTCCGGCCCACGTACGCCCCGGTGTCCAACCACCGGGGCGTTCGTCG
+TTGTGGGGGCCGGGCGTTGGCGTAGAGCGTGATCCGTCGCGCTCTCCGCTCGCTCACCGA
+CCAGCCCCGTCTGGGCCGTGCGGTGAGCGACGGGGCGCGCGAGGATCAGGCCGCCAGCAC
+CTCGGACTCCGCGAACGACACGACGACGGTGCGGTCGATCCGCAGCTGCCGCGCGGCGGG
+GATGAGGATGTCGACGAGGCGCTCGCGGACCCGCTCGGTGACGGTCGGATCGGCGGCGAG
+GATGTCCCGCGCCGCATCCCGCCGCGCCCCGGAGGCCGCAACAACCTCCTCGCGCGCCCG
+GGCCCGGCCTTTCTTCACCACGGAGACGGCGTCCCATCGGGCCAGCTCGTCTGCGGTCAC
+CAGGTCGTACATCTCCAGCGGCGTGCCGAAGGCGACGTCCAGGTCCAGGTCGCCGAACGC
+GGGGAGCGGCACCTCGACCGCCTCCAGGAGCGCGAGCGTCTCCGTGTCGAACTCAGTCAG
+CGGGTCGGTAGCGGACATCGGTATCTCCATGGGGGTCTGGGGGGCTCCCGTGTGGGGGAG
+CGCGAGGGCCCCGGGCTGCGAGGTGCAGCTCCGGGGCCCGGAGGGTGTGGATGGTGGTGC
+GGGTCATGCGGCGGCGAGCGGGGACCTGCGGCAGCGGGTGATGTACGCGGCGACGGTCTC
+GCCCGGGACTGGCGCGGGCAGCGCGGCCCTGACCGCAGCGATGAGCGCGGTGTGTGCGGG
+CTGGTCGGCCGGGGTCAGGGGGCGGCGCCAGAGGGTGGCCAGGTGCAGGTACGCGGCGCG
+GGTGAGGTGCTCGGCGAGCCCGTCGCCCGCGAGCCGGTCCTGGCGGGCGTCGGCCAGAGC
+GCGCAGGGTGCCGGTGGCCAGGGCGCGGACGGAACGGCGGTCCCCGGCACTCTGGCGGCG
+CAGGGCCGGCGGGGCGCCGGCGGGGCCGTCGACGGCCCGGCCGCGAGTGGTGGGGAGCGC
+GTCGGCGGGGACCGCGCGGGCGGCGTCGGCCTGGCGGGCGGCGGGCACCGCGCGCTCCCA
+CTGCGCGCGCCGGTCGGCAGGCCGCTGCTGGGGCCGGGCGACTTTGAGGGTCTGGACGGT
+GGCTCGGCGGTGGCGGGTGAGGTCGACGGCGAGACGCTCCTCGCGCGCCCACTCGTCGTA
+CTGGCGGCGCCACATGGAGTCGGTGAGGTCCACGTCGACGAGGCGGTTGCTGGAGCGGCA
+GCGGATCGCGGCGTCGACGCCAGCACGACCGGTGTGGTGCGGGACGAGCTTGAGGAGGTA
+GGTACCCCGGTGCGGGGTCACGGCCACCCAGGTGCGGCAGTCCGGGCACACCAGCGAGAT
+ACGGCGGGCCTGCGTGGCCTCCACCCTGCGCATGTCGATGTGACCGGGCGACAGGGTCGA
+GACGACGATCGCGTCCAGGGGGCTGACGCGGGAGGTACGGGTGCGGCCCCGGCGCGTACG
+GGCCGTGGGCATGGCGAGCTCGGGCATGGCGACTCCTCGGCAGGAGAAGGGAGGGGGATT
+CGCGGGGCGGGTGCTCTCTCCGCCCACCAGGTCCACGAGCCAGCGGCCCACGTCCTGGCG
+GACAGACAGCGCATCAGCGCTGAGGTCATACAGCAGTCCTGCCAGCCAGGGGGTTTGGTG
+GTGCTACCGCCTCCGGCCACCTGCCCGACTCCGAAGAGACGAGCCGCAGAAACTGCGGTG
+GCGACACGACCGACGCTACGCACACTTTTCGTGCTAGTCAATACTTCAGTGCTAGGCAGT
+GTCTTCAAATGA
+>orf00056 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGGGCGGGCGGGCTCGGTCGGCGGCTGCGGCTGACGGCCCCCGGTCTCGTGCGGCTG
+CGGGCGGGTCGGGAGCGGGTCGCGCTGGACGCGCGGCGAGCGGGGCAGGGTAGCGTTCGG
+CATGCGAACTCCATCTCGTGA
+>orf00057 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCACCGATGTTCAACTGGGCGAGGCCCGCATTCAGGCGGAGGTCGACAAGATCCGT
+GGCGAGGGTCGCCTGAAGATCGCCCGGGCTGAAGCGGAACGCGAGGCTCAGGCGGAGATT
+CAGGCCGCCGAGGCCGATGCTCAACTGCGTGAGGCGCAGCGTCAGCACGCGCTCAAGCTC
+GCGGAGGACCAGGCTGCGGCCGAAGCGCAGGAGCTCGCCGACGAGACCGAGAAGCGGCGC
+ACGCTCTCCCGGATCGACCGGGAGAAGGTGCAGGCCAGTTGGGGTCTGGAGCAGAAGCAG
+ATGGCCACCGAGGCCACCGAGCGCGAGCGCCGTATCCAGGCCGATGCCGCCGCCCGCGCC
+CAGCGCGAGGAGATCACACGGCAGGCCGGCATCGCGGAGCAGGCGGAGCGGCGCGCGCGG
+GCGCTCGCCGGGGAGAGGGCGGCCCTGGAAGAGGCCGCTGAACGCGAGAGGAAGGAGGCT
+GAACATCGCGCCGCGACGGTGAACACGATCTTGGAGGCGCAGCGCGGAGCCGAGTCGATC
+GCCGTGTCGAAGGCCCGCGAGCAGGCCGCGATCGAGGACGCCGCCGCCCGCAAGGCGCGT
+GCGGCTGAACACGAGGCGGCGGCGGTTGAAGCCGCGGCGCGCGCCCGCATGACCCAGGTC
+GACTGGGATGTGCAGCGGGTCTCCGCGATGATCCAGGCCCGGGGCGATAGCGCGGTCACC
+GTCCGCGTCATCGCTGACGAGCTGGGCATCTCCACCGGCTCCGCGCAGGACCGCAAGACC
+AAGGCGCTCGCCCTGCTCAGGGGCGAGTCCACCGGCGATCTCGAGCGGGCTGCGGCCTGA
+>orf00058 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGAACATCGGTGCGCACGCGCTGAATCTCAGCCTCAGCACGCTGAACAGCGGCCCGCGC
+CGCCCGCTGGAGGCGCTTGGTCTCTTCCTCCAGCGGGACCCCGAGAGCGCGCTCCACGCT
+GAACCCGAACGGGGCCAGCTTGAACGGCAGCAGCTCGTCCGGCGTCGCCGCCCGGCGCCA
+GCTCTGCTCGTGGTTCTCGTACTTCTGGCGCAGGCCCTCGCGGTAGATCCGCAACGCCTG
+GTGCTGGGCGGCGACCTCCTTGTAGGGGAGGTTGTACAACCGCATCCGACGGGCCAGGCG
+CGGCGTGGACAGCGGGGCGAGGATCCAGCGGGTCAGCGGGACCGACCCGAGCGGGGTCTC
+ACCGGCGAGCAGGTCGGCCATCCGGCCGATGTAGTGGCGAGCGGCCTCCACGGCGATGAT
+GAACAGCACCGGGATGACGCCGTGCATGGACGCAGCGAGCGGGTCCTCGGTCACCGGGCC
+GGCGGCGGCCGCGTTGAAAGCGACGGTCGCGACGGTCAGGCCGTGCGCGGTCCAGCGAAG
+GATCGGCCACGGCATCCGCTTGCGCATCATGTACAGATCGAGCGCGAGCAGCACGAGGAT
+GCCGGCGTCGATACCGACGGGGAAGGCGTAGGAGAAAGTCCCGAAGCCCTTGCTCTCCGC
+GAGGTGGCGCAGCGTGTTGTAGGAGCCGGTGAAACCGATCCCGGCGAGGACCAGGCCGCC
+GACGCCAGCGACGACGGCGAGCAGCCGCATGGTGCGCGGGTCGTCGTCCCGGTCGTCCTG
+GTCGTGCTGCTGGGAGCCGGGCTGCTCCTGGTCGTGATCGGTGTGGTCGGCCGGGGCCGG
+GACGGGCCAGGAGTGCTGGTCGTCGTCGTCCGGGCGGACCGTTTCGGGCTTGCGGATATC
+GACGGCGGTCATGTACTGCTCTCCGGGTCATCAGCGGGGAAGAACGGGTCCAGGGCCAGG
+CCGACGCACAGCCGGACCGCGCCGAACACGGCGAGGCCGACGGCGAGATGCAGCAGGGTG
+GGCCACAGGCCGTTCACGAAGAGGTCGAACAGGGCGAGGACGGTGGAGATCACCGCGATG
+ACCGTGGCCAGCAGAGCGGGCAGCGGGTTGCGCGGGACGAAGACGTCGTCCGTCATCTTG
+CTCGGGGTCGGGGTGGCCGTCGTGGTACTCATCGGGCACCCCCACTGGTAG
+>orf00062 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGGAGATTCGTCGTGGCAGACACCGCGACCGCGACCCCTGAAACCACCGCCGACACC
+ACCGGCGACGGGGCCACGGACACCGCCGAATACACCGTCGTCACCGAGCCCGAGACCACC
+ACCGACACGGCCTCGGACAAGCCGAAAGCCAACCGGTCGCGGCCGAGGGCGATGCCGCTG
+CTGATCCACGGCGGCAACGCAACCGGAATCGCCGCAGGCGTCGCCTACGGACTCGCCGGA
+GTGCCCGGTCTCATCGCCGCCGGCGCGGCCGGAGCCGCGGTCGGCGCCGCCGCGCTGGCG
+GGCCGCAAGAAGCGCTCGAAGGTCTCCGCCGCCCGCACGAACGCCGCGAGCAACCGCTCC
+GGCGGCGGGACGCACCGCTCCGGAGGTGGCGCGGGCAAGGGCGGCCTGCTCGGACGCGGC
+GGCGGTCGCGGCCGGGGCGGCGGCGGTGCTGCTGGTGGCGGCGGCCGCGGGCCCGGGCGC
+GGTGGCAAGGGCGGCGGCTGGCTGAACGGCTCCGGGTCAGGGGGCGGTGGGACCGGCACG
+AAGAACCGGCCCGGCGGCGGCAAGCACGGCGCCGGTGGCGGCGGGCGCGGCCCGGGAGGA
+ACGGGCGGCGGCAAGCACGGCCGCGGCGGCGGCCTGGGCGGACTGCTCGGAGGTGGCAGG
+AACCGGCGCGGTCCCGGCGGTCCCAACTCGCCCGGCGCGAACACCCCGAAGGGCACCGGG
+AACGGCAAGAACAACGGGGGAGGCAAGAACGGTCCCGGCGGGAAGGCCGGCGCCCACCAG
+CAGTCTCGCACCGGCAAGGCCTGGCAGACCCTCAAGGGCTGGGGCAACAAGATGCGCCGC
+AACAACGGCGGCACCTCGAGCTCCGGCGGCTCCGGATCCTCCGGTTCGGGCGGCGGCTCC
+AGCTCGGGCACCTCCGGCTCCGGCACGAAGACCATCACGCCCGCCAAGACCCGCCTCGGT
+CGCGCCCTGCAGAAGATGCGCGGCCTCGCGAGCAAGCTCCGCCGCTCCAAGAAGAAGAGC
+GGCTCCACCAGCTCCGGTGGAAGCGGCCCGACCTCGGGCCGCTTCCACCGGATGCGCCGC
+CTAGCCGCCCGCAAGCTCGGGCACTGGCTGCGCTGCGCAGGCGCCGGACTCCTCGCCGGA
+CTCGGAGGGCTGGCAACGCTGCCCCTCGGACTCCTGTGGGGACTGGCCCTGCTGCCGTTC
+AAGCGCCGCGACCCGCTCCACGGGTTCGCGCTGCCCGTCCGTGTCGCCGGACGGATCTGG
+CGGTTCTTCTTCCGCCGCTCCAAGGCCCGCCACGACAAGAGCGCCAAGGCGGACACGCTC
+AACCTCAAGGTCAACAACCCCAGGAAGGACACCGATCCCGTGACCGGACCCTCGCTCGCT
+GCTGGCACCACGGTGCTGGACGGCAACAGCTCCAAGTTCGCGATGGCCATGCGCGCCGCG
+CACGCCTCCTACACCGGCTACAGCCCGCGCAGCATGATGGAGGTCGCTGCCGAGTACGCC
+GGCCTGCCCAACGGCATCCGCGCCGCGGCCCTGGCGGTCCAGCAGATGGCCGTCAACGCC
+GACCAGAAGTACCCGTGCAGCAAGAAGGCGCTCGCCAAGCTGAGCGAGGCCTGCGCCAAG
+CTGGTCGCCGCCGCCGCTCGCGCGGACGGCATGGTCGCCTTCTTCCGCATGGTCCACGCC
+TTCGACATCGAGCGGATCGTCGCCCCGAGGACGAACGAGTGGATGTGGAACGTCACCCCG
+ACCGGCTCCGACGCCGCTGAGGGCGCGATGTTCATGCCCGGCCGCATCGAGTCCGGGTGC
+GTCCTGATGGCCGTGCTCTACCGCACCTTCGAGCCGGTCCACATGATGCAGGTCGGCTCC
+GAGTTCCAGGGCATCGCCTACGGGCTCACCGCCCTGGCCGACTGCGTCCAGGCCCTCTAC
+GAGCGCACCATTGCCCTCTACCCGGTCGACGACCGCGTCACCGACGAGATCGGCAAGCTC
+GTCTCGATGATCCGGGCCGCGTCCGACGACGCGGACATGGCCGCGAAGCTGTTCGTGGAG
+GACCACAGCCGCGAGATCAGCCACAACACCAGCCCCCGCAAGGGCCCGGCTGCCGAGTCC
+ATGTGGAACACCCCCCGCTGA
+>orf00065 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCGATGCGTCACTGGGACTGGTCGCTGCCCAGCGGCCACACCACCTTCCTCGGATAC
+GCCACCGAGACCGCCATGACCACCGTCGCGCTCGCCCCGCTCACCGGCCTGCCCTGGCAG
+GCTGCCGCCCTCACCCTGGGCAGCGCGGCCGCCGCCGGCACCGTCCACGACCTGCGCGTG
+AGCACCACCCTGGGCACGCTCACCACCCGTGCCGTCTCCTGGCTGACCGCGTCCGCATGG
+GCGTCCTGGGCGCTGGCGACCGCGCCGCTGACCACCACCGGCTGGGCGAGCGGCCTGGGC
+CTGGCCACCGTCGGCCTCGCCGCCAACGCCTCCGCCAACCGCACCGAGAACACCCGCTCC
+GAGCGCAAGAAGCTCCTCAAGCTCCGCCGCAAGTCGGTCGGCATCCTCCTGGACTGGGAA
+GACCGCATGAAGCGCGTCGCCCGCATCGAGGACTGCCACGGCAAGGACGTGCAGCACTGG
+CCCGGCGAAGTCGGCTACACCGTGGAGATGGACCTGCCCGCCGGCGGCACCAACGTCGAC
+GACCTCAACGGCTACGGCCCGAAGTTCGCCAGCGACCTGCGCCTGCCCGACGGCTGCGGA
+GTCGAGCTGTTCCCCGGTGCCAACCGCGGCACCATCCTGATCGAGGTCACCCTCAAGGAC
+GTCATCACCGCCGACATCCCTTACCCCGAGGACTACTCCGAGATCAGCCTCACCGAGCGG
+TTCCCGTTCGGCGTGTACCGCAACGGCGAGCCCGCGCTCGGCAGCCTCTGCAACGACTGC
+GGGATCCTCGTGGGCGAGACCGACGCGGGCAAGACCAACACCCTGCGCGTCGTCACCGCC
+CAGCTCGCCCGCATGCCCGACGCGCTGATCTGGGCGATCGACACCACCGGCGGCGGCGTC
+GCCCTCCCCTGGATCACTCCGTGGGCCACCGAGGGCATCGCGTCCGCGCCGATCGTCGAC
+TGGATCGCGCACACCGAGGACGAAGCCCGCCTCATGCTCAAGATGGCCGCCGAGATCATC
+GCCGCGCGCAAGGCCGGCTACCAGCAGCTGATGCGCGAGAGGAAGACCGACAACAAGCTG
+CCGATCAGCGCGGAGATCCCCGGCATCGTCATCATCACCGACGAGACCGCCTCCCTGCCG
+TACGACATCAAGGAGATGATCGACAAGGTCGAGCAGGAGGGCCGCGCGATGCGCGTGCGC
+GCACTCGTGGCCGCCCTGCGCGCCACGCAGGACGCCATCACCGCGATGATGAAGCTGATG
+TCGAAGTGGCGGGTCGGCATGACCGTCTCCGACGCCGAAGAGCTCGCCTACCTCTTCCCC
+GGCTACATCAAGATCGACCCGAAGGACGCGCCCGTCGCAGGGTCCGGGTGGAACATGCAC
+ACCCGCCTCGGACCGAAGAAGCCGACCGCGATGAAGGTATGGCGCCTGGTCGACGAGCTG
+ATGGACACCATCTGCCAGGCCACGGCCGGGCGACGGCCCAAGCTCGATGAGCTGTCTGCC
+GCGGTGGACAGCGGCGAGCACTACCCGCAGCGGTGGGCGCGCACCCTGCCCGACCTGTAC
+AAGGGGCAGAAGCTCACCGAGTCCGCGCAGTACGCCGTCGACAACGCCGGTGAGATCATC
+GCCGCCGCGACGCTGCTCGCCTCCGACCCGGTGCCGCAGGGCAGCAGCATGGCGTCGCCC
+GCTCCGGTGGTGCCGGCCGGGTTCGAGGGGTTCGGCGGTGCAGAGGAGCTGTTCGCAGCC
+GTCACCGCACAGCTGGACCCGAACGCCGCGCACCTCGCCGTCCCCACGGCTCCGGCCCCC
+ACGCCGGCCGCCGCGCCGACGGCACCGGCCCCGCTCCCCCGCCCTGCCCGCCCGGTCGAT
+CCGCGCGAGCTGGGCTGGGAGCTCCTGGCCGCCGCCGGGGCGACCGGCTACACGCCCAAG
+CTCCTGCACGAAGCCCTCGCGGCGGAGATGGACCGGCGGAAGGTGGGCGACGCCCCGGCA
+CAGCGCACGGTCGGCGGCTGGCTCCAGGCGTGGGCGAAGGACGGCAAGGCCATCAAGGAC
+GACTCCGGGCAGTACACCCGCTACGTCGCCCGCGAAGCCGCGGTCGGCCCGGCCGTCTCC
+GGCCCGGCCACCCCGGCCGGGTCGGAGACGGCACCCCTGCCCGAGGGTCTGGACGCGGCC
+CTGGTCCTCCAGGCCGTGGACTTGGTCGTCTCCACGCAGTTCGGGTCGGCGTCGATGCTC
+CAACGCAAGCTGCGCATCGGCTTCGCCCCCGTCCAGAACCTGATGGACTTCCTCCACCAG
+CTGGGCATCGTCGGCCCGTCCGACGGCTCAAAGGCACGCGAAATCCTGGTCTCGACGGCA
+GACTTGGACGCGACCATGATGAGGATCGCCGACGAACTCGGCTACACCACGCGCGACTTG
+GGCGCGATGGGCCTCGCGGCGGCTGCCGCTTCGCATGCCAAGGAGTGA
+>orf00066 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGCGGCCTGCTGGTACTGCGCGCGGATGTGGTTCAGTGCCTCTTCCCGGCGGAC
+CAGGTCGTAGACCCGGGCCATGTACGCCTCGTCGGTGGGCAGGCCGACGGCGGTGTGCGG
+GGTGGGGGCGGGCAGGCCGCCGGCGCCGGGTCGGGCGTCGGGGAACAGCTCCCAGATCTT
+TTCCAGGCCCTCGTAGGGGAGTGCGACGGCGGGCGGGGCGGGGGTCTGGTCGGTGAGGGT
+GAGGTCGCGGGGTTCCACGGCGGGCTCCTTGCGGGGGACAGGTGGTGCGGGAACGCGAAG
+GACCCGCCCTGCCGGGTGGCGGGGCGGGTCCGTGGTGGCCCGGGCGGGCCGTGA
+>orf00067 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGCTTTGACGGCGTTGGACAGCGCGTCCCACCACCGGCGGGCGTAGCGGTCGGCGGC
+CTCGCGCTCGCGCTGCTTGTTCTCGAGGCGCAGGAGCCGGGCCTGGAGGGTGGGGCAGGT
+GCAGTCGGCGTCCGGGTCCTGGAGGCGGGCCATGCAGCCGGGCATCAGGCACAGGTCGCC
+GTCCGGGTCGGTCCACCAGTAGCAGCCGGACGGGACGGTGCCGGGCGTGGTCGCGGCGGG
+ATGGTCGCGGTCACCGGGCGGCACCGTCAGGCCTCCGGGAGCTGGCGGGCGGAGTAG
+>orf00068 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCAGCTGCTCGCGCTCAGCGCGGCGGCGCGCGCTGTCGTCGAGGAGGGTGGCGAGGTC
+GGTGAGCTCGGTGTCGGTCAGGCGGATCTCGTCGACTGTGCTGGTGCCGTCGTGGACGCG
+GAGCAGCGCTGTCCAGTCCCCGGTGAGGAGGGTGGGCGGGGCGGCGTCGTCGAGGGCGTC
+CCAGAGCAGGTCGGCGTCCGCGCTCTCCCCGGTGGTGTCGAGGCCGCAGTCCTCGGCGAG
+CTGGAGGATGTCGGGGGCGGCCAGGGGCAGGTAGGCGAGGTGGCTCCCGTCGGGCGCGAG
+GAGGACGACCCAGCCGCGTGGCGGGTTGGTGTCCGTGACAGTGCTGCGCTCGCGCAGCAC
+TGTGATCAGGCGGTCGAGGGCGTTCATCAGAAGGTCGGGTCCTTCCTTGCGGTCTGCTCG
+GCGTGCAGGGTGACGACGTGGAGCCACTCGGCGCTCAGGCGCAGATCGCCGAGGACGAGT
+CGGGTGGCCTCGGTGAGCGCGAGCCGCTCGGCGGGGGTGAGCCGGTCCCACAGCGCGTGC
+GCGTGCTGGTGA
+>orf00069 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGGGTCGCGGAACGGGCGCAGGTCCAGGGTGATGTCCGCGTCCTGGGGGCGGGGGCC
+GTGGAGGTGCCCGAAGGAGGTGATGTGTACGCGCACGAGACGCTCCTTGCTTGTTGA
+>orf00074 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGGCGAGGGCGTGGGCGGTGAGCTCGCAGCTGGGGCGCCACAGGCCGAGGCGGCCGAG
+CGCGGGGATCGGCTCCAGGAGCGGGGTGACGTCGGTGAGGGTGAGGTGCCACGCCTCCGG
+GTCGGCCCACGCCGAACAGGCGCGGCCGGGCTCGTCCTGGTGGCAGTCGGTCAGGCGCGC
+GACGGCCAGGACGGCGCCGAACTCCAGCGGCTGTCGGGGGAAGGTGCAGGTGACGCGGGG
+GTCGGTGAGCGCCTGGTGGTCGGTGCCGCGGCCGGCGTGGATGAGGAACCATCCGCGCCA
+CCACCAGGGCCGGGTGCGGTTCTCTACCCTCTTCGAGCCGTGGGCGATACAGGAGGCCCA
+GGGCTGGCGGACGGTGAGCGCGCGCAGCCCGTCGCCGCGCGGCGGTGTGCTGGTCATGCG
+GCCTGCCCCCACACGCTGGTGCCGGGACGGCCCATCCTGCGCCCGTTGATGGAGGGGACG
+CGGGTGTGCGCGGTGGTCGCGAGGACGGCGCGGCCGGTGTGCTTGCCGTCGTAG
+>orf00075 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGGGAGGCCGAGGGCGTCGAGGAGGAGGACGAGGTCCTCCTTGCCGTGGGCGTGGCG
+GGCGACGGTGCGGGCGGCGGCTGCTTCGGTGTCGGGGCTGGGTGGGGTGAGTTCGAGGGC
+TTCGGCGGTCTGGGCGGGGTTCAGGTCGGCGTACACGGCGCTCACTTCGCGCTGAGCTCG
+TGCTGGAGGCGTTCGCGGTTGTGGCGCTGCTGCTCGGGGGTGAGCTTGCGGGTGCGCGGG
+CGGGGCGTGGTGGTGTGGTGCCAGGTGGAGGTGGCGGGGGGTTCGGGGTAG
+>orf00076 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCGCTCGAGGACGGCTGTGGTGACGGCGGCCGGGTCGGACAGTTCCGGCGCGGTCTC
+CAGCACGGCGAGCTCGGTGACGTCCAGCCGCATCGGCTCGTCCGGCGTGCGGGGCAGCCG
+GAGGTGGCCGGTGACGCGGAGCTTGTCGCCGGGGACCAGGTCGTGGATGACGGTGTGCGC
+GAGCGCCGGGTCGGTGACGCTGCAGGGAAGGATCATCTCGTCCGTGCGCTCGTCCGTGGG
+GGAGACGGTGAGGCGGAACCGCGCCGTCGATCCGTGCAGGTCGCCGGGCACGGTCTCCTC
+GTCCAGGGCTATCGCGTCGTCGGTCATGGTCAGCCGGCCTTCCGGACCGGCGCCCGGTGC
+GCGGTGTCGTACGCCTGA
+>orf00077 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCCACCCGGCAGCGCCCAGGCGCCCTCGAAGGGCGGCCAGTCGCGCTCGATCAGCAG
+GACGTTGCCGTCGGGAGTCAGGGCGACCACGTCGGCGGTGTAGCGGGTGGTCTCGGTCTC
+GGTCATGAGTACCTCTCGGTGAAGTGGATCAGTGGGTAG
+>orf00078 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCATGCGAGCTCCCGGGCGAGGGCGCGCATGGCGACGGACTGTGTGCAGGTGGGGGA
+GTAGGACAGGAGCGGTTGTTGCATGCGTACGGCTTCCTTCTGCTCCTTGAGGTCGCCGAC
+GAGGCCGACGACGCGGGGGTCCTTTATGTCGACCCAGCCCTGGAGGGAGCTGGTGGCGAT
+GTAGCCGCGGCGGGCGTCGTAGAGGTTGACGACGATGCCGAGGTAATCGATGACGACGTC
+GAGGTCGCTGCGGAGGTCGTCGATCTGGGTGGTGAGCATGTCGTAGGCGTCGGCGGAGCT
+GTCTTCGGCCTGGACGACGATGAGGGTGCCTGA
+>orf00079 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTTGGTGAGGCTGTCGCCGTCGAGGGGGAGGGGCTCGGCGCCGAGCTGGCGGGTGAG
+GTGGCATTGGGGGTCGAAGTCGATCAGGAGGACGCGCAAGCCGAGGCCGGGGAGGTTTTC
+TACCTCGAGCGCGTCGCTGCTGCCGTCAGTTTCCGGTGA
+>orf00080 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGCGTACTGCTGGGCGAGGGCGTAGACCTCGGAGAGGACCACGGCGGCGCGGCG
+CTTCTCGGGGCCCTCGGCGGCGCGCATCGTGGCGTGCCCGGTGCGGATGAGATCGGGAAG
+TACGGCTGCGACAGCGGTGCGCTGCTCGCGCACTCCGTGCCAGATCGCCCACGTCCGGGC
+GACCCGCCCGGCGAGGACACCGACGTCCTCGGGCTCCTCCTGAACGAAGAGCGGCGCGTG
+CACCGCGGCTCGCAGCTCTTCGACGCCGGGGTGGGCGAGGCGCCCGCCGGTCGCCACGGG
+CATGGACGTCTGCCCGCCCGTCAGCTCCGCGACGTCGGTCAGGCCCAGGACGCGGCACAG
+GCGGTAGAGCGTCGGCAGCCTGTCCTCGGTGCGCTGCCCCGTCTCCACCCTCTTCACCCA
+GTCGGGGCCCACGCCGAGGAGGGAGGCGAGCTGCGGGCGCGTCAGGTGCCGGGCTTCGCG
+CGCGCGCCGCAGCCGCGCGCCGTCCACGCACAGGGTCTCTTCGGTCGGGCCGTCCATGAG
+GGGCCCCCTTCCGCTCTTCTTCTCTGTACCCGCAGCGTAGCCACGCGCACCCCGGCCCCG
+GACCGAATTGCCCAGCAGGGGCGGGGGTTGGGCCGTGCCGAGGTGGTGGGCGCGCCCGTT
+GAGGAGGTGGTGAGAGGAGCGGGGATGAGCGAGCTGCCGAGCGTGTGGGACCTTCTGGGG
+CGTCTGGGCCTGGCGGGCGGGGTGGTGGTGGGGGTGGTCGGCGCCGTCGTCCTGTCGCTC
+GTGATCGTGCCCGCCGAGGACTTCAACCGCGGTTTCGAGACGGGCGTGCGGGCAGTGGTG
+CGGTACCTGTCCGGCCGCGAGCTGGGCAGCGGGACCGCACCAGGTGACGCGACGTGGTGG
+CGTCCGGCGACGAACGAGGCCCCGGCGCCGCCCCCGAGGGCCCGGCCCCTGCGGGCGGCT
+GCGACGGCGGTGAAGCGGTGCGCGGTACGCGCGAGGACGTCGGGAGTTCGGTACGGGCGG
+CGGGTGCGGGGACGGGTGCGCGAGCGGTTCCCGGACGTGCTGCGGGCGGCGGGGCGCGGG
+GTGAGGTCGGCGGCGGGAGCGGGCCGGGCCGCGCGGTCCCTCGCGCAGTGGCCGGCACTC
+GGACGGGCCGTCGCCCGGACGCTCGCGCGGAGCGGACCGGCGGCATGGGCCGCAACGGCG
+GCGGCCGGGGCGGCGTGCGGGCGCGGGGCGGGCCGGGCCGGGCGGTGGACGGTGCGGGCC
+GGGCGGGCGGCGTACGCGGCGGCGGTGCGGTCGGGACGTGCCGCAGGGCGGGTGGTGAGC
+GGCGCGGCCGTGGGAGTGGTGCGGGTGCTGCGGGCGTGGGGGCGGTGGCCGTACGCGGCG
+CGCGCGGCCGTACGGATCGCGCCGGGGGTGCTGGCGTGGGGGGTGCTCGCGGCGCCGGGG
+ACGACCCGCGCCGTGGTCCTGGTGCTCCTCGGCGCCGTCGTGCTCGCAGCGCTGAGCGGG
+CCGTCAGGGGCCCGGTGGTGGTGTGTGCCCCCGGCACGGGAACGGCGCGCCTAA
+>orf00084 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGGTGGGCGTTGCCGAGCGAGGGAAACGGGCACTCAGGCGGCGAAGCCGATGTTGGT
+GACGTACTCGTACTGACCCCACTGCGAACCGAGGTCGACCACCACCTCGTCGACCCACGC
+GGCATCCAGGCCCGCGTCGTCCCCGGCCTCCCACGCGCCGACGATCCGCTCCCACTTGCG
+CACGTTGAGGGTGCGGTACTCCACGACCCGCTGGCGAGGGCGTTCCACCCCGGATTGATT
+GACGGGGTGGAACTCGACGCGGGTCCCCCGGCCCTGCCGGTTGAGGCGGGCCAGGAGGTG
+CCGGGAGACGTTCTGACGACGCACCGCGCGGTAAGTGGCGTCGATCTCGCGGAGCGTACG
+GGCGGAGGGGCGGCGTGTGCCCTGCATCTGCGCCTTGATCGTGCGGTCCGAGATCGTGAG
+CCCGGCCTCCCGGGCGGCGGCGAGCTGGCGGGCACTGCTCGTGAGGTAGCGCAGCCGCGC
+GGTCAGGCCACGGCGGGTGGTGACCGGGGACGCGATGAACCCGGCGAGGCTGTCGAGGCG
+GCGGGCGACGAACTCGTGGCCCTTGACGCCCTGGGCGCCGTACGCGCCGAACTCGATGTT
+CCGCTCAGGCATCCCGTCCCCTCCCGTACGTTGCCGAATTACGGCACCTTGCCAGTATAT
+CCCCTGTTTTGTATGGGAGTTGACGCGGTAGCGGCCTCCCCGTACCGGCGGCTGCGGTAC
+GGGGAGGCCGGGTGCCCGCGCGCTTCCTGCGGGGGTCAGGGGCGCGGGCCGTCCTGGAGG
+GAGAGCCGCCACGCGAGGGGGAGGTACACGTCGAGCGCGGCCCGGGGGGACATGCGGAGG
+GTGGTGCCGTCCACGCAGCGCACTTCGAGCCGGGGAGCGGTGGAGGCGCGGGGGGCGGGC
+AGCCGGGGCGCCTGCGCGGCGACGCGGGTGACGCCCCCGTACCGCAGGCAGTGCCCGTCG
+CGGAGCAGGACGGCGGGCAGGGGCCAGAACTCCCGGGCCGCGCCGGGGGGCTCGGCGGCG
+TCGGCGCGCAGGACCGGGGCGGCGTCGGCGGTGCGGGTGAGGACGTCCGCGAGGCTCACC
+GCGACGCCGGAGGCGGCACCGCCGAGCGCGACCATGGCGGTGCCCATGGCAGCGGGGCGC
+TCGGCGCCCAGAGAGGGCAGCCGCAGGCCCACCCGGTCCAGAGCGGTACGCAGCGCGGTC
+ACGGCGTCGGCCGCGTCCTCCTCTTCGCCCGGCTCCGCGCGGTCGGCGCGCAGGTCGGGG
+AGGACGGCGGCGGCGTGGGTGAGGACGGCGGCGAGGCGCAGGGCCGTGATGGCGGGGGCG
+CGGCCGAGGGTGACCATCGCGGTGCGGCCGGTGGGGAGGTCGCCGCGCAGCTCGGGGAGG
+GTGATGCCGAGGCGGGCGGCGGCCTCGCGCAGCCCTGCTGCCGCGCCGTCGCCCGCCCGG
+CGGCCGGTGAGAGCGTCGAGGACGCTGTCCGCCTCTGTGGTCGTGCGGGTCATGGGGTCG
+CCTCCCGGGTCAGGGTGTCCAGGTCGGGGAGGGGCACGATCCACTCGCGCCCTCCCCCGC
+GTGCGGGCCGCAGGAACACCACGACGACCTCCCCCTCCTTGTGCCACTCCTTCGTCACGG
+CGACGGGCAGCCAGCGCTCCCCGTCGGCGTCGAGGCGGGGGCGGCGCAGCGCGCGCGGGA
+GATCGGTGTAGTACTCCAGGTTCGGCACCTTCTCAGCGTGAGAGCCCGTCACCCGCCACA
+GGGGGCCATTTCGGCCCCCCTACCCGAGGGGGCCGAAATGGCCCCCTGTGGCGGTCCTCG
+CCCGGTACGCCGAGGACCGGGCGATGCCGCGCGGCGCCGTCTACTCGACGGGCACGCCGA
+CGAGTGAGGCGACCTCGTGCGCGGCCCGGCGTAGGGGCGCGGGGGCGGTACGAGCGAGGT
+CCTCGGCGAGCGCGCGCCCGGCGGGGACGTAGCGCACCGCCTCCGGCGAGGTCGCCACCG
+CGAGACGCAGGTACGTCAGGGCGGCGGCGACCTGGCGCCGCGCGCGCTCGCCGCGCGCGG
+CGTCGAGGTACAAGCGGGAGCGGCGCTCGACGCTCGGGATCGTCTCCGGGTCCACCTCGG
+TCATGCGCTGGAGCGCGGTGCCGTGGGCGCCGAGGTCGGCGGCGATGCTCACCCCGTGCA
+CGGCGACATTGCCCTCGCCGAACGCCGTCCACGGGTGCATGTACGCGGTGCCGAGGCGGG
+CAGCGGCGCGGTCGGCCTTGTCCCACCAGTGCCACGCGTCGCCCTCGCGGCGCTCCTGGG
+CGGCGCTGA
+>orf00085 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGGCCAGTGGTCGCGGTCCGCGACGCCGGTGTGCCACTGGAAGACGGCGTCGAGACG
+GTCGGTGCCAGCGCCGGAGTCGTCTTCGCTGGTCCACCACTGTGCGGGCGCAATGTCGCG
+GGCGGCGAGCGCGTCGGCGACAGCGGCCATGTACTCGTTGTGCGGTAG
+>orf00086 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCGCCCATCTGGATGGGGTCGATCTCAGAGGCGTCGACGAACGCCTCGATCTCCAGG
+GCGCGCGCGGTGGGGAGGGGGAGGTCGTCGAAGTCGGAGTCCGAGAGCGGGACCACGGTG
+TCCTTCGAGACCTCGTACCCGCGCGCGATCTCGTCGGCCGACAGCTCCTTGCCGTCGAGT
+TCGCACACCTTCCGGTTGCGGACGAGGCCGTCGTCGGCGGTGTGGATCTGCCGGAAGTGG
+ATGCTGTGGTCGCCGACGGCGGGGAGCATTTTCACGGGGATCGTGACCAGGCCGAAGCTC
+ACGGCGCCGGACCAGGCGGGACGGACCACGACTACCTCCAGGCCCCCCGGGAGCGGATGC
+GATCAGCGTAGGAGGGGTGGGGGGCGGCGGCATCCGGGGCCGGACCCGGCTGCCGCCGGT
+CAGCCCAGGCGGCAGGTGCGCCAGTGCAGGCCCGTACGGACGAGGGCGCCGCTCTCCTCC
+AGGGCCTTCAGGTGGTGGGCGATGGTGGCGAGCGCGAGCCCGGTGACGCGCTGGATCTCC
+CGTACGGAGGGGCCTTGGCCGGTCTCGGCGATCGCGTCCCGTACGGCGGCGAGCACGCGG
+TGGCGCCCGTCCCCCGCCGTCACCTGGTCCCCCGCGAGGGCGGGGACGCGGGCGCGGGCG
+GGCGGCACAGCAGAGCCCGGCGGGCCGTGGTGGGCGGGCCGTCGAGCAAGCGGGCGGACT
+GCCGGATCAGTGCCCGGCGCAGAGGCGTGGCGGCGGCGGGGTGTGCGAGGGCGAGGGCGT
+GGTAGGTGGCTCGCCGTTCGAGGGCGAGCCGGAGCAGGGCATCGTTCACACCCCTACCCG
+ATCACATGTTCGATTTTTTGGGCAACCGAACCCGCGCAAAACGCCACATCACCGCCGTGC
+GCGCGCTCTGGCCGGTCGTACCCTCGCTGGTGTGACCGATTTCCCCGACGATCTCCTCGC
+GGCTCAGCGCGACCTCACCGCCGTACGCGCGACCCTTTCCGCCCGCCTCGCGGCGCTGCC
+GCCCTCGGCGGAGCCGATGCCCGCGTGGGAGCGGCCGGACGGCTACTGGGCGGGCGCCCG
+TACGCACCCGGCCTCCCCGGGGTGGAGCGAGGAGGAGCGCCAGGAGGTCGCCGCGCTCCG
+CGAGCGCGAACGGGATCTCGCGGCGGCGATCGTGACGCACGAGCTGTGGGCGAGCGTGCC
+GGCCGAGGAACGGATGCGGGCCCGCGACGCACTCAAGCACGCCCACGAGACACAGGCCGC
+CGAGGCGGCGGGGGCCCGGGGCTGAGTGTGTCGGGCCACGAAGGCGCGAGCAGCAGCGGG
+GCGCCGGGGGTGTGGGTGGTGCTCGCGGACGGGCAGGAGGTGCGGGGGCGGCTCCTCGCG
+CGGCGCCAGCTCCCGGACGGGTGGCGCTACCGCGTCGCGCTCCCGCTCTACCGCAACGTG
+GGCGGGGAGGGCCTGGAGGTCGAGGCGGCGCAGTACGAGGTGTGGGTGCGGGCCCCCGAG
+CATGTGCGGCCCGTCGAGGACGTCGACTACACGGGCGTGCCGACCACGGCGCTCCCGGCG
+CCCTCGCTCGTGGAGGTGGCGCTCGGGCCGCGCAGGCCCGCCGGGTGGGTGCTGGCGAAG
+AGCGGCGGCGGGCGCCGGGGGCCCTCCCGTGCGGTGCTGCACGCCGTGGACTGCGCCGAG
+GCGCCGCCCGGCCTTCCGGTCCTGCGGGTGGAACAGGCGCTCAACGCTGCCGAGCACCCC
+GCCACCCGGGCTTGCGCCCTGTGCGGGGCCGGTGCGGAGCTTGATCCGCTTCTGCGGGGC
+TTCGACCCGCAGGAGGACGCGGTGGGAGACCCCTGA
+>orf00088 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGGGTGGGTGGCCTCGTAGAGGATGCGCGAGAGGTCGGCGCGCAGGATCTCCAGGTC
+GGCGATCGGTCCCTGGCCGCCGAAGGCGCCGCTGGTGAAGGCGGCTCTGGTGCGGTTCGC
+CGCGTCGACGAAGCGGATGCCTTCTTCGCGGGTGGCGTGGTCCCGGAGGGTGTGTTCCAG
+GCCCATCCTGCGGGCGACGTCCCGTCCGGCACCGCGCAGGTCCACGGTCTGTCCGCCCTC
+CCGCGGGGCGGGGGCCCGCTCGACGAGGGTGGCCTGCATTCCGTGCCGTTTGAGCCAGTG
+GGCCAGGGCCGGACCGGCGATACCGGCTCCCGCGATCAGCACATTCCGGTGCGTCATGGC
+GCTCCCTTTCGTTTTCCTGGGCTTCTCCCGCCTCGGGCGGCGGCTCCGGTGCGGTCCCGG
+CCGGGTCCGCTTGTCGTGCACGGCCCCGGCCGGGGCTCAGATGGCGAGGTGCTGCTTGGT
+GCCGGAGTCGTCGGCAGTGGTCTCGGGGGTGATGCCGTGCTGCTCGTCTTCGGGGCGGCC
+CTTCTTGGGCAGCAGGAAGGTGATCGCGAAGAAGACCACCAGCAGGCATGCCTGGACGAT
+CAGGGCCCGGTGGAAGCCGCCGGTGAAGTCGCCGGTCTTGGCCTGGGCGAAGAACACCGA
+GCCGAAGACCGCGACGCCGATGGAGCCGCCGACCGCCTGGACCGCCGACAGGACCCCGGA
+GGCGGATCCGATCTCGTCGTCGTCGACCGCGGCCAGGATGAAGCTGAACAGTGCGGCGAT
+CACCATGCCGGCGCCGATGCCCGCCACTGTCGTGCCCGGGACGATGTCCCAGATCGAGAA
+CGAGGCGGAGTCGAGGCCGTCGAGCTCGAACCACAGCACGGCGGCGCCGGCCAGCTGGAC
+CAGCGGTCCGATCTGGAGCACCTTGCGGCCGATCCTGTCAGCGAGGAACGCGCCGCTGAT
+GGCGCCGCCGATCGCGGTTCCCACCGCGAGGGGCAGGTTGCCAAGGCCCGCGTCACCAGC
+GGTGAAGTGCTGGCCGATCTGGAGGAACAGGGTCAGGACGAGCTGGGTGCCGATGAGTCC
+GCCGAAGAACAGGGCGATGCCGCCGAGCCCGACGGTGAAGGCGGGCTTGCGCAGCAGGCC
+GGGGGTCACCAGCGGCTCGCGGCCCACGGCGGCCGTGCGACGCTGCTGGAGGGCGAAGAG
+GGCGAACCCGATCGCGGAGGCGGCCATGGACAGCCACGTCCACAGCGGCCAGCCGCTCTC
+CTGGCCCTGGTTGAGCGGCAGCACCAGCAGGGCGCAGGACGCCACGATCAGGGCGGCGCC
+GGTCATGTCGACCCGGACCGTGCGGTCGCCCGCCTTCTTGGGCACGAATTTCGCGGCGAC
+GATCAGTGCCGCGATGCCGATGGGCAGGTTGATCAGGAAGACCGAGCGCCAGCCCAGGCC
+GAAGAAGTCGCCCTCGATGAGGAAGCCGCCCAGGACTGGGCCGATGATGCCGCCCAGTCC
+GAGGACGGGGCCGAAGATCGCGAAGACCTTGGTGAGCTCGGGGCCGGAGAAGTTCTCGCG
+CAGCAGACCCAGGCCCTGGGGCAGCAGCATCGCTCCGGCGGTGCCCTGCAGCAGGCGGAA
+GGCGATCAGCGACTCGATGTTCGGCGCGATCGCGCACAGCAGCGATGCAGTGGTGAAGGC
+CGCGAGTCCGATCAGGAACATCCGGCGCCGGCCGTAACGGTCACCGAGCCGCCCGCCGAG
+CACCAGACCGGCGCCCAGGGTGAGGGCGTAGCCGCCGATCACCCACTGCAGTCCGACCGA
+GCCGGCGCCGAGGGACTTCTCCAGGTCCGGTCCGGCGACGTTGACGATCGAGGCGTCCAG
+GAGGTCCATGATCTCCGCGACGATCATCACCGCCAGGATCAGCCACCGCCACCGGTAGGG
+CTCGGTCGTCTCCTCGCGGGTGGGGGACGGGTCACGCATTCCAGTTACCTCCATGGTGAA
+GTAATTCCATCATGA
+>orf00089 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCCGTCCATGGTGGCGTTCAGGTCGGCCATGAACGCTTCGACCTGTTCCAGGAACTG
+GGGCGGGTAGGGCGACATCGCGGCGTCGAGGCGGTGGGCGAGCGGGCCGAAGAACTCGTC
+CGCCCGCTCCTGGATGTGCTCGCCGCTGTGCAATGTGACGATGCGCCGGTCGGAGTGCTC
+GCGGGCGCGGGTGATGTGCCCGGCCGCTTCGAGGCGGTTCAGCAGCGCGGTGGTGGCGCC
+GGTGGACAGGGAGATCCGTTCGCTCAGCCGCGCCGGTGA
+>orf00092 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGATCAGCCCGCGGTGAAGTCGCCGTCCGCGGCGAGTACGGCGCCCGTAACGAAGGCG
+GATCGCGGGAGACCAGGAAGCACAGGACTTCCGCGACCTCGTGCGGCTGCGCCACCCTGC
+CCAGGGGGTGGACGTTCCCGAAGGACGCGAGATAGGCGCGGCTGTACGGCCACGGTGGGC
+CGGCTGTCGGCGGCGACCCGGTCCCGGCTGGACGACCTGGTGGCCGAGGACGCCGGCGGG
+GAGGAGTCGGCGGGCGGCGGGGTGTCATTCTTCTCCGAGCTGAAGGCGGACCCGGGCGCG
+CTGGGGCTGGACAGTCTGCTGGCGGAGGTGAACAAGCTCCAGCGGGTGCGTGCGCTGGAG
+CTGGCGCCGGAGCTATTCGGGGACGTGTCGGAGAAGCTGGTGGCGGCGTGGCGGGCGCGG
+GCGTCGAAGGAGTACCCCTCGGACCTGCGGGCGGCAGCCGGGCCGGTGCGCTACACGCTG
+CTGGCCGCGCTGTGCCATGTGCGGCAGACGGAGATCACCGACTCGCTGGTGGAGCTGTTC
+ATCCAGCTGGTGCAGCGGATCAACACGCGGGCGGAGAAGAAGGTTGAGGGCGAGTTCACC
+AAGGATCTCAAGCGGGTCCGTGGCAAGGAGGGGATTCTGCTGCGGCTGGCGGAGGCCGCG
+GTCGCGGAGCCGGGCGGCACGGTCCGCAAGGTGATCTTCCCGGTGGCCGGGGAGTCCACG
+CTGAAGGCCCTGGCGGCGGAGGCCGCGGCGAACGAGGCCCGCTACCGGGCCCGGGTGCGC
+ACGGTGCTGCGGTCGTCGTACTCGGGGCACTGGCGGCGGATGCTCTCCCCGCTGCTGGGG
+GCGGTGGAGCTGAAGTGCAACAACACCGCTTACCGGCCGGTGATGGACGCCATCGACCTG
+CTGAAGCGGTACCTGGACCAGCCCATCGCCAAGGAGGGCGCGTTCTTCGACGAGTCGGAG
+AACATCCCGCTGGCCGGGGTGGTGCGCGAGGAGTGGCGCAAGGCAGTGGTGGACGAGCGC
+GGCCGCGTCGAGCGCATCCCGTACGAGCTGTGCGTGCTGGTCAGCCTGCGGGACGCGCTG
+CGGCGCCGGGAGATCTGGGTCCCGGGCGCGGGCCGGTGGCAGAACCCCGAGGGCGACCTG
+CCCCCCGACTTCGAGGACAACCGCGATGTCCACTACGACGCGATCCGCCAGCCGCAGGAC
+CCTGGGTCCTTCATCGGGGCCCTTCAGAAGCGGCTGCGGGAGGCCCTGACCCGGCTCGAC
+ACCGCGCTGGAGCTGGGCACCACGGGCGGCGTGGACATCGTCCGCAAGCACGGCGAGCCG
+TGGATCAAGGTCTCGCCGCTGGGCAAGCAGGCAGAGCCGGAGAACCTCGTCGCGCTGAAG
+GCGGAGATCGAACGCAGGTGGGGCACCATCGACCTGATCGACATCCTCAAGGAGGCCGAG
+TTCGCCACCGGGTTCACGTCCGAGTTCGCCTCAGTCGCCACGAGGGAGGCGGTCCCGAAG
+GCGGTGCTGCGGCGCCGGCTGCTGCTCGTGCTGTTCGCGCTGGGCACGAACATGGGCATC
+AAGCGGGTCGCGGTCACCGGCAAGCACGGCGAGAGCGAGGCCGTCCTGCGCCGGGTGCGG
+CACCTGTTCGTCAACCGCACCAACCTGCGCGCCGCCCTGGTCCGCCTGGTCAACGCCACC
+TTCGCCGCCCGCGATCAGGCGTGGTGGGGCGAGGGCACCGCCTGCGCGAGCGATTCGAAG
+AAGTTCGGGTCCTGGTCCAGCAACTTCATGACCGAGTGGCACCAGCGCTACCGCGGGCCC
+GGGGTGATGATCTACTGGCATGTCGAGCGGAAGTCGCTGTGCGTCTACTCCCAGCTCAAG
+TCCTGCTCGGCCTCCGAGGTCGCGGCGATGATCGAGGGCGTGCTGCGGCACTGCACGGAC
+GTGGAGATCGACCGCCAGTACACCGACACCCACGGGGCCTCGATCGTCGGGTTCGCCTTC
+GCCCACATGCTCGGCTTCAACCTGCTCCCCAGGTTGAAGAACGTCGGCTCGGCGCGGTTG
+TACCGGCCGGCGGCTGGGGAGGACGACACCTGGCCGCATCTGGCGCCGGTGCTGTCGACC
+AAGACGATCGACTGGGACCTGATCGCCCAGCAGTACGACCAGATCGTGAAGTACACCACC
+GCCCTGCGGCTGGGCACCGCCGAGGCCGAGCAGGTCCTGCGGCGCTTCACCCGCGGAGGC
+CCCAAGCACCCCACCTACCGGGCGATCGAGGAACTCGGCCGGGCGGCACGTACGGCGTTC
+ATCTGTGACTACCTCGCCGACGCCGACCTGCGCCGCGAGATCAACGACGGACTCCAGGTC
+GTGGAGAACTGGAACTCCGCCAACCACGACCTGCTCTACGGCAAGGACGGTGATCTGACC
+GGCTCCGACAAGGAGTCCCAGGAGGTCTCGATGCTCGCGCTGCACCTGCTCCAGTCCGCG
+CTGGTGCACGTCAACGCCCTGCTCCTCCAGGACATCCTCGCCGAGGAGAAATGGCAGAAG
+AAGCTCACCGACGCCGACCGGCGGGCCCTGTCCCCGCTGTTTTGGACGCACGTGAACCCG
+TACGGCCGGTTCGAGCTGGACATGAATTCCCACCTGGACCTCGTCGCCGCCGTGGCGGCT
+TCGGTGCCCGGCCCGCGCAGCGGCGAGCCGGCCACGTCCCCGGCCTGA
+>orf00093 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACTCGCGGGAGTGGCCCTCCCGGCGTCAAGGGACGGCGACCACGTTCAGGGCTCCGG
+GGGGCATCAGTGCAAGGGCCCCGGCGCGACGCCGTCGGTCGCCTCTTCATACACAACCCG
+CGAGGTGTCCCTCAGGGCGCCCGCGAGGGGGAGGCACGCGGCCATGACGGCGGCTACGAC
+CAGCAACGCCGGTGCGAGGCCGGTCCGGTCGGCGAGGGCGCCGAACAGGGGCGGGCTGCA
+GACAAAGCCGCAGTACCCGATCGAGGTGATCACGCCGACCCGCGCGGCCGCCTGGGCGGG
+GTCGTCCGAACCGGCGCTCAGACCGAGGGGAAAGCCGAGTGCCGCGCCCGCTCCCCACAG
+CAGCGTCCCCGCGAACCCCGCCCAGAGGCTGGGCCCGGCCGCGAACAAGACCACCCCGAG
+GCAGGCGGCCAACGCAGACGCGCGCAGTGCTCCTGGCCGGCCCAGGCGGCCGACGATCAG
+CGGACCGAGCCAGCGGCCGAGGGTGACGGCCGCGAGGAAGGCGGCGTAGGCGAGCGTAGC
+GACTGCGGCCGTGGTGCGGTGGCGGTCGATGACAGTGAGGCTGACCCAGTTGCTTCCCGC
+TCCTTCCGCCAACGCGAAGGCCAGGGCGACGAGGCCGAGGACGACCGTGCGTGGGTCGCG
+CCATGCGCGCTGTCCGGGCTCCTGCGTCGTCCTGCGTGGTGGCCATGCCGGGGGTGCACT
+CCGGGGGAGGAAGCGGCGAACCGCCACGGGTGTCAGCACGGTGATGAGCAGGGCCACCGC
+GCCGATGTGCAGGCTCACCGTTACGCCCAGCGCCGTCAGGAGCGCGCCGAGGCAGGCGCC
+GACGACGGTGCCGAGGCTGAACCCGGCGAAGAAGCGGGGCATCAGAGCGCGACCGAGTCG
+TCGTTCGAGGGCTGCGGCGTGCACGGCCACCGCGACATCCCAGAAGCCCGTGGCAGTGCC
+CAGGACGAAGAGGCCGATGAGGAGCAACGGTGGCCAGAGAGCGAAGCCGGTCGACACCGC
+AGCGAGGCCGGCACCTACGAACGCGCCCACCGTGGTGACGGCCCGGCGCGGCCCGACCCG
+TGTGACGAGGAGACCGGCCAGCGGCAACGCCACCAGACCGCCGACCCCGAGGAGGAGCAA
+CAGGAGACCCACTGCCGCGGCGTCCAGATCCATGCGGTCCCGGATCTGCGGCAGGCGGGA
+CGCCCACGTGGCCCCGGCCAGGCCCAAGAGGGCGAAGACGAGGTAGGTCGCCCGTACGGC
+GCTCGCGGTCTCGCGTGCGTACGAGCCTGGCGCGGCACGGGGTTTCACTTACTCGGCCCG
+GCGGCCGGGCCGAGCGTCTGCGCCAGGGACTCCCGGGTCGCCTCGGGCGGTTCCTGGTCC
+GTGGAGAGCAGTGCGTGCATGATCATTCCTTCCAGGAGGGCATCGAGGCGGGCGGCGGCC
+CGCGGCCCGGTGAAGCGGGCCAGCACCGCCCGGCTGGAGCTGGTCCACTGCTGGGTTAGG
+ACGCGCAGCGCGGGATCGCGCAGCGCCGCCAAATGCAGTTCGAAGCCGAGAACCGCGCTG
+CGATGCCGGGCCGGTCCTCCTTGGACCACCGTCACCAGGACGTCGATCAGGTCTTCGCGC
+GATGCCACCTGGGTGAACAGGGCCTCATATTCGGCGGTGCGCTGTTCGACGTACCAGGCG
+AACGCCTGCGTGCACAGTTCGGTCAGGCTTGCGAAGTGGTAG
+>orf00094 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGAAGCCCAAGTGGTCGTGCATCAGCCGGTGCCAGAGGTCATGGGTCTGCTCGGCGTC
+GGTGAGGGCGGGGCGCTGTGGCGAGAAGGTGAAGCCGGGCAGGGAGGGGATGATGACGGT
+GAAGGCGTCGCGGGCGTCTCCTCCGTGGCGGGAGGGGGCGGCGAGTCGTTCGGCGAGCAT
+GGTGAGTTCCATGACGGTACTCGGCCAGCCGTGGGTGAGCACGATCGGCAGGGCGTCAGG
+GTGTTCGGCCTCGTAACGCAGGTAGTGCACTCGTGTGCCGGCGATGTCGGCAAAATGGGA
+GGGCAGTGCGTTGACGGCGGCTTCGTGGGTGCGCCACGTGTAGTCGGTGGCCCAGTACAT
+GACGAGGCGGCGGAGTTCGGCTGCGTCGGTACCCGCCTGCCAGCCGTCGACCGGCCAGGG
+CTCGGGCCAGCGAGTGGCGCGCAGCCGGGTGCGGAGGTCTTCCAGGTCGGCGTCGGCGAC
+CTGGATGACGGGTGTGCTGGTCGGCACGGTGTGCTCCTTCATGTGCGTGATGTGCAGGGG
+GACGGCGGCGGTGCGGTTCGTTCTCGTGCGTGA
+>orf00095 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTAGGTGCGCTCGGCCCAGCTCCGGGGCGGTTGGGCGAGGTCTGCGGGGAACAGGGC
+GAGGGCGGTGGGGACGTCGACCCGCCGCACGCGCCGGGTGAGCTGGTGCGCGTACTCGTA
+GTACGGGCGGAAGGACGTGGAGATCGTGCCGGTGAACCAGTAGAGCGATGCCTGGGTGAG
+GAGGAAGTCGTCGCCGAAGCGGGTGGACAGGTCGCCGCCGCAGTCGGTCCACGCGCGGTA
+CTTCTCGAGGATCCAGGAGAGCAGTCCGGCGGGCGAGTCGTTCAGTGCGGGCGCGAGGGT
+GAGGGGACGGGTGTTCTGCTGGTGCATGTAGGCGCCCTCCTCTGCCTGCCAGGCCGCGGC
+GGACAACAGGTGGGTCTTCTCCTCAGGGGTGAGCGAGGCCGGATCGTACTCTGCCGGGGC
+CGCGGCAGCGAGCAGATGAATGCCGACGACGGCCTCGGGGTGGGCCTCGGCGAGCCGTGA
+>orf00097 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCTTGTCTGCCTCGTGAGGAGTTTCAAATTTCTGTTTCTCGGGTTCCGTTGCGGAAA
+CATCAGGTGGAGCTTATGTCGGACCTCAGGAAATGGGTTCGGGTGGCTGCCCGGGAAAGC
+GCCCGTTCGGGGCGGGGGGCGCGGGCGACGGTGGTGTCCGCTACGGGTACGGGGAAGACG
+ATCAGCGCGGCTGTTGCGGCGTTGGAGTTGTTCCCTTCGGGGCGGGTTCTCGTGATGGTG
+CCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGCGGGCGGTGGGGCACACGGCG
+CCGATGGTCGGGGTGTGCTCGCTGCCCGGGGATCTGCTCCTGGAGGAGTTGCGGGTGCGG
+ACGACGACGCACCCGATCCGGCTCGCGCTGTGGGCCGGGCAGGGGCCTGTGGTCGTGCTG
+GCGACGTACTCCTCGCTCGTGGGCGGGGACGGGCAGGGCGGGCCCCTGGAGGCCGCCCTG
+GCGGGCTCGGGGTTGTACGGGCAGCGGATGGACGGCTTCGACCTCGCGGTCGTGGACGAG
+GCGCACCGTACGGCGGGCAGCGCGGCGAAGCCCTGGGCCGCGATCCACGACAACGCCCGT
+ATCCCGGCGGCGCACCGGCTCTACCTCACCGCCACCCCGCGCGTCCTCGCGCCCGCCCGC
+CCCGACAGGGACGAGGACCAGGAGGAGGGCGGCGGGGAGGCGCCGGCACTCGTGACGATG
+GCGAACGACCCGGAAGGCGAGTACGGGGCGTGGATTCACGAACTCGGGTTGTCCGAGGCG
+ATCGAGCGGAAAATTCTTGCGCCTTTCGAGATTGATGTTTTGGAGATTACCGATCCTGAG
+CCGGAATTGATGGAAGGAATGGACCGGGAGGCGCGGCGTGGGCGGCGGCTCGCCCTGCTC
+CAGACTGCGTTGCTGGAGCACGCGGCCGAGCACAATCTGCGCACCGTGATGACGTTCCAT
+CAGCGGGTGGAGGAGGCGGCGGCTTTCGCGGAGAAAATGCCGGAGACAGCGGCGGAGCTT
+TACCGGAATGAGGTGTCGGCGGAGGATCTTGCCCTAGCCGAGGAGCTCCCGGCCTCCGAG
+GTGGGCGGGGGCTTCTACGAGCTGGAGCCGGGGCGGCATGTGCGGCCGGAGCGGGTGTGG
+TCGCGGTGGCTGTACGGAGAGCACCCGGTGGCCGAACGCCGTGCGGTGCTGCGGGAGTTC
+GCGAACGGGATGGACTCGGCAGGGGTGCGGGTGCACCGCGCGTTCCTCGCCTCCGTCCGC
+GTGCTCGGCGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTCGCC
+GACGCGCGCGGGTCCCAGGTCGAGATCGTGCAGAACATCGGCAGGGCGCTGCGCCCGAAC
+CCGGACGGGCAGACGAAGACGGCGCGGATCATCGTGCCCGTCTTCTTGGAGGCCGACGAG
+GACGGGGAGGGGATGGTCGCGAGCGAGGCGTACCGGCCGCTCGTGGCCGTGCTCCAGGGG
+CTGCGCTCGCACTCCGAGCACCTGGTCGAGAAGCTGATGCTCCGGGCCCGGGTGCGGGCC
+GAGAGCGCGAGCGCGCGCAGCGCGGAGGAGGCCGGTGCGGGGCCCGCGCGGGTCCTGTCC
+GACTCCGGGACCTCTTCCCCCGCCTCCCAGGCCTCCGGGGACGTCGAAGGCGAGAACGAG
+GACGACGTCGAGGCGGGCGCGGACGGCGCTGAGGCGGGCGCGGACGGCGCTGAGGAGTCG
+GAGTCGGTGTTGTTGCGGTTCTCGACGCCGCGCTCGGCGTCGACCATCGCGGCCTTCCTG
+CGGACGCGGGTGTACCAGCCGGAGTCGACGGTGTGGCTGGAGGGCTACGAGGCGCTGCGC
+GCCTGGCGGGCCGAGCAAGGGGTGCGCGGCTTGTGCGCGGTCCCGTACGACGCCGAGGTC
+GCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGACCACCGCGCAACGCCGCGCC
+CGCCGCGAGGGCACCCTCAGCGCACACCGCATCGACCTGCTCGACGCGGAGGGCATGGTG
+TGGGAGCCGCGCGAAGAGGAGTGGGAGCGCACGCTCGCCGGGCTTCGCTCCTACCGGGCC
+GCGTACGGGCACCTCGCCCCCCGCCGGCGCGAAACCTGGGGCGAAGACGAGGGTGAGGAC
+GTCGTACGCGTCGGGGACCTGATGGCGAACCTCCGCCGCAAGGACGGACTCGGGCGGGAC
+GCGGAGCGGGCCGCCGCGCGCGCGGCCCAGCTGAGGGCCGTCGATGCGGACTGGGACTGC
+CCCTGGCCGCTGGACTGGCAGCGCTGCTGTCGGCAGCTCGCGCTCCTGGCCGCCGACGAA
+CCCGACGGACGCGCGCCCCGGATCGCGCGCGGGGTGCGCATCGACGGGGACGACCTCGGC
+GCGTGGGTCGCGCGGCAGCAGGAACCGCGGGTGTGGGCGAAGCTCAGCACCGAGCAGCGG
+GCGCGACTCGAAGCGCTCGGGCTCCGGCCTACCGAGACGGCCCCACGGCGGGGTGTGGAG
+GGCACGGGGGCGGCGGGGAGCGGGAAGCGGACGGCGGCGGCGCGAACGGCCTTCCAGCGC
+GGCCTCGCGGCGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGAGAAACCCGTACCCCGC
+AAACACACCGAGACCGTGAGCGTGGACGGTGAGGACGTCGACGTACGCCTCGGCGTGTGG
+GTCTCGAACGTGAAGAGCCGCTTCGACGGGATGGGCGAGGACGAGCGCGGCCAGCTCACC
+GCGCTCGGAGTGCCCTGGGCGGTGTAG
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/glimmer_w_icm_trans-table-11_genomic.out	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,61 @@
+>gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+orf00001      897     2918  +3     3.19
+orf00002      938      144  -3     2.86
+orf00003     7368     7237  -1     2.50
+orf00006    10347    11945  +3     2.93
+orf00007    12238    12110  -2     6.22
+orf00008    15088    13067  -2     2.95
+orf00009    15045    16529  +3     3.36
+orf00014    21385    20276  -2     2.90
+orf00016    23037    21382  -1     2.93
+orf00017    23031    24797  +3     2.92
+orf00020    27291    27115  -1     1.92
+orf00021    28556    28960  +2     2.51
+orf00022    29040    30026  +3     0.40
+orf00025    33151    32942  -2     1.06
+orf00028    38242    34754  -2     2.97
+orf00031    43300    43100  -2     6.70
+orf00032    43402    43497  +1     0.97
+orf00033    45157    44963  -2     1.68
+orf00034    47430    46852  -1     0.78
+orf00036    51314    48354  -3     2.96
+orf00037    55329    55069  -1     1.43
+orf00040    59457    56431  -1     2.96
+orf00041    59669    60169  +2     2.15
+orf00042    60516    60881  +3     0.34
+orf00043    62032    60959  -2     2.90
+orf00044    61997    62821  +2     3.73
+orf00046    66395    62922  -3     2.97
+orf00047    70996    71166  +1     0.90
+orf00049    81960    81835  -1     1.90
+orf00050    87355    89982  +1     2.96
+orf00051    90028    90390  +1     1.66
+orf00053    91917    92009  +3     0.65
+orf00054    93540    93307  -1     1.81
+orf00055    96379    94568  -2     2.94
+orf00056    96523    96383  -2     0.37
+orf00057    99628   100467  +1     3.23
+orf00058    99645    98455  -1     2.91
+orf00062   100811   102931  +2     2.95
+orf00065   103074   105521  +3     2.96
+orf00066   106200   105847  -1     0.32
+orf00067   108365   108069  -3     4.89
+orf00068   110498   109947  -3     0.90
+orf00069   110907   110791  -1     2.13
+orf00074   117071   116538  -3     0.81
+orf00075   117733   117443  -2     0.01
+orf00076   118776   118399  -1     3.59
+orf00077   119740   119582  -2     0.41
+orf00078   123152   123484  +2     2.86
+orf00079   123767   123925  +2     0.89
+orf00080   126459   124906  -1     2.93
+orf00084   128992   126704  -2     2.95
+orf00085   129178   129011  -2     1.85
+orf00086   132172   130337  -2     2.94
+orf00088   134993   136987  +2     2.94
+orf00089   137523   137245  -1     1.14
+orf00092   140512   137825  -2     2.96
+orf00093   142487   140766  -3     2.94
+orf00094   143056   142484  -2     0.89
+orf00095   143578   143099  -2     0.42
+orf00097   147016   144230  -2     2.96
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/glimmer_wo_icm_trans-table-11_plasmid_genomic.fasta	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,2213 @@
+>orf00001 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCTCGTCTGCCTCGTGAGGAGATTCAAATGTCTGTTTCCCGGGTTCCGCTGCGGAAA
+CATCAGGTAGAGCTTATGTCGGACCTCAGGAAATGGGTCCGGGTAGCCGCCCGGGAAAGC
+GCCCGCACGGAGCGTGGGGCGCGGGCCACGGTGGTGTCCGCTACGGGTACGGGAAAGACG
+ATCAGCGCGGCTGCTGCGGCGTTGGAGTTGTTCCCTTCGGGGCGGGTTCTCGTGATGGTG
+CCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGCGGGCGGTGGGGCACACGGCG
+CCGATGGTCGGGGTGTGCTCGCTGCCCAGGGATCTGCTCCTGGAGGAGCTGCGGGTGCGG
+ACGACGACCCACCCGATCCGGCTCGCGCTTTGGGCCGGATCGGGGCCGGTGGTCGTGCTG
+GCGACGTACTCCTCGCTCGTGGGCGAGGACGGGCAGGGCGGACCCTTGGAGGCCGCTCTC
+GCCGGGGCTGGCTTGTACGGGCAGCGGATGGATGGCTTCGACCTTGCGGTCGTGGACGAG
+GCGCACCGCACGGCGGGCAGCGCGGAGAAGGCGTGGGCGGCGATCCACGACAACGCCCGT
+TTTCCGGCGGCGCACCGGCTGTACCTCACCGCGACCCCGCGCGTCCTGGCCCCGGCCCGT
+CCCGCCAGGCACGAGGGCGAGGAGGGACGCGGGGAGGCGCCGGCACTCGTGACGATGGCG
+AATGATCCGGCGGGCGAGTACGGGGCGTGGATTCACGAACTCGGTTTGTCCGAGGCAATC
+GCGCGAAAAATCGTCGCGCCTTTTGAGATTGACGTTTTGGAGATTACTGATCCTGAGCCG
+GAATTGATGGAGGGATTGGATCGGGAGGCGCGGCGTGGGCGGCGGCTTGCGTTGCTTCAG
+ACCGGGCTTTTGGAGCACGCGGCCGAGCATAATATTTGCACCATGATGACGCTTCATCAG
+CAGGTTGAGGAGGCGGCGGCTTTCGCGGAGAAAATGCCGGAGACGGCGGCGGAGCTTTAC
+CGGAATGAGGTGTCGGCGGAGGATTTTGCCCTGGCCGAGGAGCTCCCGGCCTCCGAGGTG
+GGTGGGGGGTTCTACGAGCTGGAGCCGGGGCGTCATGTGCCGCCGTCGCGGGTGTGGTCG
+CGGTGGCTGTATGGGGAGCATCCTGTGGCCGAACGGCGTTCTGTGCTGCGGGAGTTCGCG
+AACGGGATGGACGCGGAGGGGCGGCGGGTGCACCGGGCGTTCCTCGCTTCCGTACGGGTC
+CTGGGTGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTTGCCGAC
+GCACGCGGGTCTCAGGTGGAGATCGTGCAGAACATCGGGCGCGCGTTGCGCCAGAACCCG
+GATGGGCGGGCGAAGACGGCGCGGATCATCGTGCCGGTCTTCCTGCGGCCGGACGAGGAC
+GGGGAGGGCATGGTGGCGTCGGAGGCGTACCGGCCGCTCGTCGCCGTACTCCAGGGCCTG
+CGCTCGCACGACGAGCACCTGGTCGAGAAACTCATGCTGCGGGCGCGCGTACGGGCCGAG
+AGCGCGAGCGCGCGCAGCGCGGAGGAGGGCGGTGCGGGGCCCTCGCGGCTCCTGTCGGAC
+TCCGGGACGGCGGCTGCGGCCTCCGAGGGCGTCGAGGGCCAGGAGCAGGGCGAGGACGGC
+GCCGAGGCGGAGTCGGTGCTGCTGCGGTTCTCCTCGCCGCGCGCGGCGTCGACGGTCGCG
+GCGTTCCTGCGGACGCGGGTGTACCAGCCCGAGTCGCTGGTGTGGCTGGAGGGGTACGAG
+GCCCTGCGCGCCTGGCGGGCCGAGCAAGGGGTGAGCGGGGTGTGCGCGGTCCCGTACGAC
+GCCGAGGTCGCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGACCGCCGCGCAA
+CGCCGCGCCCGCCGCGAGGGCACCCTCAGCGCACACCGCGTCGAGCTCCTCGACGCGGAG
+GGCATGGTGTGGGAGCCGCGCGAGGAGGAATGGGAGCGCACGCTCGCGGGGCTTCGCTCC
+TACCGGACGGCGTACGGGCACCTCGCCCCCCACAGGCGCGAAACCTGGGGCGAAGACGAG
+GGTGAGGACGTCGTACGCGTCGGGGACCTGATGGCGAACCTCCGCCGCAAGGACGGACTC
+GGGAAGGACGCGAAGCGGGCCGCCGCGCGCGCCGCGCAGCTGAGGGCCGTCGATGCGGAC
+TGGGACTGCCCGTGGCCGCTGGACTGGCAGCGCTGCTGCCGGAAACTCGTGCTCCTGGCC
+GCGGACGAGCCCGGCGGGCGCCTGCCGGAGATCGCGCCCGGGGTCTGCCTGGACGGGGAT
+GACCTCGGGGTGTGGGTCGCGCGGCAGCAGGAGCCGCGGGTGTGGGCGCGGCTCAGCACC
+GAGCAGCGGGCGCGGCTCGAAGCGCTCGGGCTGCGGCCCACCGAAGCGGCCCCGGGGCGG
+GGTGTGGAGGGCACGGGGGCGGCGGGGAGCATGAAGCGGACGGCGACGGCGCGAACGGCT
+TTTCAGCGGGGTGTGGCGGCGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGGGAAACCC
+GTACCCCGCAAACACGTCGAGACCGTCAGCGTCGACGGCGAGGACGTCGACGTACGCCTC
+GGCGTATGGATCTCGAACACCAAGAGCCGGTACGACGGGCTGAGCGAGGACGAACGCGCG
+CAGCTCACCGCACTCGGAATGCCCTGGGCAGGATGA
+>orf00005 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTCGCCGCCGTACGGGACACGATCGCCGAGACCGGCCAGGGACCGTCCGTACGGCAG
+ATCCAGCGCGTCACCGGGCTCGCGCTCGGCACCATCGCCCACCACCTGAAGGCGCTGGAG
+GAGAGCGGCCCCCTCGTCCGTACGGGCCTGCACTGGCGCACCTGCCGCCTGGGCTGA
+>orf00006 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGATGAACTGCTCCGCCTCGCCCAGGAGAGGCGTGCGACCTACCGCGACCTCACC
+CTCGGCGGCCCCGCCCGCCCCCCGACACCTCTGCGCCGGGCACTGATCCGGCAGTCCGCC
+CGCCTGCTCGACGGCCCGCCCACCACGGCCCGCCGGGCTCTGCTGTGCCGCCCGCCCACG
+CCCGCGTCCCCGCCCTCGCGGGGGACCAGGTGA
+>orf00007 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGATTTCCCCGACGATCTCCTCGCGGCTCAGCGCGACCTCACCGCCGTACGCGCC
+ACCCTTTCCGCCCGCCTCGCGGCGCTGCCGCCCTCGGCCGAGCCGATGCCCGCGTGGGAG
+CGGCCCGACGGCTACTGGGCGGGCGCCCGTACGCACCCGGCCTCCCCGGGGTGGAGCGAG
+GAGGAGCGCGAGGAGGTCGCCGCGCTCCGCGAGCGGGAGCGGGATCTGGCCGGGGTGATC
+GTGACGCACGAGCTGTGGGCGAGCGTGCCGGCCGGGGAGCGGATGCGGGCCCGCGACGCA
+CTCAAGCACGCCCACGAGGCCCCGGCCGCAGCCGGGGCGGCGGGGGCGCGGGGCTGA
+>orf00010 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCACAAGCCAATCACAGGACATCCGGCACTCCCACGGCCGAGCCCGTTGGAACAGCA
+GAGGAGATCGTCATGGCAAGTAGCAACCGCGCCGTCACCTTCCAGAACCCGAAGGAGATG
+CGCGTCGAGTCTCTGGATTTCCCGAAGCTTCAGATGCCGAACGGGAAGAAAGCCCCGCAC
+GGCGTCATCCTCAGGATCGTCGCCACCAACATCTGCGGGAGCGATCTGCACATCTACCGT
+GGGTCCTTCCCGGTGCCCCAGGGTATGGTGATGGGCCACGAAATGACCGGGGAGGTCATC
+GAGGTCGGCCCCGACGTCGAGTTCCTCAGCGAGGGCGACCTCGTCTCCGTCCCCTTCAAC
+GTCGCCTGCGGCCGATGCCGCAACTGCCGGGCCCGCCGGACCGACGTCTGCGAGACCACG
+AACCCTGAGGTGTCCTGCGGAGCGTACGGCTTCAACCTGGGCGACTGGACCGGTGGACAG
+GCCGAGTACTTGTTCGTCCCTTATGCCGACTTCCAGCTCCTGCGCTTCCCGGACAGGGAC
+CAGGCCATGGCGAAGATCCGTGACCTGGCGCTGCTCTCGGACATCCTGCCCACCGCGTTC
+CACGGCCTCATGGAGGCCGGCGCCAAACCGGGCTCCACCGTGTACATCGCCGGCGCCGGC
+CCGGTCGGCCGCTGCGGCGCAGCAGCGGCGCGGCTCCTCGGGGCGTCCTGCATCATCGTC
+GGCGACTACCACAAGGACCGCCTGGAGCTGATGAAGAAGAACGGCTGCGAGACGATCGAC
+CTGAGCCAGGACGCAGCGCTCACCGACCAGATCGAGGCCATCCTGGGCGAACCCATGGTC
+GACTGCGCAGTCGACTACGTCGGCACCGAGGCACACGGCATCGGCCGCGAGGCAGAGGAC
+ATGGACCCGGCCCACGCCCTCAACCAGGTGCTCGACGCCACCCGCGCGGGCGGAGCCACC
+GGAGTCATCGGCGTCTACGGTCCCGACCCGCTCGCGAAGTCGAAGGCCGAGCAGCAGGGA
+ACGTACCCGATCGACTTCGGCAAGGCCTGGATCAAGTCGCCGCGGCTCGCCGCCGGGCAG
+GCACCGATCATGCACTACAACCGTGAGCTGATGATGGCGATTCTGTGGGACCGCATGCCC
+TACTTGAGCGCGATGCTCAACACGAAGGTGATCAGCCTCGACGACGCCCCTGACGCCTAC
+GCGACCTTCGACACCGGCGTGTCCGAGAAGTTCATCATCGATCCCCACGGCCTCATTGCC
+GCCTGA
+>orf00011 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCAACGACTTGCACGGCAGGAAGATCGCAATCCTGGCCACGGACGGCGTTGAGCGC
+GTCGAGCTCGAAGAACCTCTCGGCGCACTGCTGGGTGCTGGAGCGCAGGCTGAACTCCTG
+TCCCTCCACACCGGCGAAATCAACGCGCGCCAGATGGACATCGAGCCGGCCGGAACCTTC
+ACCGTGGACAAGAAGGTCGCCGACGCCCGGATGGGTGACTACGACGCGCTCCTGCTGCCC
+GGCGGCACCATGAACCCCGACCAGCTGCGCGCCGACCCCGACGCCGTCGCCTTCGTGAGG
+GGGTTCGTGGAGACAGGGAAGCCCGTTGCCACCATCTGCCACGGACCCTGGACCCTGGCC
+GAGGCTGACGTGCTGCACGGTCGCCGCCTCACCTCTTGGCCCAGCATTCGGACTGACCTG
+CGCAACGCCGGCGCCGAGGTCGTCGACGAGGAGGTCGTAATTGACCGCCAGCTGATCTCC
+AGCCGCGGCCCGCAGGACCTCTCTGCCTTCTGCAAGGCGATCGTCGAACGCTTCGCCAAC
+GCACCGCAACCCACCTGA
+>orf00012 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCTTGCGGAGGTGGGGCAGCAGGAGAAGATCTCTTCGTGCGGTACTCCGTCCCCCGG
+GGACGCGCCCGCACGACTGCGGGGACCGGCCCGGCCAACGTCAAGGCGTACAACCGGCAG
+CTGTGGGCCCTGATCGCGCAGGGTAAAGCCAAGCTGGCCTGGATCGTTTTCCAGGAGCTG
+TCGCTGGACCGAGCACCGAGCCTCCCAGCACCTTCGGCCACCGAGAGGGCAGTCGGGCCA
+AGGTCCTCCTCCCTCATCGACGGCAGCTGA
+>orf00013 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACAACGCAGGTCAGCAAAGCGGTTCTGGTGCGCCTCGAAGCGCTGCCCGGCAGGGAA
+GACGACGTCCGCGACTTCTTGAACCAGGCGCTGTCGGTCGTCATGGGGGAGCCCAAGACC
+GTCAGGTGGATCGGAATCCAGTTCGGACCATCGTCGTTCGGGATCTTCGATGCCTTTCCC
+GACGATGAGGGACGTCAGACGCATCTGTCGGGTGCGGTCGCCAAAGCGCTCGGCGAGAAG
+ACGGGTGAGCTCTTCGAGGAGCCCACAATCGAGCAACTCGATGTCGTCGTGGAGAAGCAG
+CCCGCGTAG
+>orf00016 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGGAATCTCCACGGCGTCCAGGTCACCAACAGGGGCTGGATGAGCATCTTCGTCAGC
+AGTATCTCCTACACCGCGACAGTCAAAGCGTCAAGCGGTAGGGGTGATCGGCGAGCAGTG
+GCAGATGGGTCGGCGCATCGGGCGTAG
+>orf00017 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCGGCAGACACCATCGTACTGTTCCGGCAAAAAGCGCTCATTCTCCACAACGCCCGG
+GATATCGCCGAGATCGTCCGCCAGCTGCTGGGGGAGCCCTGGCCGGTCGAGCCGGAGAAC
+CTGTCGAGCCGGAGGACCTATCGAGCATCTCGCCCTATCTGA
+>orf00018 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGACTTGGTGGTCCAAAGCCTTGGCCACCGTTACATCCAGGAGGAAGTTATGGCGGAT
+CCGCGGGCGGTCAGCCTTCCTTGTGGGGTTGCGGTCACGGCGCTCGGTCAAGGTACCTGG
+GGGATGGGGGAGAATCCCGGGCGCCGCGCGGCCGAGGTGTCGGCCTTGCGTGCCGGGCTG
+GACCTGGGGATGACTCTTGTCGACACCGCCGAGATGTACGGGGACGGCGCGGCGGAGGAG
+GTGGTCGCCGAGGCGGTGGCCGGACGGCGGGACGAGGTCTTCTTGGTCAGCAAGGTGCTT
+CCCTCCCATGCGGACGCCCGCGGAGTGGCCGAGGCCTGCCGGGGGAGCCTGCGCCGTCTG
+CGCACGGACCGGATCGATCTGTATCTGCTGCACTGGCGTGGAGCCGTGCAGCTGGAGGAG
+ACGGTTGAGGCGTTCGAGGCCTTGGTGCGGGAGGGTGCCATCCGCTCCTGGGGTGTGAGC
+AACCTGGACGTGGATGATCTCGCGGACCTGCCGCCTGGAGCCGGGCCGCAGACCGATCAG
+GTGCTGTACAACCTCAGCCGTCGAGGGCCTGAGTACGGTCTGCTGCCCAGGTGTCGTGAA
+CTATCGATCCCCGTGATGGCGTACTCGCCGGTCGAGCAGGGCCGACTGCTCCGCCACACG
+GCGCTGCGGGACGTGGCAGCCGCCCACGGTGCGACGCCCGCGCAGATCGCCCTGGCCTGG
+GTCCTGCGGCACGAGGACGTCATTGCCATCCCGAAGGCGTCCTCCCGCGCGCACGTCGAG
+GAGAACAGAACAGCTCTGGAGGTGGACCTGACCGCCGAGGACCTCGCGATGCTGGACCGG
+GCGTTCCCGCCCCCGAAGAGCAAACGCCCGCTGGAGATGCTGTGA
+>orf00019 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGTGGTGCTCGTGGACGGGCAGGAGGTCGGGGGCGGCTCCCCGCGCGGCGCCAGCTG
+GCGGACGGGTGGCGGTACCACGTCGCGCTCCCGCTCTACCGCACCGTGGGCGGGGAGGGC
+CTGGAGGTCGAGGCGGCGCAGTACGAGGTGTGGGTACGCGCGCCCGAGCACGTACGGCCC
+GTCGAGGATGTCGACTACACGGGCATGCCGACCACGGCGCTCCCGGCGCCCTCGCTCGTG
+GACGTGGCGCTCGGCCCGCGCAGGCCCGCCGGGTGGGTGCTCGCGAAGAGCGGCGGCGGG
+CGCCGTGGGCCCTCCCGTGCGGTGCTGCACACCGTCGACTGCGCCGAGGCGCCGCCCGGC
+CTCCCGGTCCTGCGGGTGGAACAGGCGCTCAACGCCGCCGAGCACCCCGCCACCCGGGCC
+TGCGCCCTGTGCGGCGCCGCCGCCGAACTCGACCCGCTCCTCCGGGGCTTCGACCCTCAC
+GACGAGGACACGGGCGCTTCTCCCTGA
+>orf00022 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCACCGGCCGACGTCTGCCTGGAGGCGGTCTGTGAGGAGCCGCGCGAGCGGGTCGAC
+GGCGTGCTCTACGCCTGCCCCGCCCACGGGGCCGAGGCGGCCTCGCGGATCACCGAGGCG
+GGATGGACCGCGCTGGTCAAAGTGATGGGGCCCGCGAGCCGGGCCAGGTGCGAGGTCTTC
+GACGGCGCCACCCGCGAGGCACGTCACCTCCTGGGCGCGTAG
+>orf00023 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCTCGGGGGCCACGTTGGTCACACATCCTGCCGCACTTGCCCCACGCTCTCGTGGAGC
+CAGCCCATACAGCCACGGCACCCTCAACCCCGACACGATCACCCTCGTACGTTTCACACT
+TCCCCCATTAGCTCGGCAGTCGAGTACCGCATCCTGAACGTCCGCACGTGGGAGGCCGGG
+GACGACGCGGGCCTGGATGCCGCGTGGGTCGATGAGGTCGTGGTGGACCTCGGTTCGCAG
+TGGGGCCAGTACGAGTACGTCACCAACATCGGCTTCGCCGCCTGA
+>orf00024 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAACAAGGGCTTCAAGAAAAAGCGGGTAGTCGCTATAGCGGCCGCGTCCGTCATGATG
+CCGCTCGTGGCCGCCGTTCCGGCGAGTGCCACCACCGGCGCGGAGGTCCGGGACGGTGCA
+CGGTCCTTCACCGTCCGCCTCGACATCGGGAAGGGCACCCGGGGCTGTTCCGGGGTTCTG
+GTCGACGCCCAATGGGTCCTTACCGCGCGAAGCTGCTTCGCCGACAACCCGGCCACGAGC
+ATCGACATCCCCGCAGGAGCGCCCGCGCTCCGCACGACCGCCACTGTCGGCCGTACCGAC
+CTCACCACAGGGACCGGCGAGGTCCGCGAGGTCGTCCAGCTCGTTCCGCGCACCGACCGC
+GACGTGACGCTCGCCCGGCTCGACAAGCCCGTCGCCGGGGTGGCTCCCGTCACCGTCGGT
+ACTCAGCAGCCGAGCGCCGGCGAGGCCCTGACCGCCGCCGGATTCGGCCGTACGAAGACC
+GAGTGGGCCCCGCTGCGCCTGCACACCGCCACCCTCGGCATCGACGCCGTCCAGAGCCAG
+GACATCAGCTTCCACGGGCAGGACGGACAGGCCCTGTGTGCGGGGGACACCGGCGGCCCG
+CTGCTGCGCGAGAGTGGCGGCAACGCCGAACTCGTCGGCATCAACTCCCGTTCCTACCAG
+GGAGGGTGCTTCGGTATCGAGGCGACGGAGACCCGCTCCGACGGAATCTCCTCGCGCGTC
+GACGATCTCGGCGACTGGATCGCGAAGAACAGGCTCGCCGCTCGCGCCCCGGAGCAGATC
+AAGCACCTCACCACCGGCGACTTCAACCGCGACGGGCACCCCGACATCGCGGCGATCCTC
+GACGACAACAACTTGTACGCCTTCTACGGCACGAGTGACGGCAAGCTCACCTATGGCCGC
+GAGCTGTGGGCGCACGACGGCACCTGGGGTTCCAAGGCCCGCATCCTGGGCGGCGACTTC
+AACGGCGACGGCAACGCCGACATCGCGGCTCTCAAGGACGACGGCGCCTTCCACAACTAC
+GCCGGAACCAGCGGCGACCTGCTCAGCCCGGCGGCAAGCATGTGGAAGGACAAGACCTTC
+GCGAGCTACCTGCCGACGACGTACCGTGCCAAGGGCTGGACGCGCGACGGCCTCGTTGCC
+ATCGCGCCCACCGGCCGCCTCTACGCGTACGCGACCGGGGCCAACGGCATCCTCACCGAC
+AGTCGCACCGAGGTGTGGCACGACGCCACCTGGGACAAGAAGTTCCTCACCAGCGCCGAC
+TTCAACGGGGACGGCCTCAACGACATCGCCGCGATCTCCCAGAAGGGCGAACTGGCCCTC
+TACCCGGGGAAGACGGACGGTACATTCGCCAACGCCAAACTGATGTGGGACGACGCGAGC
+TGGGGCGGCTTCCACGCCCTGCTGAGCGGCGATTTCAACGGTGACGGCAACGCCGACATC
+GTTGTTCTCAACAGCGTCGACCACCTCTACCTCTACCCCGGAGACGGTAAGGGCGGGCTC
+GGCACCCGCCGCAGCATGTGGCCCGCCATAGGCTGA
+>orf00027 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCCGTGACGACTACGGATGCACAGATGACACTGAATTCGCGCTCACGCGCCCTTCTC
+GCGGTCGCCGCCGCGACGCTCTCGCTGGCCGGCGTCTCCACACTGGCCTCCGCCGACGGG
+AAGGACTCCCCGTCCGTCCAAGCGGCAGCGGCGGAGCAGCCCGGGTACGCGGTCGAGACC
+TTCGACTATCCCGGCGCCGACCGCATCGCCGCCGAGCAGGGCATCACGCTGCGCCGGGGT
+GACGGCCACATCGTCCTCGCGGAGTGCGACGACTCCAGCCCCATGATCAAGGTGTGGACC
+CGTAAGAGCGCGGCCGGGAGGTTCTGCTTCCGCAGCACCGCCTCCACCGGGTCCCTCACC
+CTGGAGGTCCCCGACGTCTACGCCATCGAGACCGTCCAGCGGGCCGTGCACGCGGAGTTG
+GAGGCCGAGGGCAAGTCAGTGGAAGTGGACGTGAAGAAGGACGAGTTCAAGGGAGTGGGC
+GAGGGAGTCGGCGACGCCCCCACGGTTCTCCTCGAACTCCGCGTCACCGGCTGA
+>orf00031 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGTGTCGCCGTGCTGCTCGCCCTGACGGCCGGGATGCTCGGTCCGGCGCCGGCCTCC
+GCGCTCGACCCCGACCCGGACGAGGACGACTACACGCCGGTCGCGTACCTGCCGGCGACC
+GACCGGGGAAAGGTGCTCACGGCGTGGGAGGAGGGCGGGCCGGGCGTCAAGGCAGCCGCC
+GAGGCAGCCCTGCTCGGCTCGGACGCCGACGTACGGAAGTTCCTGGACGGGGAGGAGGCG
+CTCGCGCGGACGGCGGACGACCGCGTCGCCACGGTCCAGATCCTCTCGCTCGGCGGGCGC
+GCCGTCCGCGAGGCGGCCGAGGAGGCCCTCGCGGGCCCCGAGGAAGGCCTCGCCGACTTC
+CTGAAGGACGGCTGGAAGGAGCCTCTGGAACAGGACCAGCGCGTCCAGGTCACCCAGATC
+ATCTCCTCCGCGGCCGGACCGCAGGTGGCGGCCGACGGGCGCAAAGCGCTCAACGGGGGT
+ATGGAGGAGGTACGGAAGTTCCTCTCCGAGGGGCAGTACACCGCCGCTGACAACGATGCC
+AGGGTGCAGGTCGTCCAGATCATGAGCACCGGCGGGCAGGCCACCAAGGAGGCCGCCCGC
+GTCGCGCTCAACGGCGACATCAACGACATCCGCGAGTTCCTGGAGGTCGGGCAGCACACT
+GCCCGTGCCCGCGACCAGGAGCAGGCCACGGTGGCCGATCTCGCCACGCAGGCCACCGAG
+GCCGGGCGGCAGGCGCGGGTGGAGACCGACCGCGCCAAGGAAGCGTCGGATCGCGCGATC
+AAGGCGACGAAGCTCGCCAAGGAGGCGGCGCAGAAGGCGGCCAAGGAGACCGAGGCCGCG
+AAGGACGACGCCGTCAGGGCGTCGAACGCGGCAGGTCGTGCCGCCGACGCCGCGCGCGGT
+GCCGCACGGGCCGCGCAGGTGGCCATCGACGCCGCCAGCGCCGCCAACCGGGCCGCCCGC
+GTCGCGGCCAACGCCGCCGCCCAGGCAGCCTCCGCGGCAGCCGCCGCGGCCAACGCCGCC
+GCTCGGGCCCGGAACGCCGCCGCGGCAGCGGCCACCGACGCGGGGAAGGCGTCCGCCGCC
+CGCTCCGCGGCCGAGGACGCCCTGGACGCCGCCAAGGGCGCGAAGAAGGCCGCCCAGGCC
+GCCGACTTCGCCGCCACCGCCGTCGTCGAGGCGGCCGGCGCCGCCCAGGCAGCCGCCAGT
+GCCGGGCAGAACGCCGACGCCGCGGCGTCGGCCGCGTCCGAGGCGAGCGGCCAGGCCGGC
+GTCTCCGACGCGCAGGCCGCACGGGCCAGGGCCGCCGCCGCCGAGGCGCACCGGCACGCC
+GCCGAGGCGACGGCCGCCGCCAACCGGGCCGACTCGCTCGCGGCGAAGTCGGCCAAGGCG
+GCGCGTGAGGCGAGGGACGCCGCCAACGCCTCTGCCGAGCACGCCGAGAAGGCGGCTGCC
+GCCGCCAAGGAGGCCGCGGAGCACGCGGGCGAGGCAGCCACCGCCGCGGCCGAGTCCACC
+AAGCACGCCGCTGCCGCGAAGACCGCCGCGGACGCGGCGAGCGCCGCGGTCCAGCAGGCC
+AAGGACACGTTCACGCTCGCCCGCGAGGTCGAGGCCGAGGAGCTGGCCTCCCGCACGGCC
+GGAGCCGTCGAGCAAGCGCGTTCGCTGCGGGACCAGGACGACGAGCGCATCGCCGAGGGC
+AAGAAGCAGGCCGACGCCGCCGCCGCGCTCGACTCCGAGGCAACGGAGCTGGCCGAGGAG
+ATCTCCGCGTCCGGCGAGAACACCGACGCCCTCGCGCCCAAGGCACGCAAGGTCGCGCTC
+AACACCGTCAAGACACGAGGCCCGTGGAGCGTCAGCGCCGCCGAGGTCGCCCTCGCGGGC
+TCCGCCGACGACGTCGTGCGGTACGTGGCCGAGGGCCGCGAGGAGGCCGCCGCTCTCGAT
+CGGCGCGCGCGTGCCGAGACGCTCGCCACCGACTCGACGTCGGCGGACGTGCGGACAGCC
+GCCGCCGCTGTCGTGGAGGAAGGCGACGCCCCGATCCAGGAGTTCCTGAGGACGGGACAG
+TTCCAGGCGGTCTCCAATGACCTCCGCGTGCGCATCACCCAGTTGATGAACGGTGCGGGC
+CCCGGCGTCAAGGAGGCGGGCCAGGCCGCGCTCAACGACGGTTCCCCCGCGAAACTGCGG
+GACTTCGTCGACAGCGGCTACTACGTGCAGCGGGCCAACGACGAACGCGTCCAGGCGACG
+CAGCTCGTCGGTTCCGGGACACCGGAGGAGAAGGCCGCCGCGCGCATCGCCCTGGAGGGA
+CCGCCGCAGGTCCTGCACGCCTTCACCGAGACCGGCCGTTTCAAGGCCAAGCGGCAGGAC
+CTGCTCACCGCGACCCACACGGCGCGAGTCCAGGGCCTGATAGCCAGCGCCGCCAAGGTG
+GCGGCCGTCGCCCAGCAGAACGCGGCGCTCGCCGGTGAGACGGCGGCGAAGGCGCGCAAG
+GCCGCCGCCGAGGCGAAGAAGTACGCGGACCAGGCGAAGGCGTCGGCCGAGCAGGCCGCG
+TCCTACAGCAAGGACGCCGACGCCTCCGCCGACGCGGCGCAGAAGTCGGCCGACCAGGCG
+GCGAAGTCGGCGAAGACGGCCCGCGCCGCCGAGGCCGACGCCCACGCCGCCGCCCGGGAC
+GCGGACCACTCCGTCGCCCGCGCCGAGGCGTCCGCCGCCTCCGCGCACGGCTCCGCCAAC
+TCCGCCTGGGCCGCCGCCGGTGCGGCACGCGCCTCCGCCGAGGCGGCGGGCAAGGACGCC
+GACGCCGCGGCCGAGGCGATGACCGAGGCGCTGAACGTCGCCGCCGAGAAGCAGTGGGCG
+GAAATCCGCAAGGCGCTGGAGGACGAGCAGGACCGGGCCGACCAGGCGTCCCTCCAGGAG
+CTGGAGGAGTACTTCGCCGACCTGGCCAAGCAGCAGGAGAGCGGCGACACCGACTGGTGG
+GACCTCGCCACCCTGGGGCACACGGTCCTGGACACGGCCGGGCTGGTGCCCGGTTTCGGG
+GAGATCGCCGACGGTATCAACTGCGGCTGGTACGGAGCCGAGGGCGACAGCCTGAACGCG
+GGCCTCTCCTGCGCGGCGATGATCCCCTTCGTCGGCTGGGGCGCGACCGGCGGGAAGTGG
+GGCAAGCGCGGTGTTGACGCGATCGAGGCGTTCAACAAGGCCATGCGTGCGGAGGGGAAG
+GTCCCGCACATATGGTCGGCCAATCCTCGCAAGGGCCGCAACAACGTTCAGAACGCCTAC
+AGCCACTGGAAAGACCACGGCGCCCAGTTCCCCGAGCTGAACAACGCGCTGGACTACGTC
+AAGAAAGCGCGGCAGTACGGGGACATGGCACTGGCGCAAAAGCCGGTGAAGGGCTATCGC
+GTCTTCTCGCAGAACGGCGGTGCGGTGGCGATCTTCGACGAGAGCAACGGCGCTTGGGCC
+GCCTTCACGAAGGACGGGATCCCGCAGACCATGTACAAGCCCGAGCCACGCAGCCAGAGC
+AATCCCAACGGGTACGCGACCACCATCGAGGACTGGCTCGCCGAGCCCGGCCGCGGCACA
+GAGATACGCTGA
+>orf00033 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCTGAAGAGGAAGAGTGGACGAAGGTCCCGGTCGAAGAGGTCTGCCGGGTGTGCGGC
+CTCTATGCCGAGGGGGCCCTGTGGGACGAGTACGGGGCGCCGCAGTACCTCACCTGCCCT
+TGCTGCGGTGTGGAGTCCGGGCTCGGTGACGCGTCCTACGAAATGGTCACGTGGAACCGG
+GCGCGATGGCTTGAGTCCGGCGCGGAATGGCAAGAGCCCGAGTTCCGTCCCACGAACTGG
+AGCCTGGAAGAGCAACTGGCCTGTATTCCCGCCAAGTGGCGCTGA
+>orf00036 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGAGCCGTGCGCAGGCTGGTCGACGAGGCCACCGGCGAAGTCGTGCCCTATGCCCCG
+TACGCCTTCTCCGGCGGCGGACACGTCCAGGTCGACAAGGCGCGCGTCGCGGCCATCACC
+GAGAGCCGCACGTTCACGCCGAGCCAGAAGTACTTGATCCTGTGGTGGATCGGCACGTCA
+CCGCCCGGCATGGAACCGCTGCGCCTCACCGGCGCGGACATCGCGAAACGGGTCGGCATG
+ACCCCCGACGCGGTCGGCAAGATCAACCGGGCCCTGCGCCGGCGGCGCATCCTGATCGAA
+CGCGGCCGGGTGGGCAGCTACCGCTTCTACCGGATCAGCCCCTACATCGCTTTCCACGGC
+AGCGGAGTCGAGCAGCGCGAAGCGATCACGCTGTGCAACCCGCCCGACATCCCAGGCTTC
+GACAAGGACGCCCGCACGGCAGCGCAGGAGGCGCAGTGA
+>orf00038 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTGACGCGCTCGGCAGGCCTGACGGCCAACCAGCGCCTCGTCCTCATGCTCTACGCG
+ACGCACAAAACCGACCGCTCCGGCGCCGTCCCGGTGACCGCCGCCGAGCTTGCCGCGCAC
+CTCGGGCTCGCGCCCACCGTGTTCTCCCGCACCCGTCGCCAGCTCGTCGCGGGTGGATGG
+CTGGAGGAATCGGAACGGTTCGGTCACATCCGCTTCTACCGCCTCGCCCCGAAGAGCACC
+GGAGAGCAGGTCGTGGTCCCCCTGCGCCGGACCGGCACCCGCTGA
+>orf00039 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCATGTGGGACGCCTGAGGGACGGGCTCATCAACATGGACGCACCCCACCCCTTCAAC
+GCGGGGCCGGACGGGTCCCGGACGCCGGTCGAGGAATGCAAGAGCGTCAGAAGCCCACGA
+GGACCTCATGCCCGATTCCGGGAAGCCACCCCCCCCTCCCTCATGTACTCCACGTGCATT
+TACCCGGTTCCTGGGAACTGGCAGGCAGATCCTGGGAACTGGCAGGCAGATCCCAGGATC
+GTGGTGTCCGACAACGTTTCAGCAGGTCGGAGGGGATTTCCTGGCGCCGCCCTCTAA
+>orf00041 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAAGCCGATGTTGGTGACGTACTCGTACTGGCCCCACTGCGAACCCAGGTCGACCACG
+ACCTCGTCGACCCACCCGGCACCGGCGCAGGTTGAGGGTGCGGTCCGAAATCGTGAGCCC
+GGCCTCCCGGGCGGCGGCGAGCTGGCGGGGGCTGCCGGTGAGGGGGCGCAGAGGGGCCGT
+GAGGTGACGGCGGGTGGTGACCGGGGAGGCGACGAAGCCCGCGAGGCTGTCGAGGCCGCG
+GGGCGCGACGACGCTCTCGTGCACGGCGAGGCCCGCGCGCCACCGGAATATGCGCACGCC
+TGA
+>orf00043 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCACGTGTCCACGTTTTCCGGAGGACTCATGAAGATCGGCATTGTCGGCGCGGGACAC
+ATCGGCGGGAACCTCACCCGCCGTCTGACGGCGCTCGGGCATGACGTGAGCGTGGCCAAT
+TCGCGTGGCCCACAGACGCTGTCCGAGCTCGCCGAGGAGACCGGGGCCACCGCGGTTCCC
+GTCGCCGAGGCGGGGCAGGGCGCGGACATCTTCGTGGTCACGATCCCGGTGAAGAACATC
+CCCGACCTGCCCGCCGGGCTCCTCGACGGCGCGACGGAGGGGTTCGTCCTCATCGACACC
+GGCAACTACTACCCGCAGCGCGACGGCCGGATCGCCGGGATCGAGGACGAGGGCCTCACC
+GAGAGCCGATGGACCGAGCGTCAGCTCGGGCACCCGGTGGTGAAGGTCTTCAACGCCACC
+TACGCCCAGGACCTCCTGGACAAGCCGCGCCCCGCAGGCGCCGCCGACCGCATCGCCCTG
+CCCCTCACCGGTGACGACGAGGAGGCGAAGAAGACCGTGACGTCCCTGCTCGACGAACTC
+GGCTTCGACGCCGTCGACGCGGGCGGCCTCGACGAATCCTGGCGCCAGCAGCCCGGCACC
+CCGGTCTACGGGCTGGCCGCGGGCGCCGACGAGGTCGTCGCCGCGCTGGCCGCCGCCACC
+CCGGAGCGTCCAGCGCAATTCCGCGCCTGA
+>orf00047 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAGTTCATGCTCTGGGCCGGAGACCTGATCTGCGTACGCCGCACCCCCACCTGGCAA
+CGCCTCCTCGACCTCCCCGAGCGCCACCTGGCCACCGCACTGCACACCAACCGCCTCACC
+GACGAGGAATGCCTCACCGCCCTCCTCACCCACGCCGCCCGCGCCCTCGGCATCGCCACC
+ACCGCCGACCTCGCCGACTACCTCCGCATCTCCACCCGCACCACCGCCGCTCTCCTCCCG
+CACACCCCACTGCTGCCCGCCACCGTCGAAGGATGGACCGAACCGGCCTGGGCCCACCCC
+GACGCCCTCACCCCACCCGCCCCGGCAGACGACCCACCCGTCTTCCTCGGCCCCTTCGAC
+AACCTCATCTTCAACCGCCCCCGCACCCAACGCCTCTTCGGCTTCACCCACACCCTGGAG
+GCCTACAAACCCGCCGCGAAGCGCGAGCACGGCTACTACGTCTGCCCCCTCCTCCACCAC
+GACCAGCTCATCGCCCGCGCAGACCTCACCCGCACCACACACGCCGTCACGATCACCCAG
+ACAAGCACCGAAACCAACGCGCCCGGGAACGCCAGCGCTCTTATCCACGAAGCTCTGCAA
+CACCTCACCCACGCCGCACAGTGA
+>orf00049 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGGCACCGCCACGATGACCCTGACCGCGACCGCCGCCGGGAGCGTCGCCGCCCGCTGG
+CCCTGGTGGACGACCCTCCTCCTCGTCCTCGCCGCCAACCTCACCAACCCGCCCCTCAAC
+GCCGCCCTGCGTTCCTCCTGGCGGCGCCTGGTCACCACACCCACCCAGCTCAAGACGGTC
+CACTCGGCCGACAGCATCCTCGAAGAAGCCGGCTTCGTCGTCGCCCCCCTGACCGCCGGA
+GTCCTCATCACCTGGCTCGGCCCCGTGGCCGCCTACGAAAGCGCCACCGCCCTCTACCTC
+ACCGTCATCGCCCTCTACCTCACCGCCGCCCGCCTCTGGGGCCTCACCCCCACCAAACCC
+CCCGCCGCGCAGGCCGGGCGGAGCGAGCGCGCGCGGCGCGCGCACCGCTGGCTCGGGCCA
+CTCGCCCAGCCCCGCATCATCGGGATCATGATCCCCATGCTCGTCATGGGCACCCTGTTC
+GGCGGGACCAGCATCTACGTCCCCGCCTACAGCCAGCACGAGCACGCCACCACCCTCATC
+GGCCCCCTCCTCGCCGCCACCAGCGCCGGCGGCGTCCTCGGCGGCCTCCTCTACGCCCTC
+CTGCCCACCCAGCGCCTGGCCCCCTGGACCCTCTACCGGCTCCTGACCGCAGGGTTCGCG
+CTGCCCGCCTGCTTCCTCCTGGCCGCCCGCCCCCCCTGGGCCCTCGCCCTCCTCCTCCTG
+CTCAGCGGCTTGTTCGTCACCCCGCTGTTCATCACCGCGTTCCTCCTCATCGACACCCAC
+GCCACCGACGACGTCCGCACCGAGGCCAACACGTGGGTAGGCGCGAGCACGGACGTGGCC
+AACGGCGTCGTCGCCGCCGTCATCGGCGCCCTCACCGCCCACAACAGCTTCACCACCGCC
+CTGACCGTCCTCACCGCCTGCGCCGCCCTCGGCCTCCTGACCGCACTCCTCCTCCCCGCC
+CCCGAGAAGAGCACCGTGCCCGAAACCTCCCCACACGTGCCCGCCAACGACGCACCGGCC
+ACGACCGCGTGA
+>orf00050 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGTTGATGTCGCGTTCACCGCGCTCTACCCGTGGAGCCTGCCGCCCGACAAGCCGCGT
+ACCGACCGGGCGGCCGCCCGGTCGGAGCGCGACCTGTACGCGGCGCATTTCCGGCACGCG
+CGGATCGCCCGGCTGCCCGCGGACTGCCCGCCGTGGGCGCTCGGCCAGGATCTCGGCTGG
+GTGGTGCGCTCCCCGGTCACCGCGACCCTGACGCCGCTGTCGGACACGGACGTCGCCGTG
+CCCGAGGACGAGGACGTCAGAGCGGTGAGCCGCCGCGCGGGCGGCGGGCAGATGTGGCGC
+CGCGGCCCCGACTGGATCGCCGTTCCCGACCAGGGCGGAAGCTGGCTGCGCCGCTACGAC
+TTCCGCAACTCCAGCGGGCAGTGGGAGGCGATGTTCCTGCCCAACGGACAGGGCACCGTG
+GAGTGGCATCTCGGCGTCGCGGTCCGCCTCCCGCAGCCGTACTTCCTCATGGTCCTGCCC
+CTGGACCCGCCCCTGCCCGGCCTCCACGTCCCCGTCGGGATCATCGGCGCGAAGACCGTG
+AACACCATGACGGACATCAGCATCGCCATCCACCCCACCCACCCCGTCGCCGTCCGCCGC
+GAGCAGCCCGTCGCGCGCCTCGTGCTGCTGCACCCCGACACCCTCCGCGCCACCAGCACC
+ACCACCCCCCTCACCGCCGCGCCCCCCGCACCCGCGTCGAGCCCACCCGACCCCGCCGGG
+CCGGCCGCACCGGTCGCTGCGCCCAACACCACGATCCTGGACGCCTCATGA
+>orf00051 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCACGTAACGTCGAGTTCTTCTCGACCGACACCGACGACGGCACGATCTCGGTCGTG
+GCGAAGGCCGGGCCTGGCGAGCACCGGCGGATCGACCAGATCCGGGTCGGCAACGCGCCG
+CGCGGCGGCGTGAAGTTCACGAGGTCCGGGCGCGGGTTCGTGTGCAACACCTCGCAGAAC
+ACGATCAGCGAGATCGACCCGGTCGCCCACACCGAGGTGCGGCGGATCGAGGTCGGGCAC
+GGCCCGCGCGGCCAGGGGCTGCTGCCCGGCGACACGTACCTGCTCGTCTCCAACTCCGGC
+TCCGACACCGTCAGCATCGTCGACCTCGAGCTGAACGTCGAGATCCACCAGGTGCCGGTG
+GGCCGCGACCCGCGGCACATGGGGATCAGCGCGGACGGCCGGAGTGCGTGGGTGTGCGTG
+TGGGGCGCCGGCTACGTGAGCAAGCTCGACCTCACGGCGCTGGTGGAACGGCAGGACGCC
+GCCGGGGTCACCGAGGTCGCGCGGATTCCCGTCGACGCGAAGGCCCACCCCTACAGCCTC
+GGCATCGACCCCTCCGGTCGCAGGGTGTTCGTCGCGAACACGCAGGCCACCTACGTGACG
+GTGATCGACACCGCCACCCACGAGACCCACCGTGTCGACGTCGGCTTCATCGGCGGCCGT
+GGGGTGGCCTTCTCCCCGGACGGGCGCCACGCGCTGATCACGGTCGAGTCCATCAGCCGG
+GTCTACGTCATCGACGTCGACACCCTCGCCGTTACCCGGCACATCCCCGTCGGCGGCGGC
+CCCCGCGGCCTCGTCGTCGACCCCGCCGACTCCACCGCGTACGTCACGAACTTCTCCCGC
+ACGAACCTGCGCGCGGTGGCCCCGGAGCTCGACTACGACCCCAACACCCTCACCGTCATC
+GACCTCGGCAGCGCGCCTCTCGACCGCGAGGAGGGCGTCTTCGACACCGAGCCCCTCTAC
+GTCGGCTTCGGCCCCTGCTCGGTGACGATGTTCGACCTCGACACCCTGCCCGAGCAGGAA
+CGCCAGCGCCGCACCGAGCGCCTCACCACCTGA
+>orf00054 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCAGGCGTTCGCCACGCCCGTGGCGCGGTGCCCGTACCCGGAGGCCGCAGCCGTGCGG
+GATGTCCTCACCGAGGCGGTCCTCTCCCGCCTGGGGGAGGGGAAGGTGTTCGGCTACAAG
+CAGGAGACCTCCCGGGACCTGACCACATGGGGTGTGGCGGAGCTGGACGCGCTGACGGGC
+TGGGTCGGCCGGATGACGCGTCAGCTGGTGGAGAAGCTGGCCGGCGTCCCGCTGGGGGAG
+GCGTTCGCGCGCTCGGCGGGCCGGGAGGGCGAGGGTGCGGGGGTGCGGGCGGCGGGGATC
+GTGGCGTCGCGGAGCTGGGCGAGCGTGTACCGGGCGGGTGACCGGCATGCGGCGCACTTC
+CACCCGAACACGGCCTGGTCGGCGATCTACTACCTGACCGCTCCCGGTGTGTGTGAGCTG
+GACCTGCTCGATCCCCGCCCCGTGGGCTACTTCGATGCGGGGATCGTCTTCGCGGGGGAG
+GACCAGCGGATGCGGCTCTCCTGCTCACCCGGCGACCTCGTGATCATTCCGGGGTGGCTG
+CGTCACGAGGTGCCCGAATTCCAGGACGACGAGGTGCGTATTTCCCTTTCCTGGAACCTG
+AACTACTCGCTCCATCGCGGCTGA
+>orf00055 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGGGCTCGCGCGGGGCGGCGGCGGTGCGGGGCCGGGGACCTTGCGGGTGCCGGTGCT
+GTGCGCCTGTGGCTGCGCCGCTTCTGCTCCCGTGCGGGGCAGGTTTTCTCTGTGGTGCTG
+CAGGTGGGGGTTGCGTTTTGGTGGTAG
+>orf00056 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGATTGGGACGCTCACACCGAAGAGGTGCGCCTCGCGACCATCGCGCTGCCCACGGTG
+GTCTCCGATCTCCTCGGGCGCCTCACGGACGAGATCGAGAAGCTGACCAGGTCGTCACCA
+CTCGCTGCGGCACGCGCCGCGCACCTCATGCAGGTCGCTGCGAAGCAGGCCGGCCGGTGG
+CCCGCGCAGAAGGCCCTGAACGACACCGACCGACACGATGCGGCCGTTGCGCTGGTCGTC
+AGCGAGAACGGCGCGCGCTCGTTGCTGGCGCATCTCGGTGATGTCAGCCTGTACGGCTGA
+>orf00057 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCTCACAGACGAGGCAGCGGCCCGGGCACTGAGGCCGCGCTTGCCCACGAGTTCTCC
+CAGCGGATCCTGATCGCCATCTCCAACGGCACCAACGCCGTCGCGGCGAAACAGTCATCC
+GCCGACGCGGTCGTCGCCTCTGGTGCGCTCGCCTGTTCCCTCGAGAGCGGCGTGCGGGCT
+CGGAGCGGGCGGCGACTTTCTGGTTTTTGGGGCGGCGGCGGCTGGGAGGGGGCATTGTCG
+GAGCACCGTATCTGTAGCGCGGGTGGCGAGCGGCGGGTGGAGGAAGTTGTGGTGGAGCGG
+GAGACGTGGACGGACCCGGAGTTCGGCTCCGAGCACGAGGGATGGGTCGGTGTTCTGCTT
+GAGGACGGCACGGTCCCACCACCTGTTTTCTTCGGCTCGGAGAGCAGCGCTCATCACAGC
+GAGGTGGCTCAGTGGAGCGTGTACATCGGCAGGTACCCCTACGGGCCGCGCGCCGCTGCG
+CTGCGGGGAGCCTGTGCGTGCGGCTGGACCGGGCCCGCGCACGTGCTGGACTGGGGAAGA
+TCGGCGACCGGGAACTGCAACTCGCCGGAGCCAACGCAGCGGACAACTGTGTAG
+>orf00058 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGAGACCAGTACGCCGACCACCTCAGCGCCTTCGGCGCCGCGGCAACTGAAGGAATC
+CAAGGTGTCCTGGACGAGAGCAACTACGGGCAGCTGAGCTCCCTCGACTTCGACGAGACC
+GAGCAGGGCATCTTCGTCTCTTTCACGATCGACCTGAGCGGCGAGGTCGCGGAGCGCTGG
+GGATCCGACGTCTACACCCGCCGCTACCTGATCATCAGGACGCAGGACGGACCTGTTGAC
+CCGGTGGAATTCGGTGCCTCTCTCCTGCACACGAGTGTGATGGAAGACCTGGACACCGCT
+GGCAGACGCTCCGCGCGGTAG
+>orf00060 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGACGCGCGGCCATCGCTACCGGAGCCAGCATCGCCAGCACCATCGGGCTCCTCATC
+GCCGGCACAGTCCCTGCACATGCGGCGGGTGAGAACTGGGCCGTCTACTCCACCCACTTC
+TCGCCCAAGGGACACGACATCCCGCTGCGGTACGGGCGGCACGACAACACGGCCGGGCAC
+ACGACGGGCTTCGGGAAATACCACATCGAGGACCGCGGACACCTGCTCGGTGTCTCCTGG
+AGCACGTTCAAGAAGGACATCGACGAGACTCTCGACAGTCCGACCATCAAGTGCAGCAAA
+AAGAACACCACATGGACGTGCGACTCCAACAAGATCAACGGGGTGAACTCGACGTGGGGC
+AACATGAAGGTGTCGTACACCCACAGCACCTCGGGCACCCCCGACGGCCGCGCCCGTGGG
+ATCATCACGGCCTACTACCTCAACGACTGCGGTTGCTTCGCCGCTGAGGAGAAGACCTCA
+AAGTGA
+>orf00063 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTCAAGGTGAGGGAGTACTGGCGCGGCGGCACGAAGGTACGGGCGCATACCCGCCTG
+CCTCCCGGCGCGCGCAAGCAGCTGACCATCGCTCTCGTCGCCGTGGCGGCCGTCTTCGTC
+TTCAGCCACACCGGCCCCGCCACCGAGGCGTCAGAGCCGCGCCGGCCATCGACGAACCGC
+TCCACACCGCCACCTGCGCCCGCAAGGGAGAAGGAGGAGCCGAGGCCGGGGCCGAGCTGG
+ACCGTCACCTACCCCATCCCCTGGGACCGCGACGGCTCCTGA
+>orf00065 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCTCCCGCACCCTGGCCGCGACCGCCGCCGCCTTCCACGCCTTCTACGACCTCAAC
+CACTTCGCCTACCGCGACTACGCCGGCGCCCTCCTCCCCACCGATGAAGCCCACATCCTC
+GTCACCCACGTCTTCACCCTCCTTGCCACCGACTGGCCCCGCGTCATCGGCCGCCCCAAC
+CCCGCCGCCTTCGCCTGGGCCCTCTTCACCCACCACATCGCCCTGCGCACCGGCACCCCA
+CGCACCCCCGCACAGGACGCCGCACTCCTCTACGACACCCTCCACCACAGCATCAACACC
+ATTGCCACCCTCACCGGAACCGAACCCACCCTCGTCGGCACCCTCATCACCGCCACCCGC
+CGCTAA
+>orf00066 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAGTGTTCGCCCGCCCGCGCCCCGCTCCTGCCAGGACTGCGGCACACCGCTGGAACCC
+GAGCCCGCCCGCTCCGGCCGGCCCGCCGCCCGCTGCGCGCACTGCCGTACCCGCACCCCG
+GCCCAGCGGCAGAAAGAAGAAGAGGACCGGCAGACGCGCGCCTTCTGCGAAGACGTGCTG
+CACGCCGCCACCGACACCGTCGCCCGCCACGCCGCGGCGCTGCTGCACCAGGCTTACGGC
+ACCACGGCCCCCACCGGCGACCTCCTCACCACCGTCGCGTGCCTGCAGCGCGCGCTGACC
+GTCGTGGAGGCCGCCACCGTCGCCCGGGCCCGCGCTCTGCACGAAACCCACGCCACCGTC
+GCCGCCCACCTCTCCGTCTCGGCGGACCACGTCCGCAAGAAGTACGACAAGAAGCACCTC
+GACCGCGTCCTCGCCCCCTACATGGACCCGTGGAACCCGACCCCCGTCTTCGCCGCGACG
+GACTCCGAAGGCCCGCCGGGCCAGGAGCCCTCCCTGCCCCGCGCCCAGGAGTGCTCCGAA
+CGCCGGGCCGCCGACCGCCTGCGCGCCGCGCTCTCCCACACGATGCGCCGCTCCGCGGCC
+TCGCAGCGCGCCGTCGCCGAGGCGATCAGAAGGCACCCCTCCTACGTCTCCCGGCTCCTG
+TCGGGGGAAAAGCCCCTGCACTGGCCCCACGTGCGGGACTTCGCCCGCGTCCTCGGCATC
+GCCGAGCGCCTCCTCCTGCCCCTCTACAACGTCGCCGCCGGCATCGAACCGCCCCCGGAG
+ACCGATCCCGTCGCCTACCTGCGCGACTACCTCGCCGGCCTCCTCCTCTCCTGCGGCCAC
+ACCCCCCACACCCTCGGCGACGCCCTCGCCTCCACCGTGCACCCCACCGCTGTCCGCGAA
+GCCCTGCACGGCCCGGGCGTCCCCGACTGGGCCGTGCACAAGCAACTCGCCGCCGCCCTG
+TTCAGCCTGCCCAGCGACATGCGCCCCCTCTGGCAGGCCGCCCACCACCACGCCGTCGCC
+CAGGCACGCACCTCGACGCCCTCGCCGTTGCGCGCCGAGCACTTCGGCTGA
+>orf00068 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCGGTCACCGTGCGCGGAAACCTCCTCACCGGGGCGCTCACCATGCCCTGGCTCCTC
+ATCACGGGCACCTCGTCGCCCTGGACCGCTCCCGTCCTGGCCGCGCTGAGCACGGCCGCG
+GTCGGCTCCAGCGTCGTCTACCGGCGCGTTTGGCAGCGCTGA
+>orf00069 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCCACGGCTCCGGGATGGACTGCGCAGAGCGGGCCGGCATGTTCGTGACCGAGCGC
+GCTCAGGGCCAAGCTGAATCACGGGAGAGGCCGGGTGTGCGGGTCTGGGGTATCCCGTAG
+>orf00070 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCTGGTGCGCGACATCACTCGCCGCGCCGATGCCGCGCGAACCGGCAGCGTCCGGTC
+GGGCGGCGTGCGGGTGCCTCGATGCCGGCGACGAGGATCTGGGCGCGCGCGGCGTGA
+>orf00071 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGATGATCAACGAGATCGGCCCTCGCATGGCCGGGGAGCGTCTGATGTACAACCGGGCC
+GTCAGGGTCGACCAGCCACGTAGTTGGCTGTTCGTCTCGGGGCACGAGGCTCGCGACGAC
+GACGGCGGCATCGCTCACCGGGGCGACATGGCCGGACAGATGGAACTGACGCTGCGGCGG
+CTGGGCGAGACCGTGGCCGAGGGCGGAATGAAGATGGCGGACGTGGTACAGATCCGCGTC
+TTCACCACCGATCTCACCTCGTGCAAGGCCCACTACGGCGTCCTCTTGGATGCACTCGCG
+GCGGTGGACTGCCGACCTGCCAGTCTGCTGGCAGAGGTCAGCGCTTTGTCCGACGAAGAC
+ATGCTGATCGAGATCGAGGCCGTAGCGGTGTGCTGA
+>orf00074 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCATCGCATCCGGACGGTCTGGCCCGGCTTCCGGCCCTTCTCGGTACGCCGGCTGGTG
+CTCGTGGGCGGGTTCGCGCGGGGGCGCTTGAGGCGAGCTGTTGATGGGGAGATATGA
+>orf00076 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGGTGGAAAGATGAGTTTCAGATCGCGATGGGACAACTGGGCGAAATACGGGAACAG
+TTGGGGCGTCTCGAGGGGCGCCTCGACGATCCGACGGCGGGGCTTGTCGCCCTGCATGGA
+CAGGTCGAGCAGGCCCGGACGAAGATCCTGGAGAACGTGCAGGGAGGCACGACCGGGCTG
+CGCGAGGAGAATCGCGAGCTGCGACGTCGGCAAGAACGCATGATCAGCGATCTGAGCGAG
+GCGAGGGCGGAGCTGAGCCGTCCGGCCCCGACCCGTGCGGATCTGTTGGAGAGCCCGGTC
+TCACACGTACCGGAGCTGGCCGAGGAGAAACCGAGTCAGGAGACCGACGCGCCCGGCCCG
+GCCCTCACCGTTGTGGGATCCCAGGACGGCAAACGCCCCACCACGGATGAGCCGGAGCAC
+GCCCTGCCCACGAATGACCTCTCGGGAGACAGCATGCGCAACTATGACCGGGCCGTCCGT
+GCGGAGCGGGACCAAGACCGTGATCTGCGGCCGTCGGTCGAAGCCGCCTACCGGGGCACC
+AGCGCCCCCGCCGGCCCGGCATCGACCTCTGGCTCTCCGGAGAAGGGCCTCCGGGTTGCC
+CACGGCGTCCTGCTCCTACGCGCCGCGGGGGTGGCCTCGGCCGAGGTGGTCGCGCACCGG
+GACACCTGGGAGTGGCTGGCTTCTCTCGCCTCCGAGCACGCCCACTTCCGCGCCCCGTTC
+GCGGTCGAGGACTCCGGAGAGGGGCGGGTACGGGTCGTGGTGTCCGGGCGTTCACTCATC
+GCGCTGCTGATCACGTTGTGGGACACGCGAGCCGACGCCGAGTCCCCGGACGGGGACTGG
+GCGATGGCGGTGACGACCTACACCAGGATGGCGAACGAGCTCTCCGAGGCCACCGGCGGC
+GACCACGAAATAGCCGGCGCCATCCGCATCGTCCTGGACGACGGCGTTCCGGAGGAGCGG
+AGGGAGTAG
+>orf00083 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAAGGAGAGGGTGCCCTTCCCTTTCGGGATGATCCCTGAGCGCTGCTATTCCGGCGGT
+GGCGTACGGGCCGCGCAGGGCGACGGTTATGACTGCGACTCCTACGGCACTGTCCAGACG
+ACGAAGGAAACCGGCACCGCCGGCACCCAGAACCCCTACCGCTTCGTCGGCGGCACCTAC
+GACCGCACCACCGGCTACGTTAAGTTCGGCCAGCGCTGGTACGACCCCACCACCGGCCGC
+TTCACCACCCAGGACAAGTACAGCTTCCTTGCCAACCCCGGACGGGGCAACCGCTACGCC
+TATGCCGGCGGCGATCCAATCAACAACACCGACCCGCTCGGGCTCTTTTCGTTCGCTGAT
+ACGGTCGGGATCGTCGCTGGTGGCCTGGCAGGAGCTGCCGGGGTGGCTGTGGTGGCGGGT
+ACGTGCGCGCTGACAGCTGGAGCAGGATGCGTGGCGGGGGCTCTCATCACCGGTGCCATG
+TGGGGTGCAGGTGGAGGGGCGCTCGGATCTACTCTCGCTGGCGGAGACTCTGCCGAAAAA
+AGCAATGGGACACTTGGCGGTCTCGTCGGGGGAGCCACGGGCGGACTCGCGTCTCTGCTT
+TTCGGATAG
+>orf00084 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGAGACAAAGAGATCGCTCTGTACGTGGCGGGGGTTTGCCTTACTCTGGGGCTCGCC
+TTCTCTCTATATAGAGAAAATTACACCCTCGCAATCCTGGCGGCATTTGCGCTGATCGTC
+AACGGATTCGCAATCTCTCAGGAGAGGAGAAAGAAAGGCGACTAA
+>orf00086 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCTTCATCCAGCGTCCGCAGACGCTCGGTTCAGGTGGGGATCGCGACGGCTGTTGTG
+TCGGCCGTGGCGGTGTGGGGAATGCCGGCCGCGTACGCGGCGGCTCCTGACGCTCCGTCG
+CAGCTGGTGGCGCTGACGGAGAGCACGGCGCCGTACGTGACGGCGAAGGTGGTGGCGCCG
+TCGGGGAGCGGGAAGGTGACGGCGAAGTTCTACGCCGGCACATATGCGGCCAACGGTGAC
+AACGACCTCGCGGACGGCAAGGAGGTGACGGTCGATTCGGGTGAGGTAGCACGGCTGAAG
+CTGCCCGACATGCGGATCGGGACGCAGTTCACCTGGCAGGTCAAGGCCTGCGTCGACGAC
+GACTGCTCCGACCTCTCCCCCCTCCAGACCACCCGGGTCAGCCCGATGACGGGCGCGGGC
+GAGAGGCCCGGGGCCACGCGCCTGCAGTTCTCGACGGGCGACTCGACGGCCGCGCAGGTC
+GATGTCGGCTCGGGCAATCTTCTGGTCAACGCCTCCGGGCTGACCTTGCCGGGGGTCAGT
+GGTGACGTGGGCCTGGGGGCGGCGTACAACAGTGCGGCGATCGGCACGGATGCGACCTCG
+GCGAAGTCGCCACTGGGGTACGGGTGGCGGCTGACCCCCTACGAGGTCGAACTGAAGGAA
+CGCGGGGACGGCTCGGTCACCTACTACGGCCAGGGCGGGATCACCGGCCTGTTCGTGAAG
+TCGGGCAGCGGGTTCACGACGCCGGGCGGGTTCAAGGCCGACCTGAAGAAGAACAACGAC
+GGCACCTACACCCTCACCGACCACGGCTCCCAGTCGAAGCAGACCTTCACCAGCGCGGGC
+AAGCTGACGAAGATCACCGACCGCAACGACAACGCCACCACGCTCTCGTGGAACGGCGAC
+CTGCCCGACACCATCGTCACCACCCGCGGCACCAAGACGCAGCGCACGGCCGTGTACGCC
+TCGGCGAACGGGCGGGTCACGACGCTGACGCAGACCGCCTCGGACGGCAAGAAGCGCTCC
+GTCACCTACACCGTCGATGCTGCCGGAGACCTGGTGTCGATCAAGGACACCCTGGGCCGC
+ACCACCAGCTTCACCTACACCGGGCACAAGATGACCTCGGTGACCAATCCCGGGGGTGGG
+GTGACGCGTTTCGAGATCGGCGCGATCGGCGCCACGAAGATCACCCAGGAGAACAAGGCC
+GCCGGCTCGCCCGGAGACTCCGTCACCCGCCTGTCCTACGCGGACCCGGACAAGACGGTG
+ATGGCGTCCCCCAACACCGACCAGACGAAGACCGTGACCGCCGTTCCGCACACCACCTAC
+GAGCTGACCGACAACAACTCGGCGCGGGTGGCGAAGGCGACGGACGCGGAGGGCCGGGAG
+CGCTCGAAGACGTACACGGCGAACTTCGACACCGCCTCCTCGACGGACGGCTCGGGCGCG
+AGCGCGGGCACGACCACGAACACCTTCGGCGCCAACGACGGCGAATCGCTGACCAAGTCG
+CAGGGTGCGGACGGCTCGACGTTCTCCGCCGCGTACGGCAACACGGCGGCGGGCTCGAAG
+TTCTCGCCCTCGGAATCGACGGACGGGCAGTCGAACAAGTCCGCCTACTCCTACAACGGC
+GCGGGGAACCTGGCCTCCTCGAGCAACGCGGAGGCGGCCGAGGCGAAGGTCGACTACAAC
+GACGACGGCACCGTCAAGACCAGCACCGACCCCGGCAACAGCACGGACACGTCGTACACG
+TACGACGGCGACAAGCAGCTCACCAAGGTCGACCCGGCCGGCGGCTCGCTCAAGTCCCAG
+TCGTACACGTACGACGCCTGGGGCCGCCTGGCCGTTGCCACGGACGGCCGGGGCCTCACG
+ACCACAACGACGTACGACGACGCCGACCGCGTGACGAAGGTCGACTACTCGGACAGCACC
+CCTGATGTCTCCTACACCTACGACGCTTTCGGCCGTACGAAGACCCGCACCGACGGGACG
+GGGACGGTCACCTATGGGTACGACGATCTCGGCGCGATGACGTCGCGGACCGCGACGTCG
+GGCGGGGGCACGCTGGCGTACTCGTATGACAAGAACGGCAACCGCCTCAGCACCACTGAC
+GCGCGCGGCACCACGCAGTACAAGTACGACCAGGCCGACAAGCTCACCCAGGCGATCACC
+GATGCCCCGTCGACCAAGACGAAGATCGGGTTCAGCTACGACGATCGCGGCCGGCGCACG
+GACACGTACTACGGCACCAACGACGCGAAGACGATCTTCAAGGCGCGCGTGCACCAGGAC
+TACGACAAGTCCGGCCGCATCAGCCGCGTCTGGGCCGACCAGGGCCCGGCGACCGACACG
+ACCCGCCAGTTCGACGCCACGTACTGCCGCAGCCTCGGCTCCACCTCGTCCTGCTCGACC
+GAGAAGGCCGACAACACCGACCTGATCCAGTGGAGTAAGGACAACCTGAGCGGCAAGACC
+ACCAAGTACACGTACGACAAGGCCAACCGGCTGACGAAGGTCGCAACCGACGGGGGTGGC
+AAGACGTACACCTACACGTACGACGCCCGCGGCAACCGCAAGTCCTCGTCCGACGGCAGC
+GCGGATCAGTCCCTGGCTTTCGACGCCGCCAACCAGATCACCAGCGACGGCTACACGTAC
+GACGCCCAGGGCAACCAGACCAAGACCGCCAAGCTGTCCACGCTCACCTACGACGGCGCC
+AACCGCATGACCGGCGCCAAGACGGCCAAGGGCACCAGCAACTACACCTACGCCGGCGAG
+GACGCCACCGAGCTCGTCTCCCAGACCAGCGACGAGGGCGAGAAGACCGACTACGTCTAC
+GGCGCCCCCGACCAGTACGGCATGCCCGTCATCGAACAGGTCACGCTGAAGGAGGGCACG
+GCGTACATCGACCACGACCCCACCACCGGCCAGCCCCTCTCGCTCCGGACAACGAACGAG
+TACGAGGCGTACTACATCGTCGACGGCATCGGAAACCCGGTCCAGTTCATCAACCAGTCC
+ACGGTCCAGTCCACGATCTACGACTACGACCCCTACGGCACCGTCCAGACGACGAAGGAA
+ACCGGCACCGCCGGCACCCAGAACCCCTACCGCTTCGTCGGCGGCACCTACGACAAAACC
+ACCGGCTACGTAAAATTCGGCCAGCGCTGGTACGACCCCACCACCGGCCGCTTCACCACA
+CAAGACAAACTCAGTTTCTTCGCGAATCCCGCACGCGGAAACCGCTACGCGTACGCAGGA
+AGTGATCCTGCCAACGCGGCAGACCCAACCGGCCAGGATTACTACGACTGCGCCTTCGCG
+GGACTCGTGTTTGTCGGGGCAGCGGGAACGGCAGTTCTCAGCAGCGGAGGCACAGCCCTT
+TTCGGTGGCGCCGCTGCGGTAGGAGCCGGTGGTCAGTCGTACAGGGCTTGCCCCAAGGAA
+GCCAAAGAGGGTCCCGGGCGGAAGAACTCGCTGAAGGCAGCAATAACCCCGATATGGAAA
+ATTCTGTAA
+>orf00089 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGGTGGCGGGGCTGGTTCGGGGGTGTTGGTGGTGGCGGATGGCGGTGGCGAGCAGCAG
+TCCCACGACGCAGGCGGTGAGGCCCCAGAGGCCGAAAGCGAGGGCGAGGGTGTGAAGGCT
+GGGCATGGAGCGGGCTCCGTGATCTGTGCGCTCGACGACACCGAGTGCGGCGAAATTGTG
+TTTTCTGAGTGA
+>orf00090 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCGAAGCTCGCGGAGCCGTGCTCGGGGTTGTTCGCAGGGCGCCGGGGTACCACGGCG
+GCGGGCAGTACGGTGATCGGACCAGAGAACGAGACGACGGGAGCGCCGGTCGGGTCCATG
+GTCGCTTTGGCGACGGTTCTCGAGCCGAGCTTGCCCGCAGTATGTCTCGTGACTCGGCGT
+CCCGCTGAGGGCACACGCCCGCCCGGGGGGCAGAGGTCGTGTGCGTCGGTGGTGACGGGT
+CGCAAGCGCATGCTGAGCATCTGGCGGATGCCATGCCGTCCCGTCATCACGCTCCGCGCA
+AGCCATGCGGCATGTGAGCCCGCATGCCTACATCTCCCCGGCGAGCGCCTCCCGTGCCTC
+TTCGGGGCCGGACCGGCTGCGCAGGGCGTCGCTGAGGCCGGTGACCTCGAGCAGGCGCAG
+TACTGCGCCACCAGCGCCGGCCAGGGCGACGGGGCGGCGTGCACGGGTTTGGAGGAGGAG
+ATTGAGGGTCTGGGAGTCGGCGAAGGTGACCTCGCTCAGGTCGAAGACGACAGGTCCTCC
+GAAGCGGCTCAGGGCATCGTCCACTGCTTCCTCCACGTCCTCGGCGCTGTCCATGTCGAT
+GTCCCCGCCCAGAGCGATGAGCCACACGCCCTGCCACAGCGTGCTGCGCAGGACCGGGTG
+ACCCGCTCTCCTTCCAACATTTGTCATGCGGCAACTATCCAGGGCCCCTCTGACAATGCC
+GCCCCCGGGTGTCCCTCCGGGCAACGCACACGCTCAGGGGTATCCGTTCGCGGACAGAGG
+GTAGGCGCGAGCTATCCGAAAAGAGGAGCAAGGGTGCTTTCCCTGGAGTCCGCTGAACTC
+ACCGCCGTTGACGCGCGACTCCTGGCACAGACGTACGCGGCCGCCCACTGCCCGCGCGTG
+GACCGTGCCGCGGTGGCCCTGGTCGTGGCCGAGCTGCTCGCGAACGCCGAACGTCACACC
+GCTGGGAGCTGGCGGCTCGTGGTCAGCCACAGCACTCGCCTGCTGAGCATCGCCGTCCAC
+GACCTGGGCCGTCTTCTCCCTCTACCTGGCAAAGTGGCGTTCGACGGCACCGGGCAATTC
+GGTCTGCGCATCATCCGCGGTCTCAGCGATCACTTCTCCGTCCACTCCGGCCCGACGGGA
+AAGACCGTCACCGCACAGTGGCACCTCGCCACCCTCTGA
+>orf00094 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGCCTGTCCCGCACCATCCCCGCCGCCCTCACCGCGCTCGCTCTCAGCACCGCGCTC
+GCCCCCACCGCGGCCGCCGCCGACCTTCCAGCCGCTCCCGGCGACACCGTGACCCTCCCG
+CTCCGCAAGGCCATCGCCGCCCTCGACACCCGGGCCGAGAAGCGCACCGGCTACGAGCGG
+ACAAAGTTCAAGCACTGGATCGACGAAGACCGCGACGGGTGCACCACGCGCAACGAGGTC
+CTGCTCGCAGAGGCCGTCACCGCGCCCGAGGAAGGCGCCCGGTGCAAGCTGAGCGGCGGC
+ACATGGCACTCCGCCTACGACGACACCACCATCACCGGGCCCGGCGGTCTCGACATCGAC
+CACTTCGTCCCCCTCGCCGAAGCCTGGGACAGCGGCGCCTCCGAGTGGAGCGCGAAGGAC
+CGCGAGCGGTACGCGAACGACCTTGGCGACGACCGCAGCTTGATCGCGGTCTCAGCGAAG
+ACGAACCGCAGCAAGGCCGACCAGGACCCGGCCACCTGGATGCCACCGGCCGCCTCCTAC
+CGCTGCACCTACGTCACGACCTGGACCACTGTGAAGACCAGGTGGGGCCTGTCGGCCGAT
+ACCTCCGAGAAGGCGACCCTGGAGCGCGTGGCGGGGGACTGCCCGAACGTGCCGATCAAG
+GTCGAACTGGCCCGCTGA
+>orf00101 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGATCTCGGCTGGGGGTGGGTGTCGTGCGTGGCGGCGTGGGTGGGGTGAGGGTGGGGGG
+ATGGAGTATCCGGTGCGGGTCGGGCTTGCCCGCGCGGCCGCCGCGCTCCCGGCCGGCGAC
+GGGTGGTGGTACGAGCCGAAGTACGACGGCGACCGGTGCGTCCTGTGGCGGCTCGACACT
+GTCCGCCTCCAGTCCCGTACGAGCAGGGACATCACCGCCGCCTGGCCCGACCTCACCACC
+CCCGCCACGGACCTGCCGCGCGGAACCGTCCTCGACGGCGAAATCGTCATCTACCGCGAC
+GGCATGCTCGACTTCGGCGCCGTACGGGCCCGGTCCTCCAGCCGCGGGCGGCGCCTGCAG
+GACCTCGTCACCCGCCACCCCGCCCACTACGCCGCCTTCGACGTCCTCATGCACCAGGGC
+CAGGACGTGCGGGCCCTGCCGTACGAGGCGCGACGCGCCCTGCTCCTGACCGTCCTCGAG
+CCGCTCGGGCCCCCGCTCCAGGCCACCCCCGCCACCGACGACCACGACGTCGCGACCGTG
+TGGATGACGAGCCTGCGCCCCCAGGGCATCGAGGGGATCGTCGCCAAACGCGGCACAAGC
+CCGTACCCGGTGGGCCGCCGCGAGTGGGTGAAGGTGCGTCACGCCGACACCGTCGACGGC
+GTCGTCACCGGCTACCAGGGCCTGCCCTCACGGCCCTCGCACCTCTTCGTCCTCCTGGCC
+GACGGGCGGACCGTACGCTCGCAGCACCTCCCCGCCGCGCTCGCCGCCGAACTCGGCCAC
+CACCTGCCCGGGCACGACACCGGCACCACCCACGACCCCGACACCGGCCCCCTCCACCTC
+ACCGACGCCGCACTCGAGGTGGAGGTCCTCGCGGGCTCCACCCGGCACGCCACCGCCACC
+GTCACCCGCCTGCGCACCTGA
+>orf00103 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCGGCCTGCTCCTCGTCGGAAGCGGCCAGCACTGGGGGACCCGCCAATCCAGCCGCT
+TCGGCGAAGCCTGCCTCCGACAAGGGCTCCGGGAACGCGGACCCCGCGGGCGGAGGTCAG
+ACTTCCACCACACCGGCCAGTGCGGACCCGTCGGACTGCGCTGCCGCCGACAAGCCGGAG
+TGCGTGGTCGACATCGGGTCCATCGAGATGGAAGAAGGCAAGCTCGCTGACGGGCCGCCC
+CAGACGCGCTGA
+>orf00105 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGTGCAAGCAAGCGAGCTCGGTGGAGCGTTCTGTCGGGTGCGGCGGCACTCGCTTTT
+TCTGTCCTGACCGTGTCGCCGGCGGTGGCTGACGAGGCGCCGCCGGGGATGGTGGAAGTG
+ACCCTCCCGGCCGACATCGAGATGGTCGAGGGCACGCCCGTAGCGCCGGGCGAGGAGCCT
+TCCACAGGGCTCTCGAAGGCGGCCGCGGTGGACCGTGTCTGTCTCGGATTGACGGTGACC
+ATTGGTTCTCAGGGCTGCTTCCAGCCCTACGGTGACGTCGTCTTCTCCGGTGACACGCAG
+GCGGACGGCCGGTCCTCTGTCACCATCGTCTACACCGACTACGGTCGCGAGCCCTTCGGC
+TGTTACAACAGCACAGGGGCGAACACCTGGGTCAAGTGCAACAAGAATTACCGGGAGGAC
+GGCAACGTCTACCTCAAGGTCCTCCGCTACGACAAGCCCACGGGCAAGTACTACCAGCCT
+GAGGCGAAGTCCAGCTGGATCCCGGTCGACGGCCAGTGA
+>orf00106 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCAGCGGCCCGGCACCCTGCTCCCCGCGACCCGCGGGTACTCGCCCGCCCCTCCCGAA
+GCGGCCCACTTGGTGTTGTCGGGTCAGGCGCGCAGGCGGCTGACGGTGAGGGTGGCGTGT
+GTGTGGGGGGCATGA
+>orf00107 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGGCGAGGACGACGACAGCGGCGGGATGGAGCCGGGCGGGCCCGAGGATCCGGACTAC
+CTGGTGGGCGAGCGCACCAGCCGCCCCACCGCGGCAGAGCGGCGGGAGGAGGCGGAGGGG
+CTGTCCCGGCCGCTCGGCGACCCGGACGAGGCCGCGCACCGCTCCGCGCGCGGGCCCGCC
+CCCGGGCCGGTAGCGGGGAGAGAGGTGCGCGTTCCCGTCCAGCCCGGCCCGCAGGACCGC
+GAGCAGTTGCCCCGCCCCACCGAGCCCGCGCCCCAGGCCTCGCCCACGCCCGCATCGGGC
+TCGGCCGAGGAGGGCGGCGCCGGGACGTCACCGCGCCCGCACGGCCCGCAGGAGCCGTCG
+GCGCAGGCCGGAGGGTGA
+>orf00108 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAGGACCACCCGGCAACAGCGGCGCCGCTCGCGCGCGCTCTTCCGCAGCGCCCGCTCG
+GCGGTGAAAGGACTGCGCCTGCCCGAGGGGGCCGGCCTCGAGGAGGCGGCCGTGCGCGTC
+GCCCTGCACATCGGCAGGCCCCTGGCTCTCCTGCCCGCTGAGGAGCTGCCCCTCAACGGC
+GCCCTGACTCGCGCCATGGACGGCACCCTCGCCGTCCGCGTCCCCGTCCGCGGCGCGTTT
+CGGGAGCAGCCGGATACCTATCTCGTGCACCTGGCCTGCCGGGGCCTGGCCCGCGCCCTC
+CTCGGCGTTCCCGGGGATCCCCGTGCGGGCATCGACTACCGCACCGAGCCGGAGCGGCTC
+GTCGAGCTGACCGCCACCGAACTCGGCGTGCGCCTGCGGCCCGCCACCGCCGACGCACAC
+GGCCTCTGA
+>orf00110 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGGTCGCTGCGCGCGCTGGGCGGCATGGCGCCGCTGCCGGCCCGCGGCCTCGTGCTC
+GGTGCGCGCGCAGCCGCTCCTCGAGGACGCGCTGGCGCTCGGCGGTGGGGAGGTCGGCTG
+CTCCTGGTCGAGCTCGGCACCGAGGCGGGAGCGGTGCGCGCGGCGGACGTGGATCACGTT
+GCCGCAGCTCTCGCAGGGCTGGTTGGTGTCCAGGCTGATCCCGTCGTCGCACCGCAGGTC
+CGAGCAGGCCGGGCGAGGCTGCGGTGCAGCAACCACGGGTAG
+>orf00112 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGACACCGTGCACACGACCGCTGCCCTCCTCCCGGACCCCGCCGAACTCCGCGCGCAC
+CTGCGCGCGCTGGCAGTGCTGGACCAGGCGATCTGCCGCGACCCGCGGTTCCCCCGCTAT
+TCCTTCTCCACCACCTGGGGGCCTGGGACGGAGGCGGCCTTGATGGACAACGGCTCGGGT
+GACGACTTCTCCGTCCTCTTCACCCCGGTCGGTGTGCTCGTCCGCGGCTTCGACCACGAG
+TCGGAGATGAGCCCGTACGCCACGGACGACGAACAGGTCTGGCCCGGTGTCATCGACGAG
+GTGCCCGCCGCGCTGCGCCCGCTCCTGGACGACCCGACCTTCGTCGACGAGGGCCTCGGC
+GCCCCGCGGGTCACCGCCTGCCTGTGGTGGGAGACCGGCGCCAACGCCTGGCGCACCGGC
+TCGGGCATCGAGTTCCCCTCGGGCAACCCGGACCCGGACGGCTCCGGACACCTCTTCCAC
+CTCCTCACCGACCGCTCCCCCGAGGCCGCCCAGTCCCACTTCGAGGAGGCCTACGGGCGG
+CCCGTCCCCCTCGACACCGTCCGCCACGTCCTCGCGGGCCATCCCCTGGCCCCCGAAGCC
+GCCCGCGGCCTCAACCCGGCCGCCCTCTCCGACGAGGCACTGCTCGGCCGGATCGCCGCC
+AACCCCGAGGTCGGGGCCTACCTCGCCCGCGACGGCGAGTTCGACCTCACGCGGACCGAC
+CCCATCGAGCCGATCACCCTGCCCGGCGGTCTCCCGGTGGAGCCCGTGGCCGGCTGCAGC
+GCGGGAGGCACCCACTACCTCTGCGGCCCGGCTGGCTCCGACCGCGTCCGCCCCGTCCTC
+TACACCGACTCCGAGGGCCAGGCTTCCCTCATCGCGGAATCCCTCGCCGAGGCCCTGACC
+CTGGCCATCGCCCTTCCCTCCTGGCACGACGCCCTGGCCGGCGTTCGTCCCCCCGCGCTC
+AACACCGACTACCTTGAGGACAACCCGGACCACCCCGAGGTCCGCGACCGCCTCCTCGCC
+GCCCTCCGCCTACCCCCGGCCACCGAGCCCGAGGTCCTGACCCGCCTCCTCACCACGGCC
+GCCCGCACCGTCCCGGACGGCTACCTCCCTTCGGTCGAAGGCGACGAAGACACCACCTTC
+GAACCGATGCTCCGTCTACCGACCGAGTAG
+>orf00115 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTTGGTGCTCGTCTACCGGTACATCGAGCAGGTGAATCGCAACCGGAGCGTCCGGATG
+GTCGTGTACCTCGTGGATCTTGGCGAGGGGGCCCTCCCGGTGAACGCGGCGAAAAACCTC
+CTGCTGGAGGAGGCGAGCGGTGGCGAGGAGGCGGCGAAGGCGGCATGGCAGGACGCGGGC
+CTGCCCGAAGCGGGCGTGGTGACGTACGCGGAGTTGGACCGGGCGCGCGGCAGACTCCGC
+TGA
+>orf00116 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCTATCACCTCTCACCCCCCTCTGGTTCTCCGTCTGGTCGTGACGGGGGGAGGCACG
+GGCGGGCATACCTACCCGGCCCTGACCGCTGTGCGTACGTTGCGGGAGCTGTTGAGGGCG
+CGGGGGCGTTCTCTCGATGTGCTGTGGATCGGCAGCGCCGACAGTTTGGAGGCGCGTGTT
+GCCGAGGCAGAGGGGATCGCGTTCACGGCGGTGGCCACGGGGAAGGTGAGGCGCTCGTCG
+AATCCGTTGAGGATGGTCTCGCCTGCGAATGTGCGGGACATGGCGCGCGTTCCGCTCGGT
+GTGGCGCAGGCGCGCAAGGCGGTCGCGGGTTTCCGGCCACATGTGGTGCTCGCGACGGGC
+GGGTACGTGGCTGTGCCGACGGGGCTCGCTGCCCGGATGTGCAGGGTTCCGCTTGTGCTG
+CATGAGCAGACGGTGCGGCTGGGGCTGGCCAACCGGAGGCTCGCGGGGAGCGCCTCTCGG
+ATCGCGGTCTCCTCGGAGTCGACGCTGCCGCTTCTGCCGGAGAGTGTGCGCTCTCTCGCG
+GTGGTCACGGGAAATCCGGTGCGTCCAGAGGTGCTGACCGGGCATCCGGGCAAGGCCGTG
+GCGGCCCTGGGGCTGGGCTTCGATCTGGCCCTGCCCACGGTCTACGTCACGGGCGGGGCG
+CAGGGCTCGCAGCAGATCAACGAGGTCGTCGGCGGGGAGCTGCCGTGGCTCTTGGAGCGG
+GCCAACGTGGTGCACCAGTGTGGTCCTGCGCATTACGAGTCGCTGGCCGCGCGTGCGGCG
+ACGCTTCCTGCTCACCTGGCGGTCCGCTACCACGTGACGCCCTTTGTCGGCGCGGAGCTG
+CCCGATGTGCTGGCCTTGGCCTCCGTGGTGATCTCGCGCAGTGGCGCGGGGACGCTCGCC
+GAGCTGACTGCCCTGGGCAAGCCGGCGGTCTTCATTCCACTCGCGTCGGCGGCCGGGAAT
+GAGCAGGCCCACAATGCCCGGCACCTGGAGGAGTCCGGCGCGGCCGTCGCGCTCGTGGGA
+GAGGTCGGCGGGGAACGGCTCCGCGCGGCGGTGGCCCCCCTGCTGGAAGATCCTTTGCGC
+AGGGAGGCCATGGCTGTGGCGGCACGGGCTCAGGGTCGCCCGGATGCGGCGGACAGGCTG
+GTGGACGTGCTGCTGACCGCCGCATCGGAATGA
+>orf00117 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGGTCCGCTCCGCTCGCGCGGAGGTCACCCGCCGAGCTGACCGGGCCAGTCGGCTGC
+TGCGCCGTGGCCTACTCCGTTGAGCGACAGACGAATGCGCCGCATCGGCGGGTCGGCCAC
+GGCGATCCGCGCGGTCATCGCATCACCCACACGAATTTCCCTGGCAGGCTCTGCTGCGAG
+CAGTTCGGAGCTGTGAATCAGCCCTGCAATCCCATTACCAAGATCCACGAAGGCGCCGAA
+CGGCACGACCTTGGTGACCCGACCACTGACAATGCTGCCCACGCGCTCAGCCCAGACCAG
+CCATGGATTTTCCTGCAGGGCGGCCAAGGACAGCACAGCCTGCCCATGCAACTCGGTGTC
+CAGGGCCAGAACCTCAGCACTCACACGCTGCCCCAGCGATACCACTTCATGGGCAGAGGA
+GATCCATTGCCACGAAACCTCGGGCGGAGGAATGAACCCGACCGAAGTCTCCGGCGCTCC
+GTCGAGATCGACGAACACGCCAAAGGTCTCGACCCGGCTTACCATCCCAGCCACTACATC
+GCCTGGGCGGAGCAACTGGAGGAAGTCTTTCAAGACCTTTGA
+>orf00118 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCTCCGGGACCGCCGCGCTCCACACGGCGCTCGTCGCGGCCGGCGTCCAGCCCGGC
+GCCGAGGTGATCGTGCCGTCCATGACGTTCTGCGCCACCGTGCAGACCATCCTCGCCGTC
+GGCGCGACCCCACGGTTCATCGACATCGACGCCACCACCCTGTGCGTCACCCCGGACCTG
+ATCAAAGAAGCGATCACCGACGCCACAACCGCTGTGATGCCGGTGCTCTTCGGCGGCCGG
+GCCATCGACCTCACCCCGATCCGCGAGGACCTCGCCCACCGCGGCATCACGGTCATCGAG
+GACGCCGCGCACGCCTTCGGCTCCCGCAACCCCGACGGCACCGGATTCGTCGGCAGCGAC
+AACTCAGTGCTGACCTGCTTCTCCTTCGGCGCCATCAAGAACCTGACCTGCGGCCAGGGC
+GGCGCCGTCATTCCCCGCACCCCCGACGAAGCGCACACCCTCCGCCGCCTGAGACTGCTG
+GGAATCGAACAGTCCCAGAGCGAACGCGCCGAGACCACCACCTACCAGGTAGGCGGCTTC
+GGACTGCGCTACCCGCTCTCGGCGCTCAACGCCGCGATCGGCCTCGCCCAGCTCGACCAC
+TTCGACGAGACCGCCGTCACCCGGCGCCGCCTCTGGCGCGCCTACCGCACCGCCCTCTCC
+GGCCTTCGCGACGTGCCCCTCATCGACGTCGGCGCCGACCGCGCCGTCCCGCACCTGTGC
+CAGATCCGCGTACCGCGACGGGACGAAGTCTTCGCACACCTGCGCAAGGCGCACATCGGC
+GTCGGCGTGCACTACCCGCCCAACCATCTCCAGCCCGCCTTCGCACCCTGGAGCCGGTCG
+CTGCCCGCAACCGAACAGGCCGGCGAGGAGATCCTGAGCCTGCCCTTCCACCAGCACCTC
+ACCGAGGCCGACATCGCCCTCGTCGTGCACGCCCTACGCGCCGCGCTCGAAGCGACAACC
+ATCACTCCCCAGGCCTAG
+>orf00120 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCTGAGCGAGGCTCCCGCTCTCCCCTTCGCCGACGCCACGATGATCATCTCGACGCGG
+GACGCCGACGCCATCGCCGACGCGCTAGGCGACGTCCGTCCCGCCGGGATCGTGGGAGGC
+GCGAGCGACGCCGCCCTGGCCACCTGGCACACCCTGAGCCAGCGCTACTGCGCCCCCTAC
+GTGTACCCGGAGGGCGCGCTCGCCGCCGGTGACAAGGGAGCCTTCCACGCGATCACCGCG
+TCCTGCGGGGTGAGCGGATACGGGTGGATCGCGTCGGAGGACGAGGAAGAAGTCGTCGCG
+AAGGCAGCAGGGTTGCGCTTCCCGCTCATGATCAAGCCCACGGACGGGTCGGGCAGCAAG
+GGCGTGACCCAGATCGACGCGCCAGAGGAGCTTTCCGGTGCTGTCGCGTACGCCCGCTCG
+TACTCCGCCTCCCGCACCGTGATCGCCGAGGAGTTCGTCCCGGGACGCCCCGTGACCGTC
+GATGTGTTCATGCGCGACGGCAGGGCCGTGATGACCTCCATCAAGGATGAGGACTTCATC
+GACGGGGGCTTCGTCCTCCGGCGAATGCGCACCGCGCAGCTCGCGCCACCCGCCCAACGC
+CACCTCGAAGCCACCGCCGAGCGACTGTGCCGTGCGCTCGGCATCGACAACGGGCCGGCG
+AACTTCGACATGGTCCTCGGCCCGGACGGCCAAGAGCACGTCATCGAGGCCAACGCACGC
+CTCGGAGGAGACGGCATCCCGCGACTGCTCGCTGCCGCGTACGGCATCGACGTCGTACGG
+GCGCTCATCTCCCTCGCCCTCGGACAAGCCTTCCACGACCACCTGACACCCACGCGCGCC
+GCGCACGCGGCCCTGGAGCTGATCGGCTCGCCGCACGCCACGGAAGGCGAACTGATCACG
+TGGGAAGGCATCGCCGAAGCCCGCGGTGTCCCCGGCATCACCGATATCGAGATATACGCC
+AAGCCGGGCGATCTCGTACGCCCCCACGACCAGTCCGGCCACAAGATCGGCATGATCGTC
+GCCGCAGGCGCCACGGAAGCCCAAGCGCTCGCGGCCCTGGAAAGCGCGAGCACCCTGCTC
+AGGCCGATCATCCGCCCCAAGGAGGGATCGTGA
+>orf00121 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGAACATGTGCTCGTCACAGGCGGCGCCGGCTTCATCGGCTCGCACTTCGTGAAGAGG
+CTCATCACGGCTGAAGACGTGGCCCGCGTCACCGTGCTCGACGCCCTCACCTATGCCGGT
+CATGTCGAGAACCTCGGCACGGCCTTCTTCTCCGACAAGCTGCGCTTCGTCCACGGCAAT
+GTGCAGGACGCCGACCTCGTGAACGACGTCATGGCGTCCGGCCCCACCGCCGTCGTGCAC
+TTCGCCGCGGAATCCCACGTCGGCCGCTCCTACGGAGCGGCGAGAGAGTTCCTGTCCACG
+AACGCCCTCGGGACGCAAGTGCTCGTAGACGCCGCTCACCGCCACACCATCGGCAAGTTC
+GTCCACGTCTCGACCGACGAGGTCTACGGCCCGCTCGTCCAGGGGAGCGCCACCGAGCAG
+GCGGCGCTCCGCCCCTCCGTCCCCTACGCCGTCTCCAAGGCTGCCGGTGACCTGGTAGCG
+CTCGGCGCCTACCAGACCCTCGGACTCCCTGTGTGTGTGACGCGCAGCAGCAACAACTAC
+GGGCCGTACCAGTACCCCGAGAAGATCATTCCCCTGTTCCTCACCCGGCTCCTGCGGGGG
+ATGCCGGTGACCTTGCACGACCGGGGCCAGCATGTGCGCAACTGGCTGCACGTCGAGGAC
+AACTGCGCCGGGATCGAGGCCGTCCTGCGCGACGGTAAGCCCGGCGAGGTCTACAACCTC
+GGTGGCGGAGCCGACCTGTCGAGCAAGGACCTGACCGGATACCTGCTCGCCGTGTGCGGC
+GCGACGTGGGACGCCGTCACCTACATCCCCGACCGCCCGGCCAACGACATCCGCTACTCG
+ATCGACTGGGCCAAGGCCCGCGACCAGCTCGGCTACCGGCCCAAGCGCCGCCTAGAGGAC
+GGGCTCGCCGAGACTGCGGAGTGGTACCGCCGAAACCCCGACCGGTGGGCGCCCATCGCA
+CGCGGCAAGATCCCCGCCGTCCCCCTCGCCCGCACCATCCCTTCCGGAAAGGGAAGCCCG
+CATGCCTGA
+>orf00122 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAGTCACGACGCGCTCGCGCTGCGCGTCAACGAACTCACCTGGCATGCCGGAATTCGC
+ACGCAGTACACCAATACGAGTGTTTCCAACTGGGTGAAACGCGGCATGCTCCCCCGCCCT
+CCGACACCCGACTGCATCGCCGCTGCGCTGGGCGAACACCTGGGCCGACCGGTCCACGTC
+ACCGACATCGGCATGAGCGAACCGCGCGGCACGATTCCCGACATAGGGTTGGATTTCCCG
+CGTGAGACCGCCGACGCCGTACACGGCGTCCTCGCCTTCTGGAGACACGTGGACCGCAGA
+GCATTCCTGAACCGCAGTTTCGCCATCGGCGCCTTCGCCGTCCCGGTCACCCGGTGGCTC
+GCCGTCCCCGCCGACGCCGCGAGCAGTCACCACGATGCTGGAGGCCAGCGCGTGGGGCGC
+GAGGATATCGCCCACTTGTGGACCGCCGTCGAGGAGGCCCGCGTGGCGGACTCCCAGTTC
+GGCGGAGGGAACTGGAAGGCGTCCTCCACAGCCGCATGCCTGCGCGAGTACGCCACCCCC
+CTGCTGAAGGGCACCTACACCGAGGAGACCGGCAAAGCCCTCTTCGGGGTCACCGCCGAA
+CTGACCCGGCAGATCGGCTGGTCCGCCTTCGACGCCGGGCACCAGGGCGCCGCCCAGCGG
+CACTTCATCCAGGCCCTGCGCCTGGCGCGCGCCGCCGCGGACGTCCAGGCCGGCGCCTAC
+ATCCTCACGACCATGTCCCTGGCCGCCTTCCTGCGCGGCCACCCGACCGAAGCCGTCGAC
+ATGGCCGAGGGAGCCTACGAGCGCGCGAAAAACCTCCCGAACGCCGAGAAGGTCCTCTCG
+TTCGCGAAACTCGCACAGGCTCGAGCGCACGCCCGCGCCGGGCAAACACGCGAGGCGACC
+ACCGCACTCGCCCTGTCAGAAAACCTCCTCGACCGGACTCGCACGGAGACGGCTCCGGCG
+TGGATGGCCTACTACACCCGCGAGCGCCTGGCCACCGACGCCACCGAGATCTACCGCGAC
+CTGGGCCGCACACACGACGCGCTCACCTGGAGCCAGCAGGCCGACACCATGCCAGCCCAG
+CGCTACACCCGCGCGGTCGGCATCCGGCTCGCGGTGGAAGCATCCGCGCACCTGCACAAC
+AACGACCTGGAACAGGGCCTGGCCGTGGCCGACCACTCAGTGCAGCTCCTGTCAAAAGTC
+CGTTCCGCTCGCGCCCACGGGTACGTCCACAGCCTCACGACCATGCTGGCGACCCGACAG
+CGCGACAAGCGCGTCACCGCCTTCATCGAACACGCTCGCCGGAACCTGCCTGCCCCAAGC
+TAG
+>orf00123 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAAGCTGGACGACCGGCCCGGAGCATCCCCGCGCGTGGGCTCGACTTCTTGGGTGACT
+CTACGCGTCAGCCCATCTGCGGAGCATCCCCGCGCGCGCGGGCTCGACGGTGCGTGGAGT
+TTCGATCTCACCCCGAACGCCGGAGCATCCCCGCGCGCGCGGGCTCGACCCGCCGCTTCA
+CCGGGCGGACGAGTCCCTCTCGGGAGCATCCCCGCGCGCGCGGGCTCGACCCGGAGCGTC
+CACGCCGTGTTCGTCGTGGTGGTGGAGCATCCCCGCGCGCGCGGGCTCGACACGGGCCAG
+ATCGCCGCCCGCGTCGTCGCTCACGGAGCATCCCCGCGCGCGCGGGCTCGACCATAA
+>orf00127 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTTAAGCACTACGGCGGCTAGACGGAGCATCCCCGCGCGCGCGGGCTCGACCATCACC
+GTGACCAACGTCGCCACCGGCGAATCCGGAGCATCCCCGCGCGCGCGGGCTCGACACTTG
+TTGACCTGCAGTTCTACTGGCAGAAGTGGCCTTTTTTATTCAGTTGTTTTTGGGACGGGC
+GGAGAGAACAAGGCCGTCGAAGTCGACCGGTTGCCAGCGGTTGCGGCCTGCGGTGCGGAC
+TGCCCAACCCTGTTCGTTGCGGGCTGGTTCGACCAGGATTGCTTGGCCGTCGCCGATGCG
+GGCGGCGAGGAGTTCCCAGAGGCGGTCTCGGATGCGGCGGCTGGGATTGCCGACGAAGAC
+GCCTGCGCTGGCTTCGATCATCCAGCGGGTTAG
+>orf00129 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCTACCTCTCCCGCATCCGCATCAACCCTCTGCGCACCGCGAGCCGCACCCTCCTC
+GCCAGCCCCCGCGCCCTGCACGCCCAGGTCCAAGGCGGCGTCCCGACCCTCCCGAACGAG
+TCCCGCACCCTGTGGCGCCTGGACGCGGACAACCCCCACCGCCCCGAGCTGTTCGTTCTC
+ACCGCCGGAAAACCCGACTGGACCCACCTCGTCGAACAGGCCGGGTGGCCCGGCGCGGAC
+GGCGAGCACTACGCGGTACGGGACTACGCGCCCCTGCTCGGACAGCTGGCGCAGGGCCGG
+GAGTTCGCCTTCCGCCTGACCGCCAACCCCGTCCAGAACACCAACCGCCCCGACAAGCCC
+ACCGAGCGCCAGCAAGAACGCCTCGACGGCGGCACACGACGCAGCTTCCGCCTCGGCCAC
+CGCACCGCCGCCTCGCAGCTCGGCTGGTTCCTGACCCGCACAGCCCGCTGGGGCTTCGAC
+GTCCCCGCCGCCTCCCACCTGGACGGCACCCGCGACGACCAAGACGAACCACCACGCGAC
+GTGCGTATCAGCACCCGCCGACGCCACTCCTTCGGCAAGCCGACCCGCGCCTCCAAGGAA
+GACCGGGTAATCATGCACATGGTGACCTTCGAGGGAAAACTCCGCGTCACCGACCCCAGC
+CTCCTCACCCAGCGGCTGCTGGCCGGGATCGGCCCTTCCAAGGCGTACGGCTGCGGGCTC
+CTCACCCTCGCCCCTGTGCCCGCGAAGGCGTGA
+>orf00131 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGGGACTACCACACCGTCAGCGACTACCGCGGCCGCCCGCTCCTGGCCGCCGCGGTG
+AACGCCAAGGGCACCCAGAGACTCACCGGCCCCGCCAAGTACACCCACATCACCCAGCGC
+TTCTACCTCCAGGACGCTGTCTTCCTCGCCGCGATCGAGGGCCCGGCGCACTTCATCACC
+ACCCTCGAAAACGCGGTACGCCACCCGGCCTTCCCGCTCGCTCTCGGCCGCCGCTCGTGC
+GTCCCCGCGCAGCCGCTCGTCCTGGGGCAGCGCACCGGACCGCTGGAGGAGGTACTGCGC
+GCGGAACCCTGGCACGTCACCGATGCCGTCCGGAAGCGGTGGGGACGCCGCAACGGCAAC
+GCCGCCCACGTCGACCTGCCCCTCACCCTCGACGACCCGGCCGGCGACGACACGCGCGAG
+GACCTGCCCCTGTCCTTCGCGCCTACCAGCAGGGCCTACACCAGCCGCCGCGTCCGGCAC
+ACCTACGCCGCCGCCCCCACCGGCCTCACACCCCACCCCGACCAGCCGCCATCCACCGGC
+GGCCACGACCCCTTCGCCCTCCTGGGCTGGTGA
+>orf00132 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCCGACATCTGGTGGAAAGCCGACCCCCACGACCTGCACCGTCTCACCGACCGCGTC
+TCCAGCGTCTACGTCGAACGCAGTCATCTCGACCGCGACGAGAACGCCGTCGTCATCATC
+AATAAGCGACAAACCGTCCGTGTCCCCGCCGCCATGGTGGCCGTCATGCTCCTCGGCCCC
+GGCACCCGCACCACCCACGCGGCCATCCGGCTGCTCGCCGACTCCGGCACCACGGTCTGC
+TGGGTCGGTGAACAAGGTGTCCGTATGTACGCTGCCGGCCTCGGCCCCAGCCGGGGCGCC
+GGCCTCCTGCACCGCCAGGCATGGCTCGTCACCCGGCCCAAAGAGCGCCTGGCCGTAGCG
+CGAGCCATGTACAGCATGCGCTTCCCCGGCGAAGATGTATCGGCCCTGACCATGCAACAA
+CTCCGCGGGCGCGAAGGCACACGCGTCCGCAAGCAGTACCACCACCACGCGGAACGCACC
+GGAGTGCCCTGGAACGGTCGCGTCTACGTCGCCGGCGACGCCCACGCCGCCGGCGATGAC
+CTCAACCGGCTCCTGTCCGCCGCCAACGCAGCCCTCTACGGCATCTGTCACGCCGTCATC
+ACCGGCCTCGGCGCCAGCCCAGGACTCGGCTTCGTCCACACCGGCAAAGCCACCTCCTTC
+GTCCTGGACATCGCCGACCTCTACAAAGCCGAATACACCATCCCCCTCGCCTTCGACCTC
+ACCGCCCAAGGACTCACCGAAGAACGCGACGCACGACTCGGCCTCCGCGACCTCATTACC
+CGTGACAAACTCCTCACGCGCATCGTCACCGACGTGAAAAACCTCCTCACGCCCGAAGGA
+GCCGAGTTCGAGGACTCCGAAGCCAACCTCCTGTGGGACGAACAGGTCGGCGCAGTTTCC
+GGGGGAACCAACTACGCCGACTCAGCAGATTTGTCCGTCTACGGAATAGGAGACAACCAC
+ATCGCGGTCATCGGTCCCGATCTCGACGAAACCGGCCCCACCTCATGA
+>orf00133 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCACAGCGCCTTTTCATCGACGTGCACATCGTCCAGACGGTCCCGCCCGCCAACGTG
+AACCGTGACGACCAGGGGAACCCGAAAGAGGCCGTCTACGGTGGCGCACGGCGCTCGCGC
+GTCTCCTCCCAGGCGTGGAAGCGGGCGACGCGCAAGCACTTCGACACCACGGTGCCCGAG
+CCGGACCGCGCGACCCGCACCAGGCGCCTGACCAGCGAACTCGCCAAGCGGATCGTGCGT
+GACACGAAGCTGGAGCGTGACAAGGCCGACCGGCTCGCCGGCGCGTTGTTGACCCGGCTC
+AACCTGAGCCAGGGGAAGAAGGCCAGCGACACCGCCTACCTGCTTTTCTACGGCAACGCC
+CAGCTCGACACGGTCGCCGCTCTCGTCAGCGGGCAGGCCCACGACCTGGCCGCGCTGGAT
+GACGAGAAACTCGCCGCAGAGCTCAAGGACTTGCCCGTCGCCGACGCCTTCAGCACCGGA
+CACCCGGTCGGTGTGGCGCTGTTCGGCCGCATGGTCGCCGACATCCCCAAGCTCAATGTC
+GACGCCGCCGTGCAGGTGGCGCACGCGCTGTCGACGCACGAGACACAGCTGGAGTTCGAC
+TACTTCACCGCCGTCGACGACAAGACCGAGAAGGAGGAGACCGGCGCCGGGATGATCGGC
+ACCATCGCCTTCAACTCCGCGACGCTGTACCGGTATGCCACGGTGGGTTTCGCCCAGCTC
+GCCGACAATTTGGGCGGTGACACCGAAGCGGCCCTCGATGCCCTGGACCGCTTCGTCGAC
+AGCTTCGCCCGCTCCGTGCCCACCGGCTACCAGAACTCCTTCGCCCACCGCACCCGGCCC
+AGCCTCGTCGCCGTCGTGGTCCGCGAGGACCAGCCCGTCAACCTCGTCACCGCCTTCGAG
+GAACCCGTCGTGTCGGAAGCCGGCATCCAAGCCGCGTCGGTACGCAGCCTGGCCCACGAG
+TACGCGGCGGCCCGCAGCGCGTGGGGCGACGTCCCAGTGCACGCGGCGGCGACCCACACC
+TTCGCCTCCGGCAAGCCGGGCGCGACGGAGACCGTGGAGGCGCTCACCGAAGCCTTCGGC
+ACCTCGGTCCCCTTCGACGAGCTGCGCTCGGGCCTGCGCGCGTGCGTCAGCGCCGTCCTG
+GAGGCCCAGGGATGA
+>orf00134 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCGAACAGCGCTCTGCCGCGCAGAGGATCTGGCACCGCCACATCGCCGCGGACGGC
+ACCTGGCGCACCACGAAAGGCACCGCGGCCGCGAAGCGGCCGCCGGGCGAGGACCTCGCC
+GTGCTGCGCCGGGGCCTGACCCGTCCCGCCGGCACCGTGCTGGAGATGTTCCCCTTCTAC
+ACCTGCCCCATCGACGACTTCGCCGCCCGCAAGGGGCAGATGTCCGCCGAGCAGGAAGCC
+GAGCACATCGCGCTCGCCCTGTACGGCCTGCACCAGCAAAGCCAGGACCGTCCCATGCAC
+CAGCCCGGCGTCGGGCTGGGCCGGGCGATGCTCGTGTTGCGCGGCCACGACAAGACCAGT
+GCGGACGCGGTCGACCGGCGTTTCCAGCAGACCTTCTCCACCACGTCCCTGACGGCGCTG
+CAGAGCCGGCTGCGCGGGCTGGTCACCCAGCTCAAAGACATCAAGTGCCCGCTCGACTAC
+GACCGCCTGATCCTCGACGTCCAGGACTGGAGTCGCCCCGCAACGCGCTCACGAGTGCGG
+CGGCGCTGGGGCCTGGACTACTACGGCTGGACCCAGCGCTCCAAGGAATCGTGA
+>orf00135 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGGGTTTGGGTTTTCCCTGCTCGAGGAGCGGTGGCTGCGTGTGCCGCCGGCGGTCGGC
+GGTCTGGCGCGGGAGCGTTCGCTGAGTACGGTGCTGCTGGACGCGCACGAGTTCGGGGAC
+CTGGCGGTGGAGAGTGCCACCCAGCGGCCGGCGGTACTGCGGCAGCTGCTTCTTCCGGTG
+GTCGTCGATGCGCTGGGCCGTCCCGCTGACGAGCGGGAATGGACGCAATGGTTCGCCGCC
+GGGCGCTGGACGCCCGAGCAGCGCGCGCGGCTCACCGCGTATCTGGACGCGTACCGTGAG
+GCGTTCGGTCTCTTCGATCCGGTGCGGCCATTTGCGCAGGTGGCCGGGCTGCACACCCCG
+AGGGGGGAGACGAAGAATGCCGCCCTGATCGTGCCGCACGCGGCGACCGGGAACAACGTC
+CCGCTGTTCGCCTCGCGTACGGAAGGGGACGTGTTCGCTCTGACGCCGGCGCAGGCCGTG
+CTCTGGCTGCTGCACACCCACTGCTGGGATACGGCGGCGATCAAGACCGGGGCGGTCGGC
+GACCCGCAGGCGAAGGCGGGCAAGACCACAGGGAACCCGACGGGCCCGCTTGGCCAGATG
+GGCGTCACGCTCCTGGCGGGCAGGACCCTGTTCGAGACGCTGCTGCTGAACCTCCCCGTG
+GGCGCCGCTCCCGTGTCGGCGGATCTGCCGCAATGGCGGCGACGGGATGCCGAGCATCCG
+CTGTCGGCCGGGACGCCGCGCTGGCAGGAGCGTCTCCCGCAGGGGCTGCTGGATTTGTGG
+ACCTGGCAGTCCCGCCGGGCCCTGCTCGTTCCCGAGGCCACCGAGGAGGGCGTGCGTGTG
+ACGCGAGTCCTGGTCGCGGCCGGGGACCGGATGCCGTACACGCCGGAGATCGAGCCGCAC
+ACCATGTGGCGCACGGAACCCACGGGTGGCCGCAAGCCCGCCAAGAACAAGGGACGCATT
+GTGCCGCCGCGCCGGCCGTTGCGTCTTCAGCCGGGGAAGGCCGTGTGGCGGGGCCTGGAC
+GCGCTCCTCGCCACGGAACGTGCGACGCGGGAGGCGGGGGAGGGGACGAGCGGGTTCGTG
+ACGAGCAAGGTACTGGATCAGGCCGGAGGTCTCGTCGCCGAGCTTGGTGAGGGCTACCCG
+CTGCGGGTGGAGCTCACGGGTGTCGCCTACGGCAATCAGTCGGCGGTCGTCGACGACGTC
+ATGCACGACGCGCTCCCCCTCCCGCTGGCCGCGCTCGAGGTGGACAGCTTCGTCCGCTCC
+GCTCTGCTGGAAGTGTGCGAGCAGGCGGAGCAACTGGCCGCCGCCGTCAACCATCTCTCC
+GCCGACCTGCGTCGCGCGCTTGGCACCGAGCCCATTCCGTGGGACCGGGGCCAGCGTCCC
+GGCGAACTCGTCCTGCACGCCCTCGATCCGCTGGTGCGGCGGCTGCTGGCCGGGATACGG
+CATGTGGACGACCTCGAACGTATCGATGCCGGGCAGCTGGCGTGGGAGCAGCTCGCCTGG
+AGCCGGGCCTGGGCGGTCGCGGACCGGCTGCTCCAGGCCGTACCGGTCAGCGCGTTCGCG
+GGCCGGAGCACTTCTCAGGGGGAAGGGAAGCCTGAGCGGACCCACCGTGTCTCGCTCGCC
+GAGTCGTTCTTCCTCAAACGCCGCGCGGAAATTTTGCACCGGGCCGCCGCTGCCCGGCGC
+GAGAGCACCGCGGGCGTCGCAGAACCGGCCGGCCTGCCCACCGCATCCTGA
+>orf00136 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGAAACCTTCTCTGTTTAACCTACGCACACCCACCACGCGCGCGGGCAGGTTTCCCGCA
+ATCCGATGCGAGAATCCGTTGACCGACAACCGACCCCACCCCTGGCGCTGTCCGCGGGGA
+TGA
+>orf00138 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTTCCGGGCCGCTTCGAGGAGACAGGCAGCATCGCCCGGTTGCCCCCGCGCCTGCGGG
+ATCCTCCAAGCTGGACCTCATATGGCAGGACCCGTCTGGCGTCGACCCCGCGCACGCGGA
+GATCCTCCGTTGAGGCCGCAGCCGGGCATCCACTCGCTCAGGTCGCGGGTACCCTCCTAC
+CCGTCGATCCACCGGTCGTGA
+>orf00139 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCGCCGCGGCGGTGGGGGGGTGGGGGCCTGCGGGTGCGGGTCAGCCCATCTGGGTTC
+GGGCGGTGCCCTTGTATCACGGGGTCGGGGGTGGCGGGTGTCGTTTTGGTGATTCTCCTT
+ATCGTTTGTGCAGTTCAGAGGGTGTTGTCGGTGGTGCCGTTTACGATCCGGTTCTCGAAT
+TCGTGTGTGAGGTGGGGGTTTTCGGTGGATGTGAATGAGCTGGCGTTGAGGTACGGCGCG
+GCGGTGGTGCGGGGGCTGGAGACGTTGTGGGGGAAGTCGCGGGAGAGGGCTGCGGGGAGG
+ACGAGTCTTCTGCTGGGGCATCTGCTGGATACGGCGGCGGTTGCGGAGCTGATGTGGGAG
+GAGTTCTTGGCGCCGGCGACGCGTTCGGCGCTGGATGAGGTGGCGGGTGGGGTGGGGTGT
+GGGCGTGGGTTGTTTGTGTGGTTGTGCGCGGTGCATGACTGCGGGAAGGCGACGCCTGCG
+CATCAGCGGTTGTGGGATGAGGGGGCTGAGGCGGTTCGTGCTGCTGGGTTGACGTGGCAC
+GAGCCTTCGGCTGTAGCGGGGGCGAAGCAGCGTTGGCGGCACGACTGGGCCGGTGGGCTG
+ATCGTTCGGGAGTTGCTGGGGGAGGTGGGGTGGAGTGGCGAGCAGGTGGACTGGGTGTGG
+CCGCTGGTCGCCGGTCACCACGGGGCTTTCCCGACGCTGAAGGACGTGCGTGAACCGGGG
+TCCGCGAAGCGGCAGTTGCGCGGGATCGGGGTGTGGCGGGAGGTTCAGCGCGCACTGCTC
+GATGTGGTCTCGCGCGAGGTGGGCTTTGCGGGGCCGGCGGAGGTGGAGCCTGTGGTTGTT
+CCGTCGAGGGCATTGCAGTTGCAGGTGAGTGGTCTGGTGGTGATGGCGGACTGGATCGCG
+AGCGACGAGCGGTACTTCGGTGGGGTCGATGACCTGCGAGAGGTGAGTGCGGAGGGTTCT
+CGTCGGCGGGCCGCGGGGGCGTGGAAGGCGCTGGGGCTGCGTGGTGGCTGGGGTGAGCGG
+GGTGTGCCGGGGCGGGAGGTTTTTGCGGGGCGGTTCGGGTGTGTGCCGCGGCCGGCGCAG
+CGGATGGTCGTCGACGCGATGGGGGATATGGGGGGTGCGGGGCTGGTGGTGGTGGAGGCT
+CCGACGGGGGAGGGGAAGACGGAGGCGGCGCTGTTCGCCGCGGAGGTTCTGGCGGCGCGG
+TTTGGTGCGGACGGTGTGTTCGTGGGGATGCCGACGCAGGCGACGAGTGACCCGATGTTC
+TCCCGGGTGCGTGGGTGGCTGGGGGCGGTTTCGGAGGAGTTCGCGTCGCGGGTGGTGCTG
+TTGCACGGCAAGCGGGCGTTCAACCGGGAGTGGAAGGGGCTGGTGGAGGAGGGGGCGGGG
+GCGAGGGAGGCCTTTGGTGGGGTGGATGAGTTCGGTTTGGCTGGTGATCCGTTCGGTGTG
+AGCGGGGAGGGGGGTGGGGAGCTGGAGTGTCAGGCTCTGGTGGAGTGGTTTTTGGGGTCG
+AAGCGGGGTCTGCTGGCTCCGTTCGTGGTGGGGACGGTTGATCAGCTGCTGTATGCGGCG
+ACGCGGACGCGGCATGTGATGTTGCGGATGGCGGGGCTGGGCGGGAAGGTCGTGGTGCTG
+GACGAGGTGCACGCGTGCGACGTGTACATGAGTCAGTTCTTGCACGAGGCGTTGCGGTGG
+CTGGGGCAGGCGGGGGTCCCGGTGGTGGTGCTGTCGGCGACGCTGGCCCCGGCGCAGCGG
+CGGGGCTTGCTGGAGGCGTATCTGGCGGGTGCGGCGTCCGTGGAGGAGTTGCGGGTCGAG
+GTGCCGGCCGCTGAGGGGTATCCGAGTGTGACGACCGCGTGGTCGCCGGCTGGGGGCGAG
+CCGCAGATCCGGGTTCGGGCGACGGGTAGCTGGCGGGCGGATCTCGGGGTTGAGGTGCGG
+GTGGTTCCTGAGGCGGTTCCGGGGCGGGGGAGTTCGCGTGAGGAGCGGGAGCGGGCGCAG
+GCTTCTGCGGATGCGCGGGTGGGGGAGTTGCTGGCCGGTGAGCTTGCCGGGGGTGGTACG
+GCGCTGGTGATCCGTAATTCGGTGGCGCGGGCGCAGAGCCTTTTCGAGGAGTTGCGGGGG
+CGTTTTGGCGGGGATGAGGTGCGGTTGCTGCACGCGCGGTTCACGGTGGCGCGGCGTGCG
+GAGCTGACGGAGGAGTGTTTGCGGCTGCTGGGGCCGGGGGCGGGGCGTTCGCGTTCGGGG
+CGGTTGGTCGTGGTGGCGACGCAGCTTGCGGAGCAGTCTTTCGATGTGGATGCGGATGTG
+CTGGTCACGGATGTGGCGCCGGTGGATCTTTTGTTGCAGCGCGTGGGGCGCTTGCACCGG
+CACGAGGGCACGTGGAGGCCGGAGGGGCTGCGGGTTCCGCGTGTCTTCGTGACGGGTTTC
+AGTCCTCGTGAGGGGCGGGAGCCGGAGTTCGTGTCCGCGAGTGAGGGGATCTACGGGCGT
+CATCTGCTGTTGCGGACGGCGGCCGTACTGCCCGGTGCGGGTGTGGGGGCGAAGGCGGGT
+GCGGGCGGGGTGTGGCCGGTTCCGGGGCGGGTGCCCGCTCTGGTCGAGGAGGTGTACGGG
+GATGAGGAGTCGCTCTTGCCCGAGGGGTGGCGTACGGCGGGTGAGGCGGCCCGGAGCGAG
+CAGGAGACGCAGGACCGGGAGCGGGCGCAGAACGCGCGGCAGTTTTTGCTGACGGGGCCG
+GGTGAGCACGAGCGGCGGACGCTGGCCGGGTTGCATTACGGCGGGGGGACGGCGGGCGGC
+GGTGAGGACGCGTTGCGGGCGGCGGTACGGGACGGGGACGAGTCCGTGGAGGTCGTGCTC
+GTGCGCCGCGACGGGGACGACGGAGCGTTCCGGACGCTTGCGGGGCGGGCGCTGAGTGTC
+AACGGGGACGTGGCTCCAGAGGTGCTGGAGGAGGTACTCGGTTCCGTGGTGCGGCTGCCC
+GCGAAGTTCACCAAGGCGGCCGCAGGGCTGGCGCCGCTGCCGGGCTGGCACGGGCATCCG
+TGGCTCGGCCGCAGCCGTGCTCTGGTGCTGGACGCCTCGGGTAGGGCCCGGCTGGGCGAT
+TTCGCGGTGGCGTACGACGGCGTGCTGGGGTTGCGGCAGGTATGA
+>orf00141 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGGATCAGTCGCGCCGCCGAGCGGCTTTCGGGGGTTTTCGGGGGTTACGGTGTTGAC
+GTGGAGGGTGAGAGCTGGTGGGGGCGAGCTGTTGTTTCTGTTCTGGGCTCAGTAGCCGGC
+CGGAAAGCAACTGAAGGAAAACCGGCAGACCGGCTGGTATGA
+>orf00144 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCACTGGTCCTCATCCCGACCGACACCGTGGGAAGATCCCCGCGTGCGCGGGGCCGA
+CAGTTCGAGCGCGGGCGAGCGGCCGTCCTGCGTCGGAAGATCCCCGCGTGCGCGGGGCCG
+ACCCGTGCACCTGATCGGCGAACAGCTCACGACCAGGAAGATCCCCGCGTGCGCGGGGCC
+GACACCTTGCCCCTTGTTGTCACGCCGACGCTGGTTCGGAAGATCCCCGCGTGCGCGGGG
+CCGACGTGCCGTTCCAGATGCTCTACCGGCTGTGGGACGGAAGATCCCCGCGTGCGCGGG
+GCCGACGCCCGCTCGAGCGCGGCCTCGCTGAACGAGACCGGAAGATCCCCGCGTGCGCGG
+GGCCGACGCGCCGACGCGCCGCCAGGCGGCCCGCAGACGCGGAAGATCCCCGCGTGCGCG
+GGGCCGACCCGTTGA
+>orf00145 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGGGTCGACGCCCGCCGTGCCGAGCCGGAGGCACCCGGCCTGGGAAGATCCCCG
+CGGGCGCGGGGCCGACCACCTCCCTCGCTTCGGCCTCGCGGAGGCGATCGGAGGATCCCC
+GCGGGCGCGGGGCCGACCGGAGCCGACTCGGCGGACAGGTACGGCTTGTCCGGAGGATCC
+CCGCGCTCGCGGGGCCGACGCGCCGACGCGCCGCCGCGAGGCGTGCAGCCGCGGAGGATC
+CCCGCGTGCGCGGGGCCGACCGGTGGAGCCTGCGACGACTGCCCCTGA
+>orf00146 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGCGTCGGTGTTCCCACCGATCGTTGCCCCCGCGCCTGCGGGGATTTTCCGGACCTC
+TTCGAGTCGTTCGCCGCCCTCGCCCGGTTGCCCCCGCGCCTGCGGGGATTTTCCCTCACC
+AGCTACGACCGTCCCACCGCCCGGAACGTTGCCCCCGCGCCTGCGGGGATTTTCCGAGCA
+GCCGCAGACCACCGACGTGTGGAACGTGGTCGCCCCCGCGTCGGCGGGGATTTTCCGTCC
+ACCCCCGCCGCCTCGGCCCCGGACATGTGGTTGCCCCCGCACCTGCGGAGATGCTCCGGT
+TCGGTGGGCGGAGTGCCACGGCTCGATCGGGGCCGGGTTGTCGCCGTGTTCGTTGGTGTC
+ATCGCCTATGGGCTTCTCCTCTTCTTGGTGGATGAGGTGTTCTGCGTCCCGAGTGGGGCG
+GAAGTCGTAGGTCACTCTGGGCTGCACGGCCCCTTCTCAGCGTAG
+>orf00149 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGGTGCGAGACCACGCTCCAGCCCGGCATCGACGACATCGACCTCGGCGCCCGCCCC
+GCCACCCGCACCGGGCCAGCCTGGTTCCCCCGCGGCTGCCGCCGCTGCTGCTACGGCAGG
+GACGAACGATAA
+>orf00151 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGATCTGCGGCAGCCCCTATCGCAAGCCCGTGCACGCCGCGACCTACGGGGCCGGGCGC
+AGGAGGCGCAGCATGACCTCGACTCTCCTCCCGAGGGCCCACCCCGGGTGCGCATGGCTG
+ACCGAAACCCTGCTCGACCCGTCCCCCGCCTACGCCGACTGGCAGCGGGAACGGCTCGCG
+CCGGTGCCCTCGACGGGAATCTGGCGGGTCGTCGAGGCCCCGCTCTACCCGTCGATCGAC
+GCCTTGTGCGTGCTCCGGATGAGCGGCAACGCCGGTCCCGTCCAGGGGTCCTCCGACGCT
+CGCCGCGCCTGGTGGCTCGTGGCCGCCGGGACCGCGACCCTCCTCACCGACGTCCCGGGC
+ACCCTCGCCCACCCCGCCGGGTGGGTGCTCGACTGCCCCGCACCCGGCATCGGCGCCGCC
+GGGCGCACTTGGCTGCACCCGCCCTACGGCACCGGTCTCCTCACTCCCGCACGCCTCCTC
+CGTGAAGCGCTCCTCGACGCGCGGGAGATGGAGGTGATGGAGCGGTGA
+>orf00152 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCGTTACGGTTCATCGGGATCGACCCGAACACAGGAGACAAGGAGAGCCCGACCGTC
+TGGGTGGACGAGGAGCACAGCGAGCTGGTCTTCCAGGGCTGGGTGCCGTCACCGGCCCTG
+GAGGCGGAGTGCACGGCCACGGAGGTACCGGGCCACGCGAAGGGGATTCCCGAGGGGGAA
+GCGGTCGTCCGCATCCCGGCCCGGATGGTGGAGATGGTGAGGGAGGCGTGCGATGCCATC
+GAGCAAGCCCACGTTCGATGA
+>orf00153 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGCGACGCCTACGCCGTGGACTACGAGAAGGGTCCCTTCGCGGACTGGCGCGCCGGA
+CACCGGCTCAACCCGGCGGAACGCGAGACCTGGTGGCGTCCGTGGCTCGACCTCATCAGC
+GAAACGGTCGACCGCGGCGCGGAAGTGCGGCGCGCGCGGATCGTGTCCGAGCCGGTCAGC
+GAGTACACCCGCTTCCTCTACGACGGCACCTTCACCAATGTGGCCGCCGGGGAGCAGGTC
+CGCTGGCTGCCCCGACGCCAGGCATCCGACATTCCCCTGCCGGGCAATGACTTCTGGCTC
+TTCGACGGCGTGTGGGTGCACTGGAACCACTTCGCCGGGGACGGGTCATCGCTCGGCGCG
+GAGATCACCGACGATCCCCGCGCGGCGGCTGTGTGCCGTGACGCCTTCGAGCAGGTGTGG
+GAACGAGCTACACCGCACGACGAGTACAAGATCCGCTGA
+>orf00154 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCCGAGCGGCTGCGCGACCTCCGCCGAGCCGCAGGGCTCACGGTGACAGAGCTGGGG
+GCGGCGTGCGGCTGGCACCACGCAAAGACGTCCCGGATCGAGAACGCCCGTACCGCGCCC
+TCGGCCAAGGACATCACCGCCTGGTGCCGTGCATGCGGAGTTGAGGCGCTGACCGGGGAC
+CTGGTGGCGCAGTCCCTCAACGCCGAGTCGATGTACAGCGAGTGGCGCGACCAGATGCGG
+GGCGGAATAAAGCGCCTCCAGGAGTCCTTGACGGACTTCTACCGGGAGACGCGCCTGTTC
+CGGGTCTACTCCTCCACGCTCATCCCCGGGCTGTTGCAGACGGAGGGATACGCCGCGGGC
+CTCCTCACGGCCATCGCCGACTTCCGCCAGATCCCGGTGAACGACGGGGCGGAGGCGGGC
+GCCGCCCGGGTGGCCCGGTCTCGGGTCATCTACGAGCCCGGCCACCGCTTCGTCCTCCTG
+ATCGAGGAGGCCGCCCTCTACTACCGGATCGGCGACGACGAGGCAATGGCCGCCCAACTC
+GGCTTTCTCCTCACGGCTGGTGCCCTGCCCGCCGTGTCGCTGGGCATCGTCCCCTCGTCG
+CACCCACAGCGTCGGCAGTGGCCGCACGAGACGTTCCACATGTACGACGACGCCTTCGTG
+TCGGTCGAACTGCTCTCCGCGCAGGTGAAGCTGACCCAGCCCTCCGAGATCGCCCTGTAT
+TTGCGGGCGTTCGAAGAGCTGCGGAGCATGGCCGTCTACGGCGCGGACGCGCGCGCTCTG
+GTCGTGCGGGCGATCGACGCGTTGCGGTAG
+>orf00157 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACGCACGGCTACGAGGACGAGTGGGGGCCATCCCCGCGCGTGCGGGGACCATTCGAT
+GTGGCAGTGCTCGCTCTGCGGCACCTGGGGGCCATCCCCGCGCGTGCGGGGACCATCCGC
+ATCCGTGAAACCCGAGAAGGCGACCTTCGGGGCCATCCCCGCGCGTGCGGGGACCATTTC
+GACTTCCGGCATGTCGCTGACCTGCTGTTTGGGCCATCCCCGCGCGTGCGGGGACCATAC
+CGTCTGGAAGTCCTCGTCGGGGGTGTCCATGGGGCCATCCCCGCGCGTGCGGGGACCATC
+AGCACGGGCATCCCAGGCCACGACCGAGCGTGGGGCCATCCCCGCGCGTGCGGGGACCAT
+ACTTCGTGA
+>orf00158 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAACGTCTACAACGGCGGAGGATCCCCGCGGGCGCGGGGCCGACTTCTGCGAGAAGGT
+CGCGCAGCGCTTCGCCCGCGGAGGATCCCCGCGCTCGCGGGGCCGACGCCGATGAGCGCG
+GTGGCGGTGGAGGCCGCCGTGGAGGATCCCCGCGTGTGCGGGGACCATCCCACGGTCGTC
+TTACCGACGGACCCAGCCCGGGGGCCATCCCCGCGCGTGCGGGGACCATAG
+>orf00160 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGTTTCGGGGGTTACGGTGTTGATGTGGAGGGTGAGAGCTGGTGGAGACGGGCTGTT
+GTTTCTGTTCTGGGCTCAGCGGCCGGTCGGAAAGCAACTGAAGGAAAACCGGCAGACCCG
+CTGGTATGA
+>orf00164 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCTGCCCGGAGGATCCCCGCGCTCGCGGGGCCGACTACAGCTCCGTCCCCGAGATGT
+GGAGCTTGTACGGAGGATCCCCGCGCTCGCGGGGCCGACACTTGCTGA
+>orf00169 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGCGGGGTCGACTCCACCAGCGAGATGACCGCGAGGGGAGAGTCCCCGCGGGGACGG
+GGCCAACGAGGCGGTGCTCCTCGCCGTACGACGTACTCACGGAGGATCCCCGCACACGCG
+GGGCCAACTTCAACCGCGCCGACGAGCCCGGCCGGGGCGGCAGAGGATCCCCGCGCTCGC
+GGGGCCGACTTCGCACCACCATCCTGTCTCGTCTCGACGCCCGGAGGATCCCCGCGCTCG
+CGGGGCCGACTCGAGCACGGTCACGGTGTCGTGCTCGCTGAACGGAGGATCCCCGCGTGC
+GCGGGGCCGACCTGGCCGAGACCCTCGCGACCCTGTCCCTCAAGGGAGGATCCCCGCGAG
+CGCAGGGTCGACCCGCCCCTCGCCACCCGGCCTCGGGAAGACCGGGGAGGATCCCCGCGC
+ACGCGGGGCCGACGCTCATCCGCGCGCCGGGCCAGACTCACGCGCGGGGAGGATCCCCGC
+GCTCGCGGGGCCGACCTAGGCGGCGGTGAGCGTGCGCTCGGTCAGGGCGGAGGATCCCCG
+CGCTCGCGGGGCCGACGCGAGCCGGAACTCGCCCGCCTCCGCACCGAGCGGAGGATCCCC
+GCGCTCGCGGGGCCGACAGGGCCCCCGCCAGAGTTCCTCGGAGAGCACCCGGAGGATCCC
+CGCGCTCGCGGGGCCGACCGCCTCGAAGTCCACGCCTCCCCGGACAGCGGCGGAGGATCC
+CCGCGCTCGCGGGGCCGACGTGGTCGAACACGATGTGCGCGGACAGGTCGAGGGAGGATC
+CCCGCGCTCGCGGGGCCGACGCGGGGCGGACCTGCATCCGGGTGCCGTCCGGAGGATCCC
+CGCGCTCGCGGGGCCGACCTCGTCGGTGACCGGGATGTGATCCCATCCCCAGGAGGATCC
+CCGCGCTCGCGGGGCCGACTGCATGGCCCGGTCGGCCGCGCGAAGGGAGAGCGGAGGATC
+CCCGCGCTCGCGGGGCCGACCGGCCGCCGTGGCGCCGCCATAGCCTCCTCCACGGAGGAT
+CCCCGCGCTCGCGGGGCCGACGATACCCAGTCAGGAGACGTCATGGCTCTACACGGAGGA
+TCCCCGCGCTCGCGGGGCCGACCGGGGTCCCGGTGGTGCTGTAGCCGCCAAGCTCGGAGG
+ATCCCCGCGCTCGCGGGGCCGACGAGCTCTGGGAGGACAAGGACGCACTGGGCAAGGGAG
+GATCCCCGCGCTCGCGGGGCCGACGCCGTCGCGGCGTTCCTCACGGTGCAGGCGACCCGG
+AGGATCCCCGCGCTCGCGGGGCCGACGCATCGGGTCCCCTGTTCGGGGGCGACCACGGCG
+GAGGATCCCCGCGCTCGCGGGGCCGACTCCTGGGGAGATGAGGTGGTGCACGTCAAGGAC
+GGAGGATCCCCGCGCTCGCGGGGCCGACGGGCGCTACCGCCTCGGGGAGACCTTGCAGAG
+CGGAGGATCCCCGCGCTCGCGGGGCCGACCACTCGCCCCTGGTGA
+>orf00172 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCATCAAACGTCCCGCAGAGGTTGTTCCCTACCAGCACTTTCAAAGACTCCCCTTG
+AAATTATTTTTCATCGAGACTCTGAATTTCTTTTTTCCCGGCAAGCGCAAGGGGTTGTGA
+>orf00174 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCAACGACCCCTCGTGTGTGGCGTTTGGCCGACTACGAGCAGACCCAGATCATCAGC
+TGGAGCTGCAACTCCATCAGGCTGACGATGAAGGTCCATAGCTCGTAG
+>orf00175 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAGTTCGGTGCGGCGTTCCCAGCGGACGGCGAGGCGTTTGAACTGGTGGAACAGGGC
+GATGGTCTACTCAACGACGTAAGCGGAGTTTGCCCAGGCCCTTGA
+>orf00178 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCACTCCTCAACGCCGTCGTCGCCGACCCCCGCGCACGCGGGGATCTTCCGGAGTTG
+GCGTTCTGGTCTGCGGACCGGAGGGGGCCGGCCCCGCGTCCGCGGGGATCCTCCGCGGCA
+GACCGCCGACGCCGAGGCCGTAGCGCAGTCGGCCCCGCGTCCGCGGGGATCCTCCGCGGT
+ACGTCAGGTCGTTGGTCGTCGCGTTCGGGTCGGCCCCGCGCTCGCGGGGATCCTCCGGCC
+ACGACCTCGGCGGCGGCCAGGATGAGGACGTCGGCCCCGCGCTCGCGGGGATCCTCCGTT
+CACCTGTCCGCTCTTCTGCCCGGCAACCTGGTCGACCCCGCGCTCGCGGGGATCCTCCTT
+GCGAGACGCCTCCTGCACGTCCCCGAGCGCCGTCGACCCCGCGCTCGCGGGGATCCTCCG
+CGGCTGATGGTGGAGGGCGGTGGGACGATCCAGTCGGCCCCGCGCTCGCGGGGATCCTCC
+TCGTCGGCGGGAAGTCGTGAGGACGTGACGGGAGTCGGCCCCGCGCTCGCGGGGATCCTC
+CGGCGGCGACGGCGCGCTCCAGGCGCTCTCGCTCGTCGGCCCCGCGCTCGCGGGGATCCT
+CCGTCCATCTACGAGGACACCGCCGCGCACGTCCTGTCGGCCCCGCGCCCGCGGGGATCC
+TCCCGAGATGAACCGGTCCGCCGCGCCGAGCCCGGCCGTCGGCCCCGCGCTGCGGGGATT
+CTCCCTCCATGCCCGGTCAACGCCCGACCCCCGACCGGACTGGCTGGAGCACCGGCGAAG
+TCGGTGGCCGAACACCGCGAATCTCCACCTGCTGATCAACAACGAGACCGCCACCAAGAC
+CAGCCGAGCCAGTAA
+>orf00180 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACGTCGACCGAAGCAGCAGCAATCGCTCTACAGGACCATGCCGCCCTCTGGAGCATG
+GGGGAAATCCGTGCGAGCGATGTCGTCAATGCCGCCTGTGAGGCGCTCGTCGCCGGACTC
+GACACCCCCGGCCTTCGAGTCCTCGCCGCCTGCACACGCGCCGAGTCGGACTACGACGTC
+CACGAGTTGCTTCCTGAGGCACTCAACGAACTCGGCCTCACCTTTTATCCCATCGCCAGC
+GATGCCGGCCAAGAAGCCGCTGCCCGAGCGCTCGCACGCCGCATGCTCGCGGGTGAGCTG
+ACACCTCGGGAGTTCACAGTCCGCATTCACCAGCGCTACGGACATGAGCTGCCACTGACT
+GAGCGGCTCGCCGAACTCGATGACGAGTACGACGTCCTCGAATACGGCGACGGAACCGTG
+GACCACGTTGATGTCGAGGTCACCGCCGAAGCGCGCCGCCTCGCAGCCCACCCCCACGTT
+CCAGCCGAATCCACGGACACGCCCAGCTGA
+>orf00184 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGGGCCGACATCACGGAGGGTGCCCCAGTGCGCGTGGTCGGCCTGACGCTCCGC
+GTGCGAGAAATTGAGGGCCTGGCTGGCGAGGGCTTGGCTCCACCACCCGGAGCATCCCCG
+CGTGCGCGGGGCCGACGGGACGTAAGGGCTGCTCACGGAGCATCCCCGCGTGCGCGGGGC
+CGACGTGCGGGATGTGGATACTCATGCCGCCACCGCCGGAGCATCCCCGGGTGCGCGGGG
+CCGACGTATGCGGGAGCTGCGGGCGGACGGATGGCCCAGGAGCATCCCCGCGTGCGCGGG
+GCCGACCTCGCTCTCGTCCTCGACGACGGCGGGGAGACCGGAGCATCCCCGCGTGCGCGG
+GGCCGACCCCACGCCGGTCGAGAGCGGCGCTCCACCACCCGGAGCATCCCCGCGTGCGCG
+GGGCCGACGGGACGTAAGGGCTGCTCACGGAGCATCCCCGCGTGCGCGGGGCCGACGTGC
+GGGATGTGGATACTCATGCCGCCACCGCCGGAGCATCCCCGCGTGCGCGGGGCCGACCTC
+GCTCTCGTCCTCGACGACGGCGGGGAGACCGGAGCATCCCCGCGTGCGCGGGGCCGACCT
+CGGATCAGACTGGTCATCCGCTCCGGCATCAGGAGCATCCCCGCGCTCGCGGGGCCGACC
+GCGACGGCTGGGGACCCCTCGATGCCTGGTACGGAGCATCCCCGCGCTCGCGGGGCCGAC
+GGCTCTCTCGGGGCCACGGCTCCAGCTCCTCTCGGAGCATCCCCGCGCTCGCGGGGCCGA
+CGACCGCCACACCTATGCATCACGACCCGAAGGCGGAGCATCCCCGCGCTCGCGGGGCCG
+ACGGCGCCGGGACCTCGCCGAACGACCCGGACGACGGAGCATCCCCGCGCTCGCGGGGCC
+GACCTCCTCTCCCTGGCCGAAGTCCTCTTCGCGGTCGGAGCATCCCCGCGCTCGCGGGGC
+CGACTGGTCGTTGCGCAGGATGGAGATGACCAGGCGCGGAGCATCCCCGCGCTCGCGGGG
+CCGACCGGGAAGGGCCGGAGGGCGCAATCCCCCGGCCCGGAGCATCCCCGCGCTCGCGGG
+GCCGACTGCGGACGCCTTGTAGTTGACGTGCGCGACGCCGGAGCATCCCCGCGCTCGCGG
+GGCCGACGCGCTTGGGCTCACGAGCAGCTTCGTCGTGGGCGGAGCATCCCCGCGCTCGCG
+GGGCCGACACTTGCTGACCTGCAGTCATACCAGCGAGTCTGCCGGTTTTCCTTCAGTTGC
+TTTCCGGCCGGTCGCTGA
+>orf00186 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGGGCCGACCGTGGTCCGGCTGCCCGAGGAGCAGCGCGGGGAGGAGCATCCCCG
+CGTGCGCGGGGCCGACGGCCAGAGCAGCGCGTCGACAAGACCCCGCAGCGGAGCATCCCC
+GCGTGCGCGGGGCCGACCGTCGGGGCGGGACGATGTGGCCGCAGTCCGGCGGAGCATCCC
+CGCGTGCGCGGGGCCGACTGCGAGAGGCGGCTGGTGATGCGCTGGCCGAGCGGAGCATCC
+CCGCGTGCGCGGGGCCGACGGCCCATCGCGGGCCAACCCCAGTGGAACGGCCGGAGCATC
+CCCGCGTGCGCGGGGCCGACCTGCAGCGTCCGGTCATCGTGCGCGTAG
+>orf00190 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACGACCAGCGCCCTCGTGCCGGTCGGAGGATCCCCGCGCATGCGGGGACGACCCGGG
+GTGAGGGTGTCCGTCATGACGTGCTCTCGGAGGATCCCCGCGCATGCGGGGACGACGTCG
+CGCGGGCGCGCAGCCATTCCAGCGCCCGCGGAGGATCCCCGCGCATGCGGGGACGACGGC
+CAGCTGCGAGGCGCAGCTTCGCGCGCACAGGGAGGATCCCCGCGCATGCGGGGACGACAG
+CTCGACACGGGCGGTGATGGCGTTGACCAGCGGAGGATCCCCGCGCATGCGGGGACGACG
+TTCGTGCACGCCGAAGGCCCCGTACGCAGAACGGAGGATCCCCGCGCATGCGGGGACGAC
+CGGATCAGGTTGACGTTCTTGATGCCGTTGGCCGGAGGATCCCCGCGCATGCGGGGACGA
+CGTGACCTCCTCCAGGGCGGCCCGGGTCACGGCCGGAGGATCCCCGCGCATGCGGGGACG
+ACCCACTCCGGCTCGCGCGGGTACCACCCCTCCTCGGAGGATCCCCGCGCATGCGGGGAC
+GACCGCGTGTTGGTGCTCGCCTGCCGCATGTGCTCCGGAGGATCCCCGCGCATGCGGGGA
+CGACCCGGACGTCGACAGCCCGTTGGCCGTCAGCGCCGGAGGATCCCCGCGCATGCGGGG
+ACGACCACGCGTCCAGATACCGCTGGTACAACCGGTGCGGAGGATCCCCGCGCATGCGGG
+GACGACCCACGGCCCGGCTTCCACCCCGCACAAGACCGCGGAGGATCCCCGCGCATGCGG
+GGACGACCCCACCGTCCCGAGCGGCGGCAGGCTCATGGGCGGAGGATCCCCGCGCATGCG
+GGGACGACACTTTCTGACCTGCGGTCATACCGGCTGGTCCGCCAGTTTTCCTTCGGTCGC
+TTTTCAAACGGCCGCGGAGCCCAGGATAGAAACGACCGCCCGACCCCAGCCCCAGTAGCT
+CTCACCACCGCTCATACGAACACCGTAGCCCCGCCCAGCCACCCCCGTAACGCCACCGAT
+CCCGGGAGCGCGGGGTCGTCCCTCCTCCCCGTCGCCCGCACCCCTCAGGAGATCCCCACA
+CCCGTAGGGCCGACCCGAGGTCGTCGTCGTGGTCGCCGAGGACGACCGGAGGGTCCCCGC
+GCCCCCAGGGCCAACGCCAGGAACATCTCACGAGCCTGA
+>orf00193 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGCCCCACACGAGCACTACCAGCCCACCGACGACGCCCCGCCCATGCGGACCTTC
+GCCGACCTCCGCGCCGCACTACGCCGGCACGGCTACCCCAGCGACCTCGACCAGTTCGAC
+AGGGAACTCGCTGCCACCGACCTCGACGACCTCACTCACGTCCGCGAGATCACCCAGGCA
+TACCGGCACCGTGTCCTCCTCCACCGCGACGCGGACGCGGCCACCGCCATCTCCCGCTCC
+AGCCAGGACATCGAGGCGGAACTGCGGCGCAAGATGAGCGAGGCCGACCGGTGA
+>orf00195 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGTACGCCGCCGTCTCGAGGAGCAGCCCGACCAGCCCAGCGCCCGTCCGCTGCCCGAT
+CGAGGAACGCGCAGCGCGACCTACGCCTACGAGCTCCTCCCCGAGCAGACCGGCGGCCGC
+GGTATCAGCGTCGTCTACCGCTACGCCGAGAACCTCGACGCGGTCTTAATCCTGTGGCTC
+ATCGCCGGGCCCTGA
+>orf00200 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCCCCGCGCCTGCGGGGATCCTCCGAAAATCACCGCGCACTCCGCGCGGGCAGGCGC
+GTTGGCCCCGCGCCTGCGGGGATCCTCCGTGGAGCGGCTGTTGCGCGAGCGCGCCCTGCG
+CGTTGGCCCCGCGCCTGCGGGGATCCTCCGACCGGCCGGGGCTCACGGCAGCAGGTCACG
+CAGTTGGCCCCGCGCCTGCGGGGATCCTCCCCAGCCCAGCATCGAGGACGCGTTGCCCTG
+CGGGTTGGCCCCGCGCCTGCGGGGATCCTCCGAGGATCGGCACGACGCCGTGAGCGCCGG
+CCACGTTGGCCCCGCGCCTGCGGGGATCCTCCTCCCTCGCCGGTGATGGGGTTAGGCACG
+GGCGGGTTGGCCCCGCGCCTGCGGGGATACTCCGCCAGTGAGCACTGGCGCCTCGCGCGA
+GCTGGCGTTGGCCCCGCGCCTGCGGGGATCCTCCGTTTCGTACGGCGGGGTCCAGGCCGG
+TCAGGCGGTTGGCCCCGCGCCTGCGGGGATCCTCCGGTCTCGCCGGTCAGGGTGACGCGG
+GCGACCCAGTTGGCCCCGCGCCTGCGGGGATCCTCCGGAGCACCAGGCGGACGGCGTCCG
+CACCGAGTGGTTGGCCCCGCGCCTGCGGGGATCCTCCTCGCGGGCTCCCCTCTCGGTCAG
+GGCTCTTGGGGTTGGCCCCGCGCCCGCGGGGATCCTCCGTGGGCCCGCTCGAGCGCGGGG
+AACCTTTGCAAGTCGGCCCCGCGAGCGCAGGGATCCTCCAGATCGCGGCCCTCTTCGTCG
+GTGGGGTCATGCGTCGGCCCTGCGGGCGCGGGGATCCTCCGGTCACCAGCTCGACCACCA
+CGGCGGTCAACTTGTTGGCCCTGCGGGCGCGGGGATCTTCCGCACGGTCAGCGGAGCTAC
+TGGCGGACCAACAGGTCGACCACGCGCACGCGGGGATCTTCCGACGATCAGGCCGACGAT
+CACGTTTCGTACCCCGTCGACCCCGCGCGCGCGGGGATCCTCCGGCTGCTGCAGGCGAAC
+TGGCGGGCGCCGGGTTGCCCTCGCGCTGGCGGGGATCTTCCGACCGCTCGGGGCGGCGCG
+CGCTGGCTGAGCCTGTCGGCACCGCGCTCGTGGGGATCAGTCGCGCCGCCGAGCGGATTA
+CGGGAGTTACGGTGTTGA
+>orf00201 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGAGCTGCTGGGGTCGGGCGGTCATTTCTGTCCTGGGCTCAGCGACCGGCCGGAAAG
+CAACTGAAGGAAAACTGGCAGACCAGCCGGTATGACCGCAGGTCGGCAAGCGTCGTCCCC
+GCGGGCGCGGGGATCCTTCTCTGA
+>orf00203 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGACGCCAGCACCGAAGGATCCCCGCGCCCGCGGGGACGACGATCCCTCCACCTCGGC
+GGCCAGACCGTAGCCCGAAGGATCCCCGCGCCCGCGGGGACGACGGGCGGTCAGCGTCTC
+GTACCCCCGCCCGGCCAGAAGGATCCCCGCGCCCGCGGGGACGACGACGTCCAGATCATC
+ACGTTCAAGCGCATCTCCGAAGGATCCCCGCGCCCGCGGGGACGACTCGTCGCAGAAGCG
+GATGAGGAAGTCGAGGACCGAAGGATCCCCGCGCCCGCGGGGACGACCGCGCACGTGCCA
+GCGTCCCCGGCCGCGCAGGAGGAAGGATCCCCGCGCCCGCGGGGACGACCACCGTTCGGC
+GGAACGGCGAGGCGAGCGTGTCGAAGGATCCCCGCGCCCGCGGGGACGACTTCTGGGCGT
+CAGATGCCGAGGTCGAGGCCGAGGAAGGATCCCCGCGCCCGCGGGGACGACGACCCCGGA
+CTGCCAGAACACGACGCCCCTCCCGAAGGATCCCCGCGCCCGCGGGGACGACCCGGGCGA
+GACGAGGGCTTCACCTTGATCAAGGTGAAGGATCCCCGCGCCCGCGGGGACGACTCGCGG
+GACTCGGCGGCATGA
+>orf00207 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGGGCGACCCCGGGAGGCCGGTCGGCCCCGCGAGCGCGGGGATCCTCCGCGGTCCTG
+TCCGCGCGGTGGTCCTGGCCAGAGGTGTCGGCCCCGCAGGCGCGGGGATCCTCCGACGGA
+GAACTGGGTGGTCGAGGCGATCCAGGCGTCGGCCCCGCGCTCGCGGGGGTCCTCCGGTGT
+GCGGCGCACTTCGGGAATCCGCTTCGCCCCGTCGGCCCCGCGTGCGCGGGGATCCTCCGC
+TGGAGAGCGGCAGCACGCGCATCCTGGCGAGGTCGACTCGCGCTCGCGGGGGATCCTCCG
+GCCCCGTGTGCTCCGCCCTCGGCCCGCTGGGTCCCGGCCCCGCGCTCGCAGGGGCCCTCC
+TCCCTCGGCTGCCTCGCCGACGTGTTCAGGGCCATCGGCCCAGCGCTTGCGGGATCCTCC
+GGGACTCTTGCGCGAGGCCGCAGGCACACCGAGCGTCGACCCCGCGCTCGCAGGGATCGT
+CCGCGCTCTCGGTGTGGCTGGCCGGCGATACGGTGTACGTGTGGGGGTGAGAGCTGGTGG
+GTTCGGGCGGTTGTTTCTGTTCTGGGCTCAGCGGCCGGACCGGAAAGCCACCGAAGGGAT
+ACTGGCAGACCCGCTGGTATGACTGCAGGTCAGCAAGTGTTGGCCCCGCGCCTGCGGGGA
+TCCTCCGGCCGGGGGGCTGCTCGCGTGGTCGGTGGAGCAGTTGGCCCCGCGCCTGCGGGG
+ATCCTCCGGCCGGGGGGCTGCTCGCGTGGTCGGTGGAGCAGTTGGCCCCGCGCCTGCGGG
+GATCCTCCGGGGCAGCGCCTGAACTCGTCCAGCTTCGTGGAGTTGGCCCCGCGCCTGCGG
+GGATCCTCCGGTCCTCGGCAGCGGCTGGCGGGCAGAGGCTGA
+>orf00209 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCCCCGCGCCTGCGGGGATCCTCCGCTTTCGTGGACGCGTCCGAGATCGACCCGATC
+GTTGGCCCCGCGCCTGCGGGGATCCTCCCTCCTCATGGTCCGCACGGGGCGCCGTCAGGT
+GGTTGGCCCCGCGCCTGCGGGGATCCTCCGTCCACCCCCACCCCCGAGCGCGAGCCCGCG
+TTGTTGGCCCCGCGCCTGCGGGGATCCTCCGGTATTGATCGGCACACCGAAACCTGA
+>orf00210 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTGGCCCCGCGCCTGCGGGGATCCTCCCAGACGGCACATCACCGCAAATCTCTACGA
+ACGGTTGGCCCCGCGCCCGCGGGGATCCTCCGACGAGAGCGGCGCCGCCGGGCCGGGTGA
+>orf00211 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGGGATCCTCCGCGGCTCGCCGACCAGATCCTCAAGACCCCCGAATCGGCCCCG
+CGCTCGCGGGGATCCTCCGAGGCCCGTGTCCGCCGCGCGCCCCGCCTCCGCGTCGGCCCC
+GCGCGCGGGGATCTTTAG
+>orf00216 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTCCAGACCGGCCTGCACGCCCGTCGGAAGATCCCCGCGCACGCGGGGCAACGGGCC
+GCGCGAGGCCAGCGGGAAGTTAATCCGCGGAAAATCCCCGCAGGCGCGGGGGCAACGACC
+CGCTCCTGGTCCGCGTCGGCCTCTGGGCAGGAAGATCCCCGCACACGCGGGGACGAGGTG
+CTTTTCATGACGGATGCTGAGGCCAGGGAAGGAAGATACCCGCACACGCGGGGACGACAC
+GCCGCGAGCTCGAAGAGCCTCAAGTTCGGCTGGAAGATCCCCGCGCATGCGGGGACGACC
+ATCACGCACAGTCGGTCAGCTCCTAGTGCTGGGGAGGATCCCCGCGCATGCGGGGACGAC
+GGCACGGGACTCCCGGCCCGCTCCCTGAAACCGGGAGGATCCCCGCGCATGCGGGGACGA
+CGCCGTAGATCAGCCCGTCGGACTGGTCGGGCTCGGAGGATCCCCGCGCATGCGGGGACG
+ACTTCCTCAGCGCATCCATGCGGTAGAAGTCGTACGGAGGATCCCCGCGCATGCGGGGAC
+GACCTCAGGCTCGGGCGCGAGGGCCAGGGTCTCCCCGGAGGATCCCCGCGCATGCGGGGA
+CGACACTTTCTGACCTGTGGTCATACCGGCTGGTCTGCCAGTTTTCCTTCGGTCGCTTTT
+CAAACGGCCGCGGAGCCCAGGACAGAAACGACCGCCCAACACCAGCCCCAGTAG
+>orf00219 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGTCGAACATCGAGCCGTACGGGCTCGTCTGTCGTCCCCGCGTGCGCGGGGATCCTCCG
+GGCTACGCGCTCCTCTTCGACCAGGACTTGGGGTCGGCCTCGCGTGCGCGGGGATCCTCT
+GCTGCTGGTGGGTGA
+>orf00220 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGGGGCCGACCTCGTTCGTCACGCCCGGCCCGTCGCCCCGGAGGGAGCATCCCCG
+CGCTCGCGGGGCCGACCCGTCGAACTCGCGGTCGGCGTAGCAGGTTCCCGGAGGATCCCC
+GCGCTCGCGGGGCCGACATCCGGTCTACGGGCCGGAAGTACCAGCCCGCCGGAGGATCCC
+CGCGCTCGCGGGGCCGACAAGGCCGATCGCACGCTGCATCCAGCGCACATCGGAGGATCC
+CCGCGCTCGCGGGGCCGACCGAGGCCGCGCACGCGAAGCTCGCCGACGAGCTGGAGGATC
+CCCGCGCTCGCGGGGCCGACACTTGCTGACCTGCAGTCATACCAGCGGGTCTGCCAGTTT
+TCCAGCAGTTGCTTTCCGGCCGGTCGCTAA
+>orf00221 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGCGAAAGGCCCAGATCATTGAGGCCGCAAACACGGCGGCGGGGCGCACCGTGGTCCGG
+GCCGTACGGGTCCTCGCCCCCAGCACCGGCCCCGCGCCCACCCCGGCCCCGGCCACTGCC
+GACGGCGAAGGCACCGCCGCACCCACGCCCGTACGGACCCGGGAGAACGCCTCGCCCGGA
+TACCGCCCTGCGCTCCGCGCCCACCAGCAGGCAGCCCCCGCCCAGCGCGTCGACCACGAC
+GTCCTCAAGGCCGACCGCCGCGCCGGCGAGCGCCAGGCGGCCGCGATGCGCGCCCTGTCC
+CACCACGCCTTCCCCGACGAAGTGCCCCGTCTCTCGGCGCGCGAGGACGTCGACGCGGAG
+CGGCGCACCGGTGCCGAGATCGAGGCGGCCGCACGTCGCCGGGCCCGCGCGGACCGGGCC
+CCGCGTCGTGCGATCCCGTAA
+>orf00223 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGCAACCCGCTCCAGCTGACCGCGACGATGCGTACCCGGCTGCTCGCCGCGGTGCGC
+GCTCTGGTGTCCGATCCCGCCCTGGACGGGGCGGGCGACCCCGCGCGCCTGGCGGCGGTA
+GTGCTGATGGCGAAGGCCACGGTGGCAACCGACTACAGCACGCGGATCACCGCGACGGAG
+CTGGGTCGGTGGATCGGGCTGAAGAAGTCCCGGGTCGCGCACCACGTAGTACCGGAGCTG
+CGCGAGCGTGGCGTGCTGGGCTCGAACGGGACGACGAACGCTGCCGGGTGGATGACGGGC
+CTGGAGTGCTGGGTGATCCCGATGTACCGGGCGCAGCACGGCGGGGACCGTAGGCACGTC
+CTGGCGCTGTCGCGGGTGGAGCTGGTCGTGCTCCTAGCGCTGATCGAGGTGCTGTTCGCG
+CCGGGCTGGGAACACCGGGACGGCCGGGTAACCCCGGCCGGGATGCTCGCGGGGCGTACG
+GGGCGCGGGGCGGCGACGGACCGGCTCGGGCTGCTGCTGATGGTGCTGTCGTCGAACTCC
+AGAGGGTGGCTGCAGCTGTGCTCGGGCAGCGTGGACACCGGGCGGGGCCGTCCGGCGGCG
+ACGGTGGCGCGGCTGATGGGCTGCACGGCGGCGGCCGGGGCGAAGAGCCTCAAGCGGCTC
+CAGGAGCAGGGCGTGCTGTCGGTGGACCGGCGGGAGACGGCGTCGGGTCTGCATGCGCGC
+AGTCGGGTCCGGCTGCTGCCGGTGGCCAGGGCGCACGGGATCGCTGTCCGGGAGGCCCGC
+GGGGCCGCCGGCGCGGTGTTTTCAGACCTCGCCGTTACTGCATCCGGCGATCTTGAGACG
+ACGGTTGAGACTGTGTCCCCTGTGGTTACTGGGGTTCAGGGTACCGGGATGGGCCAGGAG
+CCTGATTCGGCAGACCGCGCCGATGCTGCACACCTTCACGCCTCTCACGCTTCTGGGGCT
+ACTCCTGCTGATCAAGTTGAGGACTCCTCGGGTTTTTCCGGCGAAGGCCGTGGGGGGACC
+CCGCCGTCGCCGGACCGCGCGAGCGCGCGTGAGGAGGGCCCGCTGCGCGGGGAAAAGCGT
+GAGGAGTCCCCCTCGTCGAGCAGCAGTGAAAAGCGCGGGCCGGGCCCGGCGGTGACCCTG
+GTGCCGGAGCCTCAGGGCTGCGCTCAAGGCCGTCAGCAACCGAAGCAGGCTCCAGCGCCG
+CTGCCGCCGGAGGATCTGCGGGCGGTCCTGGAGCCGGTGGACTGGATGTGGGCGCAGCTG
+CCCAGGCCGGGGCTGCGCCGCGTCGTCGAGGCGGCCGCGCACGCCGAGCTCGCCGTCCTG
+CAGGGCCTCGTGGGCCGTACGGATGCGCCGCAGGTCCTCGGTGCCCGGCTGTTCCGGCGC
+CTGGGGGAGCAGATCCGTACGGGCGGCGTGATCCGGGATCCGGCGGGCTGGCTGCTCGCG
+CGGGGGTTGCCGCAGCGCCAGCAGTGCGGGGACGTGCGCTGCGACGACCGCATCCTGCTC
+GACTCCGGGCAGGCGTGCCCGCGGTGCGAGGACCGGCAGGTCGATCGCCGTGCGCAGCGT
+CGCCGGATCGCCGCCGAGGTCGAGGAGCGGCTCCCGTACGCGGGGGAGGAGGAGCGGCGC
+GCGGCGACTGTGCGGCAGCTGCACGAGGACGTAAGGGCCGCCGGGTGGGCGCGCGAGTGG
+GAGTGGGAGCGGGTCCGGGCGCGGCAGGCCGCGGCCCGCGCACGCGCCGATGCCGCCCGC
+CAGGACCAGCCGGAGCCCACCGCTCCCGCCCTGGGCGCGCTCCCGGCGCCGCGGGCTCGG
+GTGCTGGCGTCCCGTACGGCCGCCCCCGCTGTGGCGCCTGCCGGGCGACAGGTCCGCGAG
+GTCGTCGACGAGCTCGTGCTGGAGGAGCTGACTCGCGAGCAGATCCTCGACTGGCGCGCC
+CGCGCCACCTACGACCACCAGGTCGTTCTCGACCACATCGCCCGCTACGGCGAGCACTCC
+GCGCAGCGGCTGTTCACCCGCGCGCTCGTCGCCACCGTCCACCGCGTGACCGGCCGCGAC
+CACCTCACCCTCACCACGAGCCCCTGGGGGATCGCATGA
+>orf00226 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCAACTACCCCTCGGGCTGGCCGCAACCTCCAAAGCCAGGACGCGACATGAAGCAGAG
+TACCCGGAGTTCACCCCGGTCAGACAGGTGGAGCCACGGTTCCGGCGTGAGGATCACACC
+GCCGACGGACGTTACCCCTGTCCCTCCTACCGCCGCACACGCGTGACCGCCCGGAGCGGG
+GCTGCCCCCGCTCTCGCCGTCATGCCCACACGCCTCATCCCCGAGCGCCGCGTTGTCGGC
+GTCTCGGGGCAGACCCCACCCGCTGCGGGGGGTCGGATGACGTAG
+>orf00228 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACGCAACAGGAGCTGGCAGCCCGGTTGAATGGACGGTCCGCTGGCTGGATGAGCCAG
+GTAGAACGCGGAATCCAGCCGGTACGTCGCGTCGATGTTCTCCAGGAGATTGCTGACGCG
+CTGGGTGTCTCCATCCAGATGCTCGACCCCAGCTCCCCGATTTTCACCCCTTCGGTTCCA
+CCTGTCACCGAGGCCACCAACGACCTCGACGGTGCTCGAACCGTCATCTCAGGGCACCCC
+GCGATCGGCCTCATCACCGGGGTCGAGGAATCGGGAGCCATTGACCTTGGTGCGCTCGAA
+GAGTCCGTCGAGCAGATTTGGGAGTACACCCACCGCAATGCGTATCCGGAGATCAGCGAG
+ACAATCGCCGCGCTGCTCCCTCAGCTGGAACGTGCCGTACGCACCGTCCCCGCCCCGGAC
+CGGCCTGTCGCCTACCGGAACCTGGCGCGGGCGTACCAAGCACTCGCCGCCGCCTTCGCT
+CGGCAGGGCGATTCTCGCTCATCATGGGTGTCCGCTGACCGGGCAGTAGCCGCCGGCGAG
+AGATCCGGTGACATTTTCCTCGTGCACGCGGGGATCTTCCGCATGGTGCACGCCTTCGTC
+CGCCTGGGGCACAACCAGGAAGCCGAACACGCGGTCACCGAAGCGGTCGCAGCTCTCCAA
+CGGCGCGCGGACCTCCCCCCGGAGGGCCTGTCCGTGCTCGGCTCGCTCCACCTCGCAAAA
+GCGCTGGTTCACGCCAGGTCTGGGCAACGCTCGGAGGCCCGCGCGGAACTGGAGAGCGCG
+AGACGGGTAGCGGAGCAGATCGGCGAGGACCGCAATGACTACAACCTCGAATTCGGCCCG
+ACCAATGTCATGATCCAGACAGTCTCAACCGCCCTGGATCTCGGTGATGCCGGGGAGGCT
+CTCGACATAGGGCAATCCATCGATGCCGCCTCGTTGTCGCCCGAGCGCCAAGCTAGGTTG
+TTGATGGACTTGGGGCGAGCCCACGCGCAGCGGCGACACACGCCCGACGCAGTCGAATGC
+CTGCTGCGCGCGGAGGAAATGTCACCGGACCTAGTACGTCAGCACAGCGCGGCCCGGGCC
+GCGATCAGAGAGCTGTTGCTCGTGAGCGGGCCGAAGGCGTCCGCCGATCTGGTGGCTCTG
+GCCGCGCGGGCGTCCGCGGCGGAATGA
+>orf00229 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCATCCCAGGAGGAGAAGTGAGCGGATACGCACTCGTCGTGCGGTTCACCACCCGT
+GACGCCGACTCAGCCAAGAAGTTCGACGCCCTCGTGAGTCGCACTTTGGAGGGCATCCGC
+TACGAACCCGGCACTCTCGCCTACGTCGTCCATGTCCCGGAGGGCGAACCACTGGTCCGC
+GTGTTCTATGAGCTCTACGCGAGCTACGACGCGTTTCAGATCCACGAGGCGCAGCCCCAT
+ACGCAGCGGATGCTCAGCGAGCGAGAGCAGTACCTCGACGGCAGCGAGGTCACGTTTCTC
+AACGAGCTGATGGGCAAGCGCCCGACGGAGACGACATGA
+>orf00230 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTCACGGGTGGAAACACCAACGACTGCACCCGGTTCCCCGCCGTGATGGAAGCGATC
+CGCGTGCCCCGGATCGGACCCGGCCGTCCCCGGGTCCGGCCCGATCACGTCCTAGGCGAC
+AAGGGCTACAGCTCGAAGGCGATCCGCGCCTGGCTCCGTCGCAAGGGCATCGCCCACACG
+ATTCCCGAGCGGGCCGACCAGGCCCGCAACCGGGCCCGGCGGGGCAGCCGCGGAGGCCGC
+CCGCCGGCCTTCGACCGCGAGGTCTACAAGCACCGCAACGTCGTGGAGCGGTGCTTCAAC
+CGTCTGAAGCAGTGGCGCGGGATCGCCACCCGGTACGACAAGACTGCCGAGTCCTACGAA
+GCAGCTGTCACGCTCGCGTCACTCCTGATGTGGGCGTGA
+>orf00231 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGATCATGGTGTCGTGATACGTCGCCATGAACTGTCGGATGCCGAGTGGGAGTTCGTC
+CGGCCGCTGCTGCCCGAGTCGTTGCGGGGACGCAAGCGGTTGGACGATCGCAGGGTCCTG
+AACGGGATCGTGTGGAAGTTCCGGACCGGGACGGCCTGGCGGGACGTGCCCGAGCGCTAT
+GGCCCGTGGGCCACGCTGCATACGCGTTTCCGCAGGTGGGCGGCGGACGGGACGTTCGAC
+CGGATGCTCCGCGCCGCCCAGGCGAAAGCGGATGCGGCGGGCGACGTCGACTGGCTGGTG
+TCCGTCGACTCGACGATCGTCCGCGCTCACCAGCACGCGGCCGGGGCCCGAAAAGGGGGC
+TCCGCGACCCGGCCCTCGGCCGGTCAAGAGGCGGTCTGA
+>orf00232 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAGGCCACGCAGGCCCGCCGTATCTCGCTGGTGTGCCCGGACTGCCGCACCTGGGTG
+GCCGTGACCCCGCACCGGGGTACCTACCTCCTCAAGCTCGTCCCGCACCACACCGGTCGT
+GCTGGCGTCGACGCCGCGATCCGCTGCCGCTCCAGCAACCGCCTCGTCGACGTGGACCTC
+ACCGACTCCATGTGGCGCCGCCAGTACGACGAGTGGGCGCGCGAGGAGCGTCTCGCCGTC
+GACCTCACCCGCCACCGCCGAGCCACCGTCCAGACCCTCAAAGTCGCCCGGCCCCAGCAG
+CGGCCTGCCGACCGGCGCGCGCAGTGGGAGCGCGCGGTGCCCGCCGCCCGCCAGGCCGAC
+GCCGCCCGCGCGGTCCCCGCCGACGCGCTCCCCACCACTCGCGGCCGGGCCGTCGACGGC
+CCCGCCGGCGCCCCGCCGGCCCTGCGCCGCCAGAGTGCCGGGGACCGCCGTTCCGTCCGC
+GCCCTGGCCACCGGCACCCTGCGCGCTCTGGCCGACGCCCGCCAGGACCGGCTCGCGGGC
+GACGGGCTCGCCGAGCACCTCACCCGCGCCGCGTACCTGCACCTGGCCACCCTCTGGCGC
+CGCCCCCTGACCCCGGCCGACCAGCCCGCACACACCGCGCTCATCGCTGCGGTCAGGGCC
+GCGCTGCCCGCGCCAGTCCCGGGCGAGACCGTCGCCGCGTACATCACCCGCTGCCGCAGG
+TCCCCGCTCGCCGCCGCATGA
+>orf00233 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGTCCGCTACCGACCCGCTGACTGAGTTCGACACGGAGACGCTCGCGCTCCTGGAGGCG
+GTCGAGGTGCCGCTCCCCGCGTTCGGCGACCTGGACCTGGACGTCGCCTTCGGCACGCCG
+CTGGAGATGTACGACCTGGTGACCGCAGACGAGCTGGCCCGATGGGACGCCGTCTCCGTG
+GTGAAGAAAGGCCGGGCCCGGGCGCGCGAGGAGGTTGTTGCGGCCTCCGGGGCGCGGCGG
+GATGCGGCGCGGGACATCCTCGCCGCCGATCCGACCGTCACCGAGCGGGTCCGCGAGCGC
+CTCGTCGACATCCTCATCCCCGCCGCGCGGCAGCTGCGGATCGACCGCACCGTCGTCGTG
+TCGTTCGCGGAGTCCGAGGTGCTGGCGGCCTGA
+>orf00234 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGGGCGACAGGGTCGAGACGACGATCGCGTCCAGGGGGCTGACGCGGGAGGTACG
+GGTGCGGCCCCGGCGCGTACGGGCCGTGGGCATGGCGAGCTCGGGCATGGCGACTCCTCG
+GCAGGAGAAGGGAGGGGGATTCGCGGGGCGGGTGCTCTCTCCGCCCACCAGGTCCACGAG
+CCAGCGGCCCACGTCCTGGCGGACAGACAGCGCATCAGCGCTGAGGTCATACAGCAGTCC
+TGCCAGCCAGGGGGTTTGGTGGTGCTACCGCCTCCGGCCACCTGCCCGACTCCGAAGAGA
+CGAGCCGCAGAAACTGCGGTGGCGACACGACCGACGCTACGCACACTTTTCGTGCTAGTC
+AATACTTCAGTGCTAGGCAGTGTCTTCAAATGA
+>orf00236 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGTGGTCGAGGTACGGCCGCCGTGGCCGTCGCAGTCCGAGCAGGCGATGCCCGCGGC
+GTGGTTCAGGCGGGCGCGCTGCTCGGCGGCGGTACGCGGCGCGCGACGACCGGCGGGGAT
+ACGGGTGTCGGCCTGGCGGGCCTCGGCGAGCATCCGGTCCTCGAACGTCGCGGCGGTGCG
+CTGAGGGTGGGGGCGGGCGGGCTCGGTCGGCGGCTGCGGCTGACGGCCCCCGGTCTCGTG
+CGGCTGCGGGCGGGTCGGGAGCGGGTCGCGCTGGACGCGCGGCGAGCGGGGCAGGGTAGC
+GTTCGGCATGCGAACTCCATCTCGTGA
+>orf00238 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCGACCACCTCCCCCACCTCCCAGCCGATCCCCGCGCCCGCGCCGACGCTGTGCCGC
+TACCGGCGCGAGCACGGCGACCCGACGACCTGGACCACCTCGGAGATTGAGGGCTGGCTG
+CACCGCCAGGACGCCGCCCACGCCGACCTCACGACGCACGCGAAGGGAACCCGATGA
+>orf00239 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAACGTCCGTGACGTGGTGGCCCGCGTTGAAAGCGCGCGCCGCCGTCCGCCCGGCGAG
+GGCGAGCAAACGGCGCGCGCGGGGATGCGCGGGTCCGTGGGAGAGCGCCCGCGCCGCGAG
+GAGTTGCGCGGCGCGGGCGCGTCTTATGTGGGGCACGCCCACCGCTACTTCGCGGGAGCG
+GGCGGCGGCGGGGGCGGGGTCTGCCCGCACTCGCAGGGCGACATGGCGACGCTCTGGAAC
+GGTTTGCCGTCCGCGCCGGTGTGGTTGTAG
+>orf00240 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGCGAGACCGGCCCGGGGGCCGTGCAGCTCGAGGAGGCCAAGAAGATCTGCACGGGC
+TGCCCCGTCCGCGCCCTGTGCCTGGAGTTCGCGCTCGACTCCCGCCAGCAGGACGGCGTG
+TGGGGCGGCATCTCCGCCGAGGAACGCCGCCGCATGCGCCGGCGCCGCGCATGGCCCGCG
+ACCACGGACACCCCCGCCGCGTGA
+>orf00242 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCGATCAGCCGCAGCCCACCACCGAGCAGGTTGCCCAGGCCATCGTCGACGCCGCC
+ACCAGCGGGGACCAGGCGTTCACCGAGACGGTCGCCAACTCCTACACGACCGAGCAGCTC
+GAAGCGGCCCAGGCCTACCTCACGCAGGGACGCTGA
+>orf00244 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGGGGAGTCGGACAGCCCGAACCACGACCACTCAGTAAGGGAGTTAATCCCATGGCC
+TTTCTCCAGCGCCTCGTCAGCCCGCTGCGCCGCATAAACGCCGACCCCGACAAGCTCGTG
+GAAGAGGCGTGGACGCACATCGCGGAGGCGGAGCGGAACCACGGCCTGTGGCCCGCGATG
+AGCGCCCTCACCGACCTCGCCACAGCCAAGGTCCAGGTCGCCCAGTACCTCAAGGAGCAC
+CGCGACACGTGA
+>orf00246 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCGCCGTCGATATCCGCAAGCCCGAAACGGTCCGCCCGGACGACGACGACCAGCAC
+TCCTGGCCCGTCCCGGCCCCGGCCGACCACACCGATCACGACCAGGAGCAGCCCGGCTCC
+CAGCAGCACGACCAGGACGACCGGGACGACGACCCGCGCACCATGCGGCTGCTCGCCGTC
+GTCGCTGGCGTCGGCGGCCTGGTCCTCGCCGGGATCGGTTTCACCGGCTCCTACAACACG
+CTGCGCCACCTCGCGGAGAGCAAGGGCTTCGGGACTTTCTCCTACGCCTTCCCCGTCGGT
+ATCGACGCCGGCATCCTCGTGCTGCTCGCGCTCGATCTGTACATGATGCGCAAGCGGATG
+CCGTGGCCGATCCTTCGCTGGACCGCGCACGGCCTGACCGTCGCGACCGTCGCTTTCAAC
+GCGGCCGCCGCCGGCCCGGTGACCGAGGACCCGCTCGCTGCGTCCATGCACGGCGTCATC
+CCGGTGCTGTTCATCATCGCCGTGGAGGCCGCTCGCCACTACATCGGCCGGATGGCCGAC
+CTGCTCGCCGGTGAGACCCCGCTCGGGTCGGTCCCGCTGACCCGCTGGATCCTCGCCCCG
+CTGTCCACGCCGCGCCTGGCCCGTCGGATGCGGTTGTACAACCTCCCCTACAAGGAGGTC
+GCCGCCCAGCACCAGGCGTTGCGGATCTACCGCGAGGGCCTGCGCCAGAAGTACGAGAAC
+CACGAGCAGAGCTGGCGCCGGGCGGCGACGCCGGACGAGCTGCTGCCGTTCAAGCTGGCC
+CCGTTCGGGTTCAGCGTGGAGCGCGCTCTCGGGGTCCCGCTGGAGGAAGAGACCAAGCGC
+CTCCAGCGGGCGGCGCGGGCCGCTGTTCAGCGTGCTGAGGCTGAGATTCAGCGCGTGCGC
+ACCGATGTTCAACTGGGCGAGGCCCGCATTCAGGCGGAGGTCGACAAGATCCGTGGCGAG
+GGTCGCCTGAAGATCGCCCGGGCTGAAGCGGAACGCGAGGCTCAGGCGGAGATTCAGGCC
+GCCGAGGCCGATGCTCAACTGCGTGAGGCGCAGCGTCAGCACGCGCTCAAGCTCGCGGAG
+GACCAGGCTGCGGCCGAAGCGCAGGAGCTCGCCGACGAGACCGAGAAGCGGCGCACGCTC
+TCCCGGATCGACCGGGAGAAGGTGCAGGCCAGTTGGGGTCTGGAGCAGAAGCAGATGGCC
+ACCGAGGCCACCGAGCGCGAGCGCCGTATCCAGGCCGATGCCGCCGCCCGCGCCCAGCGC
+GAGGAGATCACACGGCAGGCCGGCATCGCGGAGCAGGCGGAGCGGCGCGCGCGGGCGCTC
+GCCGGGGAGAGGGCGGCCCTGGAAGAGGCCGCTGAACGCGAGAGGAAGGAGGCTGAACAT
+CGCGCCGCGACGGTGAACACGATCTTGGAGGCGCAGCGCGGAGCCGAGTCGATCGCCGTG
+TCGAAGGCCCGCGAGCAGGCCGCGATCGAGGACGCCGCCGCCCGCAAGGCGCGTGCGGCT
+GAACACGAGGCGGCGGCGGTTGAAGCCGCGGCGCGCGCCCGCATGACCCAGGTCGACTGG
+GATGTGCAGCGGGTCTCCGCGATGATCCAGGCCCGGGGCGATAGCGCGGTCACCGTCCGC
+GTCATCGCTGACGAGCTGGGCATCTCCACCGGCTCCGCGCAGGACCGCAAGACCAAGGCG
+CTCGCCCTGCTCAGGGGCGAGTCCACCGGCGATCTCGAGCGGGCTGCGGCCTGA
+>orf00247 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGGCCACAGGCCGTTCACGAAGAGGTCGAACAGGGCGAGGACGGTGGAGATCACCGCG
+ATGACCGTGGCCAGCAGAGCGGGCAGCGGGTTGCGCGGGACGAAGACGTCGTCCGTCATC
+TTGCTCGGGGTCGGGGTGGCCGTCGTGGTACTCATCGGGCACCCCCACTGGTAG
+>orf00249 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGCAGACACCGCGACCGCGACCCCTGAAACCACCGCCGACACCACCGGCGACGGGGCC
+ACGGACACCGCCGAATACACCGTCGTCACCGAGCCCGAGACCACCACCGACACGGCCTCG
+GACAAGCCGAAAGCCAACCGGTCGCGGCCGAGGGCGATGCCGCTGCTGATCCACGGCGGC
+AACGCAACCGGAATCGCCGCAGGCGTCGCCTACGGACTCGCCGGAGTGCCCGGTCTCATC
+GCCGCCGGCGCGGCCGGAGCCGCGGTCGGCGCCGCCGCGCTGGCGGGCCGCAAGAAGCGC
+TCGAAGGTCTCCGCCGCCCGCACGAACGCCGCGAGCAACCGCTCCGGCGGCGGGACGCAC
+CGCTCCGGAGGTGGCGCGGGCAAGGGCGGCCTGCTCGGACGCGGCGGCGGTCGCGGCCGG
+GGCGGCGGCGGTGCTGCTGGTGGCGGCGGCCGCGGGCCCGGGCGCGGTGGCAAGGGCGGC
+GGCTGGCTGAACGGCTCCGGGTCAGGGGGCGGTGGGACCGGCACGAAGAACCGGCCCGGC
+GGCGGCAAGCACGGCGCCGGTGGCGGCGGGCGCGGCCCGGGAGGAACGGGCGGCGGCAAG
+CACGGCCGCGGCGGCGGCCTGGGCGGACTGCTCGGAGGTGGCAGGAACCGGCGCGGTCCC
+GGCGGTCCCAACTCGCCCGGCGCGAACACCCCGAAGGGCACCGGGAACGGCAAGAACAAC
+GGGGGAGGCAAGAACGGTCCCGGCGGGAAGGCCGGCGCCCACCAGCAGTCTCGCACCGGC
+AAGGCCTGGCAGACCCTCAAGGGCTGGGGCAACAAGATGCGCCGCAACAACGGCGGCACC
+TCGAGCTCCGGCGGCTCCGGATCCTCCGGTTCGGGCGGCGGCTCCAGCTCGGGCACCTCC
+GGCTCCGGCACGAAGACCATCACGCCCGCCAAGACCCGCCTCGGTCGCGCCCTGCAGAAG
+ATGCGCGGCCTCGCGAGCAAGCTCCGCCGCTCCAAGAAGAAGAGCGGCTCCACCAGCTCC
+GGTGGAAGCGGCCCGACCTCGGGCCGCTTCCACCGGATGCGCCGCCTAGCCGCCCGCAAG
+CTCGGGCACTGGCTGCGCTGCGCAGGCGCCGGACTCCTCGCCGGACTCGGAGGGCTGGCA
+ACGCTGCCCCTCGGACTCCTGTGGGGACTGGCCCTGCTGCCGTTCAAGCGCCGCGACCCG
+CTCCACGGGTTCGCGCTGCCCGTCCGTGTCGCCGGACGGATCTGGCGGTTCTTCTTCCGC
+CGCTCCAAGGCCCGCCACGACAAGAGCGCCAAGGCGGACACGCTCAACCTCAAGGTCAAC
+AACCCCAGGAAGGACACCGATCCCGTGACCGGACCCTCGCTCGCTGCTGGCACCACGGTG
+CTGGACGGCAACAGCTCCAAGTTCGCGATGGCCATGCGCGCCGCGCACGCCTCCTACACC
+GGCTACAGCCCGCGCAGCATGATGGAGGTCGCTGCCGAGTACGCCGGCCTGCCCAACGGC
+ATCCGCGCCGCGGCCCTGGCGGTCCAGCAGATGGCCGTCAACGCCGACCAGAAGTACCCG
+TGCAGCAAGAAGGCGCTCGCCAAGCTGAGCGAGGCCTGCGCCAAGCTGGTCGCCGCCGCC
+GCTCGCGCGGACGGCATGGTCGCCTTCTTCCGCATGGTCCACGCCTTCGACATCGAGCGG
+ATCGTCGCCCCGAGGACGAACGAGTGGATGTGGAACGTCACCCCGACCGGCTCCGACGCC
+GCTGAGGGCGCGATGTTCATGCCCGGCCGCATCGAGTCCGGGTGCGTCCTGATGGCCGTG
+CTCTACCGCACCTTCGAGCCGGTCCACATGATGCAGGTCGGCTCCGAGTTCCAGGGCATC
+GCCTACGGGCTCACCGCCCTGGCCGACTGCGTCCAGGCCCTCTACGAGCGCACCATTGCC
+CTCTACCCGGTCGACGACCGCGTCACCGACGAGATCGGCAAGCTCGTCTCGATGATCCGG
+GCCGCGTCCGACGACGCGGACATGGCCGCGAAGCTGTTCGTGGAGGACCACAGCCGCGAG
+ATCAGCCACAACACCAGCCCCCGCAAGGGCCCGGCTGCCGAGTCCATGTGGAACACCCCC
+CGCTGA
+>orf00253 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGTCACTGGGACTGGTCGCTGCCCAGCGGCCACACCACCTTCCTCGGATACGCCACC
+GAGACCGCCATGACCACCGTCGCGCTCGCCCCGCTCACCGGCCTGCCCTGGCAGGCTGCC
+GCCCTCACCCTGGGCAGCGCGGCCGCCGCCGGCACCGTCCACGACCTGCGCGTGAGCACC
+ACCCTGGGCACGCTCACCACCCGTGCCGTCTCCTGGCTGACCGCGTCCGCATGGGCGTCC
+TGGGCGCTGGCGACCGCGCCGCTGACCACCACCGGCTGGGCGAGCGGCCTGGGCCTGGCC
+ACCGTCGGCCTCGCCGCCAACGCCTCCGCCAACCGCACCGAGAACACCCGCTCCGAGCGC
+AAGAAGCTCCTCAAGCTCCGCCGCAAGTCGGTCGGCATCCTCCTGGACTGGGAAGACCGC
+ATGAAGCGCGTCGCCCGCATCGAGGACTGCCACGGCAAGGACGTGCAGCACTGGCCCGGC
+GAAGTCGGCTACACCGTGGAGATGGACCTGCCCGCCGGCGGCACCAACGTCGACGACCTC
+AACGGCTACGGCCCGAAGTTCGCCAGCGACCTGCGCCTGCCCGACGGCTGCGGAGTCGAG
+CTGTTCCCCGGTGCCAACCGCGGCACCATCCTGATCGAGGTCACCCTCAAGGACGTCATC
+ACCGCCGACATCCCTTACCCCGAGGACTACTCCGAGATCAGCCTCACCGAGCGGTTCCCG
+TTCGGCGTGTACCGCAACGGCGAGCCCGCGCTCGGCAGCCTCTGCAACGACTGCGGGATC
+CTCGTGGGCGAGACCGACGCGGGCAAGACCAACACCCTGCGCGTCGTCACCGCCCAGCTC
+GCCCGCATGCCCGACGCGCTGATCTGGGCGATCGACACCACCGGCGGCGGCGTCGCCCTC
+CCCTGGATCACTCCGTGGGCCACCGAGGGCATCGCGTCCGCGCCGATCGTCGACTGGATC
+GCGCACACCGAGGACGAAGCCCGCCTCATGCTCAAGATGGCCGCCGAGATCATCGCCGCG
+CGCAAGGCCGGCTACCAGCAGCTGATGCGCGAGAGGAAGACCGACAACAAGCTGCCGATC
+AGCGCGGAGATCCCCGGCATCGTCATCATCACCGACGAGACCGCCTCCCTGCCGTACGAC
+ATCAAGGAGATGATCGACAAGGTCGAGCAGGAGGGCCGCGCGATGCGCGTGCGCGCACTC
+GTGGCCGCCCTGCGCGCCACGCAGGACGCCATCACCGCGATGATGAAGCTGATGTCGAAG
+TGGCGGGTCGGCATGACCGTCTCCGACGCCGAAGAGCTCGCCTACCTCTTCCCCGGCTAC
+ATCAAGATCGACCCGAAGGACGCGCCCGTCGCAGGGTCCGGGTGGAACATGCACACCCGC
+CTCGGACCGAAGAAGCCGACCGCGATGAAGGTATGGCGCCTGGTCGACGAGCTGATGGAC
+ACCATCTGCCAGGCCACGGCCGGGCGACGGCCCAAGCTCGATGAGCTGTCTGCCGCGGTG
+GACAGCGGCGAGCACTACCCGCAGCGGTGGGCGCGCACCCTGCCCGACCTGTACAAGGGG
+CAGAAGCTCACCGAGTCCGCGCAGTACGCCGTCGACAACGCCGGTGAGATCATCGCCGCC
+GCGACGCTGCTCGCCTCCGACCCGGTGCCGCAGGGCAGCAGCATGGCGTCGCCCGCTCCG
+GTGGTGCCGGCCGGGTTCGAGGGGTTCGGCGGTGCAGAGGAGCTGTTCGCAGCCGTCACC
+GCACAGCTGGACCCGAACGCCGCGCACCTCGCCGTCCCCACGGCTCCGGCCCCCACGCCG
+GCCGCCGCGCCGACGGCACCGGCCCCGCTCCCCCGCCCTGCCCGCCCGGTCGATCCGCGC
+GAGCTGGGCTGGGAGCTCCTGGCCGCCGCCGGGGCGACCGGCTACACGCCCAAGCTCCTG
+CACGAAGCCCTCGCGGCGGAGATGGACCGGCGGAAGGTGGGCGACGCCCCGGCACAGCGC
+ACGGTCGGCGGCTGGCTCCAGGCGTGGGCGAAGGACGGCAAGGCCATCAAGGACGACTCC
+GGGCAGTACACCCGCTACGTCGCCCGCGAAGCCGCGGTCGGCCCGGCCGTCTCCGGCCCG
+GCCACCCCGGCCGGGTCGGAGACGGCACCCCTGCCCGAGGGTCTGGACGCGGCCCTGGTC
+CTCCAGGCCGTGGACTTGGTCGTCTCCACGCAGTTCGGGTCGGCGTCGATGCTCCAACGC
+AAGCTGCGCATCGGCTTCGCCCCCGTCCAGAACCTGATGGACTTCCTCCACCAGCTGGGC
+ATCGTCGGCCCGTCCGACGGCTCAAAGGCACGCGAAATCCTGGTCTCGACGGCAGACTTG
+GACGCGACCATGATGAGGATCGCCGACGAACTCGGCTACACCACGCGCGACTTGGGCGCG
+ATGGGCCTCGCGGCGGCTGCCGCTTCGCATGCCAAGGAGTGA
+>orf00254 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCTGAGACCGCAGACGAGGAGATCGAGCGCCTGGAGGCCGAACGGCACTCCTACAGC
+GAGACCTTCAAGAACACGTCCGACACGGACGCGGTCACGCGCGCGCACCTCCAGTCCGAG
+ATGGACCGGCGCACCGACCGGATCCAGGAACTCCAGCAGCACCAGCCGCTCGGGTTCCTC
+GCCCGCTGGGGGCTGCGCGCCGCCTCCCTCGCCCTGCTCTGGGGCGCCTGGGAGGTCGGC
+CCCTGGTGGGCCAAGACCGGCTGCGTCCTGCTCGCTGCCTTCCTCGCCTTCTACAGCCTC
+GGCTGA
+>orf00255 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGAACCCCGCGACCTCACCCTCACCGACCAGACCCCCGCCCCGCCCGCCGTCGCACTC
+CCCTACGAGGGCCTGGAAAAGATCTGGGAGCTGTTCCCCGACGCCCGACCCGGCGCCGGC
+GGCCTGCCCGCCCCCACCCCGCACACCGCCGTCGGCCTGCCCACCGACGAGGCGTACATG
+GCCCGGGTCTACGACCTGGTCCGCCGGGAAGAGGCACTGAACCACATCCGCGCGCAGTAC
+CAGCAGGCCGCCGCGCACGTCGCCCTCGCCCCGGCCCCGGTCTACCCCCAGATCGTCGCC
+CAGACCCCGGCTCCCGCCCTGCCGCCCGCCCCGGCCCCCGAGCCCCAGCGCGCGGTGCCG
+GCGTACGTGTGGAAGTACAGCGCGCTCACCCTGTCCACCGGCGGCTGCATCGCGCTCACC
+GGCGTCGGCATCGGAGCCGCCGCCCCGACCCTCGCCCAGATCCCCGCCATCCTCACCGCG
+ACCGGCCAGGTCCTGATGAGCGGGACCGTCCTGGTCGTCGTCGTCCTCCTGCTGCTCGCC
+CTGCGCGGCACCGGGGGCGGCGGCGGGCGCGGCGGCAACACCTTCAACATCCGCAAAGCG
+GTCTTCCGGCGCAACACCTTCCGGGGATGA
+>orf00257 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCTACCAACGACCCCAACACGCGCGCCGAGAACGACCTCACCACGAAGGTCGCGACG
+ACCAAGACGCCCCCGCGCCTCAAGACCGCCCGCGCCTGGTGGACCCAGGCGTGGAACGAA
+GGCGGCATCCTGTACTCGCTGTGGGACGACGTCCGCCAGGCACCCGACGCCGGATGGCAC
+GGCATGGCCAACTGGATCAAGACCGCCCTCGGCATGATCGCGTTCTCGTTCGTCGTGTTC
+CTCTTCACCGGCGCCGTCGACGTCCTGATGGACGCCGTGGACCACCTCCTGACCGCCGTG
+CCCACGGTCCAGATCAGCGACAACACCTCCAGCGGCGTGTGGGCCACGATCGACAACCCG
+ATCCGCTCCTACATCGCCGCCCACAGCGCGGACCTGCCGATCAGCGGGGCCACCGTCTAC
+ACCCTGTGGCGGTTCACCGGCCTGTTCTGCCTGGTCGCCGGGTTCTTCACCCGCAACAAC
+GGCGTCCGTCTGACCTGGACGGCCTGGGGCGCGGCAGGCATCGCGATGGTGTGGACGACC
+ACCCCGGACACCAGCCGCACCGTCGCCACCGCCGTCGCCCTGCTGGCCTGGACGCTCGCC
+TCCGCCTTCGCACTGCGCGGCCTCAACCTGCGCCCCCGCGTGCTCACCAACATCGGCGCA
+CCGCAGATCACCGTCCAGCCCGAGATCCACGTCCCCGTCCAGCCCGGCCCCGCTGACAAC
+GACAACATCCGCCACCTGCGCTGA
+>orf00258 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCCCTCACCCTCTTCACCCGCCGCCCCGAGCCCGCCCCCACCGAGGAGGTCCTCCAC
+CCCGCGCGCTGCCCCGAGACCGGTGAGTCCTGGACGCCCGAAGGCGTCACCGTCGCCGAG
+CGCTACTACAACCTCGCGGGCGCGGTTGTCCTCGTCTACACCGCCGACACCTCGACGAGC
+CCCGGCACCTACTACGCGGTCGCCTGCCTCGGCTGCCACTACGCCACCCGCCAGGACTCC
+ACGTACGCGCGCTACACCCTGACCGCCGCCGCGAAGGTCGCCAACACGCACGCGAGCAGC
+TGCCGGGCACTGCCCCGCACCATCCCCGCCCGCCCCGACGACGACACCGTCCGCGAACGC
+CTGCACTCCTGGGTGCGCCGCGCCCGCCGCCAGGACGAGGGCGTCCAGATTTGGATCCGT
+GACCTGGACCTGATGCGCCTCACCCTCCAGCGCACCACCAAGTGGATCGAGGCCGTGCTT
+CATCAGCTGGCCGAGGACCAGCCGGACGTCCTCTGGATCGCGCACAGCCAGTACAGCGAC
+GCCGTCGCCTACTCCGCCCGCCAGCTCCCGGAGGCCTGA
+>orf00262 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTTCGCGCGGATCACGTGCTCCGGCACGCGGCGCTCGCGGGCCGCGTTGCGGGCGAG
+GCATTCCTCGAGCGGGGTGTCGAAGAGCACGGCGTGCACCAGACGCCCGTGGTGGCGGGC
+ACGCTGCACGAGGAACGTGCGCGCGGTAGGGGCGGTGTTCGTGCTGTCGGCGACGGTGGT
+CAGCCCGCGTTCCAGGCGCGCGTCGAGGACGATCTCCTGCATCGCGACGACCTGCGCGTT
+GGCGCTCTGGTCGCCCTCGTCGCCGGTGAGCAGGCCGCGGTAGGTGTCGAGGCAGATCCT
+GGAGGCCTGCGGGAAATGGGCCGCGGCAGTCGATTTGCCTGCGGCGGGCGCCCCGACGAA
+GACGATGAGGCTGCCGGGCGGGAAGCCCGCGAGCAGGCCCGCGCGGACCTTCGATGCCTC
+GCGTGTGGCGCGCTCCTCGTCCTTGCGGGCGAACTCCTCGTCGATCCAGCCCTGTACGGG
+AAGGCCGAGGCCTTCGGCGGCCGCGTACGGGTCGGTCATCTCCGGCCACTCGCCCTCCTC
+TTCCAGGGCGGCGGCGAGGGCTGTGGCGCCGTCCGGGTCGGTCTGGGCCAGGGCGGCGAG
+GGTGCGGTGCAGGTTCCACGCGGCAGCGCTCCCGGAGGCGTACGCCCACATCGTCTGCGG
+GTCGGGGGCGGCCGGGATGCGCATGGACAGGCGGATGTGCGCGTGGAGCGCGAACTCGTG
+CAGCGCGCGGACGTGATCGGTGGGCAGCTGTGTGTCGGACACGTTTTCTCCTCGCGTGAG
+GCGGCTGAGGGACCACCGCACTGCCCCGGCCCTGGAGGAGGGCCGAGGCAACACGGAGGC
+CCCTCAGCTGTGCGGGCCGGGAAGGTCGGCGGCGGCGTGCTGGACACGCGGCGGCGTGGG
+GGTGGGGTCGGTGGTGCCGTGGGCGACGGCTGCGAGGGTCCGGCTGAGCCGGTGTCCCTG
+CGCGACGGCGGCCTCCATGAGCTCGGTGAGGCGCGGGTCCAGGTTGTGGTGGCGGGCGCC
+GACGAGAACGCCTTCGAGGCGGGCGAGGTCGAGGAGGAGTCGGTCTCGGACGTCGAGGAC
+GGAGGGCTGGAGGGACAGCGCGGTCGGGTGCTTCGCGATGGCGAGCGCCGCGTGGTCGGC
+GAATTGTGCGTTCGCGGTCTCGGTCTGTTCGGCGAGCGCGCTGTCGATCGCGCGGGTGGT
+GGTGTGGGCGCGGTGCCGGCCGAACCGGGCGGCGAGCGTGTCGAGGCGATGACGAGTGAG
+GGGCATGAGGGCTCCGGTGTTCGGGGCGGGGTGGGGCTCCGGGACGGCCGGGCGCTGGGC
+CTGCGGCCGTCCCGCACCGGTCAGCGGCCCGCGCGGCGGCGGGCGTCGGCGAGGATGCTC
+TGCGCGTCGGGGTGGGCTTTGACGGCGTTGGACAGCGCGTCCCACCACCGGCGGGCGTAG
+>orf00263 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAGCGGCACCCCGAACGCCAGGACCGGGCAGGGCTGGGACCGGGCGGACTTCCGGTGC
+GGGCGGTGCGGCGCCCGCCGCACCGCGACCACGGAACCCGAGTACACCGCCGTTGTCGCG
+GCTCACCAGCACGCGCACGCGCTGTGGGACCGGCTCACCCCCGCCGAGCGGCTCGCGCTC
+ACCGAGGCCACCCGACTCGTCCTCGGCGATCTGCGCCTGAGCGCCGAGTGGCTCCACGTC
+GTCACCCTGCACGCCGAGCAGACCGCAAGGAAGGACCCGACCTTCTGA
+>orf00265 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAACGCCCTCGACCGCCTGATCACAGTGCTGCGCGAGCGCAGCACTGTCACGGACACC
+AACCCGCCACGCGGCTGGGTCGTCCTCCTCGCGCCCGACGGGAGCCACCTCGCCTACCTG
+CCCCTGGCCGCCCCCGACATCCTCCAGCTCGCCGAGGACTGCGGCCTCGACACCACCGGG
+GAGAGCGCGGACGCCGACCTGCTCTGGGACGCCCTCGACGACGCCGCCCCGCCCACCCTC
+CTCACCGGGGACTGGACAGCGCTGCTCCGCGTCCACGACGGCACCAGCACAGTCGACGAG
+ATCCGCCTGACCGACACCGAGCTCACCGACCTCGCCACCCTCCTCGACGACAGCGCGCGC
+CGCCGCGCTGAGCGCGAGCAGCTGCACGCCGATCATCCCGAGCTCGTCGCCGAGGTCACC
+GCGATCGCGGCCTGGCCCGAGGACGAACTCTCCGCCGACATCACTGCGATCGCCGCCTGG
+CCGGAAGACGAGCTCGCCGCTGAAATCGAGGATCTCGCCCCGCGCAGTCAGAGCGACATC
+TGCGTGCTCTACGCCGAAGTCCTCGCCCACGGCCGCCGAGTGGCTGCGACCCGCGCCCTC
+GACGACTGGTTCGGCGCGGTCACCGACCCCAGCGACGAAGACCCCCGATAA
+>orf00267 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGCGTACACATCACCTCCTTCGGGCACCTCCACGGCCCCCGCCCCCAGGACGCGGAC
+ATCACCCTGGACCTGCGCCCGTTCCGCGACCCACACTTCGACCCGGCCCTGCGCGAACTG
+ACCGCCCGCGACCGACGCGTCATCAAGACGGTCCTCACGACCCCCGGAATCCGCGAGCTG
+ATCGCGGCGACCGTGGCGCAGGCCCGCGCCTATGCCGCCGCGCCCGCCGCCCGCGAGCGG
+ACCCTGCACATCGCGGTCGGCTGCTCGGGGGGCCGACACCGCGCCGGTGTCACCGCCCAC
+GTCCTCGGCCGACGCCTGCGCCGCCGCGGCCACACCGTCACCGTCGTCGACCGCGACTTA
+CACCGCCCCGTCGTCGACCGCCCCGCCCCACGGTGA
+>orf00270 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGAGCAGGTGATGCCCCGGGCCCGCCGGAAGCGCCGTCGCGAGGCCCGCCGCGTCCCG
+CGCAGCGACGCGCACCTGCCCGAGTACGACCGCGGGGACTGCCCCGAGGGCCTCCTCACC
+CGACGGCAGTTACGCGACCTGGGACTGAGCCCCGGCGGACACGGCCCGGTCGCGGTGCTG
+CGCTGCAAAGGCTGCGCCTACCGGCCCGACCAGGCGTGCAACCACCCCACCCGGGCCTGG
+CTCTACAGCGTGGCGCTCGCCCGACCGAAGCGCACGCCGACGCTCGCCCAGGAATGGGCC
+CTGGACAGAGCGATGGCCGCGAGGTCCACGTGCCCGGAATGCAAGCGCCGGTACTACTTC
+AGGTAG
+>orf00272 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTGAAGTATGCGCTCAGACCCAAGGCCCGTAGGTCAGCCGCCGTAGAGGCCCCACTC
+GTCGAGGCCCCCGTAGATGTGCGCTTCGAGGCATTGCGGGGCGTCAAGGCCCACGGCCTC
+ACCCCGGTACACGGCGATGAGGGAGTCCTTGCCCCGCCACCACGAGTCGGTCACACCCTG
+TACTTCGGGTACCGGCTCGAATGCGCCGAGATCCAGTGCGTCGACGGCCTTGCGCTTGAC
+CCTCGTGACGGTCGTGGCCCAGCGGCGGGCATGAGCGGCGAGCGCCAGGGATTCCACCCA
+TCCGTCAGTGTTGGCATGCAGGGGCGTCCACTGGTAGGCGTCGATGCCGAACGCACCGTC
+GGGGCCGATCGCGAAGCTGTAGGCCATGGAAACCCGGCAGCCCCCTGCCGGGAACGACCA
+GCCTTCTGCGGGCATCTCCTCGGGGCAGTCGGCATCCAGGATGCGCGGACCGCCCTCGTA
+GAACGGGGCCGGCGGCAAGGCGAGGCCGCCCCAGCGGTCCTGGAAGGCAGCAGCCCGCTC
+GATCTCCGCAGCGGGGACCCCGTACTCGATCCACGCGTCGCGGTGTCGCCGGATGTCCGG
+CCGGCGAACACGTATGCCCTCCGTCTCGACAAACCGCTGGGCCCTACGGCTCAGGCCGGC
+AGGCGCGACCGGGACGGACGATACGGGCTGGTCAGCCATTACCGCTGCTCGCCGTCACCG
+GCGTGGAGCACGGCCGACGCAATCTCCCGCACGCGCTCCGGGCTGATCCCTGTGCGCTGC
+TCGACGGCGAGGGGGTGGTCGGTGGGCTCCAGCTCGACGAAGGGGCGCTCACCGACCGGA
+CGGGTATGGACGCGCGTCTTCAGGTTGAGCGTCGTCGCCGGGTATACCGGAAGATCGGTG
+GTGAGCCAGCCGAAGTACGGCTTCTCAGCCTCGCGGCCGGGCCTGTCCCACAGATCCGAG
+GCTTGGGAGAAGCTCTCTCGGCTGAGCGAGACCCAGACGCCCCAGGAGAACACCTCGGCA
+CTGCCGATGACCGGTATCTCGATCAGGCCCTTCACGAAGTAG
+>orf00274 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGGCCGCACCCGCACCCGCCTGAACCGGGTGCGCGCCTCCGTCGGCATCGCCCAG
+CTCGCCCTCCAGCAGATCGAGGACGACATGAGCGCCGACGACGTCGACGGCCAGGAGCTC
+GCCGCGATCCTGCGCGAGCTCCAGGAGGACGCCGACGTCCCCTGCGGCCTCTTCCCCGCC
+CTCGCGCAGCTGGTCACCGCCGCCGCACGCCGGGCGGAGCAGATCGAGCCCGACCGCGAC
+GGCGACGCCTCCTGCCCCCTGCACGAGGCCGCCGCCCTGCTCACCGACAACGCCGGGCCC
+CGCCTGAACTGGGCGGCCCGCTCCCTCGACCCGCAAGGAGATCTCGCATGA
+>orf00275 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTGGCCTTGGTGGTGGCGACCACGGCCGCGACCAGCACGGCGGTTCGGGCGCGGATG
+GTCAGGGCCGGGCGAAGGGGTGGACGAGCCACGGTGATTCTCCTTGATCAGGCGGCCAGC
+CGGTGGATGACCGGGGCCGTGGGGACGAAGTAG
+>orf00277 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCGAGCACAGCCTCGTGGTCCTCATCGGTGCGTCCGGCGCCGGGAAGTCGACGCTC
+GCGCGCACCTGGCCCGCCTCGCAGGTCCTGTCCCTGGACGCACTGCGGGAGGCCGTGGCC
+GACGACGCGGGCGACCAGGACGCGACCGGCGACGCCGTCGCCGCCCTGCACCTGCTCCTG
+GAGGCGAGGATGCGCCGCCGGTTGTTCACGGTCGTCGACGCCACCAACGTCACGGCCGCC
+GCCAGGAAGCCGCTCATCGCCGCCGCCAAGCGCCACGACATGCTCCCGATCGCGGTCGTG
+TTCACCACGCCCGGCAGCATCTGCATCGAGCGGCAGGGCCCGCGGCCGGCCAACCGCACG
+GTGCCGGAAGAGGTGGTTGCCCAGCAGCACGACGACATGTTCGCCTCCCGCCGCACCCTG
+CGGGCCGAGGGCTTCCCCGAGATCGTCTACTCCGACAGCATCTGCCGACTCGCGCCGTAC
+CTGGAGCGCCTGAGCGAGAGGCGGCAGGCCGACCTCGGGCTGGACGGTGGCGCCGGCCTC
+GGTGACCTGAACCTCGTGGCCCGGGTGTTCGGCGAGAACATCCTGCCGCTGTGGCAGTGG
+AAGCCCGGCTCGAACATCGCCGGCGGCGACCGCGTCGCGGAGATCCGCCTCGGTCAGCAG
+TACCTCACCCTCGCCCTGCGCACCGACGTCGACGGCGAGGGCGACGTCGGGTTCGACGTG
+ATGGTGCCGTGCCCGCACGACGACGAATGCACCGGCCACGCCTGGGTGCCCGCCTACAGC
+GTCACCTGCCTGTTCCGCGCGCTCAACGGCGACCTGGACGACGACGAGGACATCGTCTGC
+ACCGTCCACGGCCCGAACACCGACGAGGACCAGGAGGACGATCCCGAGGGCCGCGCCGAC
+CTAGAAGAGCAGTTCGCGACTGCGGTCCGCGAGTGA
+>orf00279 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGCCCGCAAGCCCATCACCTGGTACATCGCCACCCCCACCGACGGCACCATCGAGATG
+TCCCGCGAGGCCGGAACCCCGGTGGACCTTTCCGTCAACGTCGGCAAGGCCATCGACCAC
+CCCAACCCCTGCCGCAACAAGTGGTACGACGAGAGCGGCTTCTCCTACTTCCGCATGGTC
+AAGCGCGTCGGCGAGGCGCTGGAGGACACCGGTATCTGGCCCATCACCTGGCCCGTCCGG
+TTGTGGATCGTGGAGCCGCTCGGGGAGACCGGCAACTGGAGCCAGCGCCACTACCCCTAC
+CGGCTGCTCTCCCACCGGATCCGCGTCCTCGAGGAGACCGACGCCCACCGCGCGCTCGGA
+CCCGCCGGCCTCGACGTCCTGAACGTCGTCCAGCAGGAGATCCCCGAGCGGGCCGCACGC
+TGGGCCGCGGACTGGGACGCCGACCCCGAGGGCATGCGCGTCCGGACGTGGAACTGGGAG
+CAGTGCGGCGGTCCCACCTGCGGCAGCGGCCGATGGGCGGACGAACTCGCCATGGCGGTC
+TCGCACAACCGCCGCGAGTCGGGCGCCCAGACCTGGATCGAGCACCTAGCGCGCAACGCC
+GTCGACCAGGCCCTCGCCGACACCGACGCCAGCATGACGGCCCGCTGCTACGCCTACGGC
+CGCGCCACCGGCCACGCGGTAGCCGCCCAGCACCAGAGCCGCTTCGAGCCGTACGTCCTG
+GACGCGCTGCGCGGCGTCGGCCTCGACTCCCCTGCCCCGGCCGTGGCCGCCTGA
+>orf00280 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGACTCCGTCCTGCACACCACGGGCCGCTTTGGCCCACGCACCCTCCTGATCACCGCC
+GCTGCCGTCCCGCTGACCGGCTGGGCCGTCCACGCGACCGTGCTGCTCAAGCAGATCGCT
+GCCAAGGAGAAGGACCCGCTGACCGGGCTGCTGCGCCGCGACACCTACACCGCCCGCGCC
+CGCCGGATCCTCGCCCGGCACGGTGACAACACGACCGTGGTCATGGTCGACGCCGACCAC
+TTCAAGCAGATCAACGACCGCGACGGCCACGAGGCGGGGGACGCGGTCCTCGCCGCGCTC
+GGGCAGCGGCTCACGGCCTGGGCCGGTCCGCGCGCGGTGTGCGGGCGCCTGGGCGGCGAC
+GAGTTCGCCGTCGCCCTCCCCCTGCCCGCCGAGCACCGCGCCGAGCGCCTGGAGCAGCTC
+GTGCGGGCACTGCACGCGCCGGTCCGCCTCGACGACGGGCGCCTCATCCAGGTCGCGGTC
+TCCGTTGGCGCCGCCACCACCGACACCCTCCACACCCGCGACCTCGCCGCGCTCCAGCGC
+GCCTCGGACGCGGCCCTCTACGACGGCAAGCACACCGGCCGCGCCGTCCTCGCGACCACC
+GCGCACACCCGCGTCCCCTCCATCAACGGGCGCAGGATGGGCCGTCCCGGCACCAGCGTG
+TGGGGGCAGGCCGCATGA
+>orf00283 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTGGCGCGGATGGTTCCTCATCCACGCCGGCCGCGGCACCGACCACCAGGCGCTCAC
+CGACCCCCGCGTCACCTGCACCTTCCCCCGACAGCCGCTGGAGTTCGGCGCCGTCCTGGC
+CGTCGCGCGCCTGACCGACTGCCACCAGGACGAGCCCGGCCGCGCCTGTTCGGCGTGGGC
+CGACCCGGAGGCGTGGCACCTCACCCTCACCGACGTCACCCCGCTCCTGGAGCCGATCCC
+CGCGCTCGGCCGCCTCGGCCTGTGGCGCCCCAGCTGCGAGCTCACCGCCCACGCCCTCGC
+CCAACTCCCCCACCTGAAGCCGTGACGCGCGCGAACCGGCCGAAACAGCTGTGGGAGCCG
+GGTCTCATCCCGGCTCCCGGCGCCCTCCTGGACTGGCGCGACGCCCGCCACCACGACGCC
+CGCAACGCCTACCCCTGCACGCTGTGCGGCCACCCCACCCACCTGCGCTCCCACACCGGC
+GAACCCGCCCATAAAACGTGCGCCGAAACGTGGATCGCCACCCACTACCCCGAGGCCCGC
+CGCACCGCGCGCTTCGCCTCCGACCCGGCCCCCGCGCGCCGCTCCGATGCCGCCGACGAC
+CACGCCTGA
+>orf00285 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCGTGAACCACACCCCGCGCGCCGACTCCGACCGCGCCCTCGCCTACCCCGAACCC
+CCCGCCACCTCCACCTGGCACCACACCACCACGCCCCGCCCGCGCACCCGCAAGCTCACC
+CCCGAGCAGCAGCGCCACAACCGCGAACGCCTCCAGCACGAGCTCAGCGCGAAGTGA
+>orf00286 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTACGCCGACCTGAACCCCGCCCAGACCGCCGAAGCCCTCGAACTCACCCCACCCAGC
+CCCGACACCGAAGCAGCCGCCGCCCGCACCGTCGCCCGCCACGCCCACGGCAAGGAGGAC
+CTCGTCCTCCTCCTCGACGCCCTCGGCCTCCCCCACAACGACGACACCCTCACCGCGCTG
+TTCCCCCTCCTCACGGAAACCGGAGCCACCCTTCCCATGACCGCCAAGAACCCCGCCACC
+GTCCTCGCCCCCGCAGTCGATATCGCGGCCTTCGACGCCGCTCCCGCTCCCGCTCCCGCT
+GGCCGGAGCGTGTCTGCGTTCGAGGCCATGGCCCTCTCGATGCACACCAACGGCGACAGC
+ATCCAGGGGATCTGCGCGGCCACCGGCCTGAGCGAGACCGAACTCAGCGACCTCCTCGCC
+GCCCCGGCCACCGGTACCCCGGACGTCGCGCTCGCCGTCACCCCCGAGATCCAGGAACTG
+CTCGACTGGGCGGCCGCGCACCCGGCCGCCTCGGTCCGCAGCCGCGCCGCCCGCATCACC
+GCCGACCTGGCCGAGCTGTCCGAGCGCCGCGACAGCGAGGCCGCGCAGCGCGAGGCCGAA
+GCGAAGGTCGCCAGGGCCAAGGCCGAACTGGAGAAGGCGCAGGAGGAGCTGCGCACCGTC
+AAGGCCGGCACCCGCACCACCACGGCGGCCGCCGTGGCCGCCCCGATTCGCGCGGCCCTC
+GGCAGCGGCCGTACCCGGGAGGAGCTCGCCGCCGTACGGGCGTGGGCGCGCGAGAACGGC
+CATCAGGTCGCCGACACCGGGATCGTGCCCAAGCGGGTCCTTCAGGCGTACGACACCGCG
+CACCGGGCGCCGGTCCGGAAGGCCGGCTGA
+>orf00287 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCGACGACGCGATAGCCCTGGACGAGGAGACCGTGCCCGGCGACCTGCACGGATCG
+ACGGCGCGGTTCCGCCTCACCGTCTCCCCCACGGACGAGCGCACGGACGAGATGATCCTT
+CCCTGCAGCGTCACCGACCCGGCGCTCGCGCACACCGTCATCCACGACCTGGTCCCCGGC
+GACAAGCTCCGCGTCACCGGCCACCTCCGGCTGCCCCGCACGCCGGACGAGCCGATGCGG
+CTGGACGTCACCGAGCTCGCCGTGCTGGAGACCGCGCCGGAACTGTCCGACCCGGCCGCC
+GTCACCACAGCCGTCCTCGAGCGGCACGGGCCGTACGTCTGCTGGTTCGACGCCGAGAAC
+TCCGGTGAGATCCCGGTGTGGACCGAGGCCGGGGTCTGGGTCGGGCACGCCGGTGACCCG
+GACGCTCTGGGCGAGCTGATCGAAGCCTTCGAGCAGCGCCAGGCCGCCAGCGGCGAGCAA
+TAG
+>orf00288 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCCATCCGTCCCGAGAACCTGCACCGCTACCCGCGCAACTGGCCCCAGATCAGTGCG
+CGCATCCGCTTCGAGCGGGCGGGCGGCCGCTGCGAGTGCGAAGGCCAGTGCGGCCTGACG
+CACCCGGGCGGCCGCTGCCCCGCCGTCCACGCGGAGACCCACCCCACTACCGGGTCCGTT
+GTCTGCCTCACCACCGCCCACCTCAACCACACACCCGAAGACGTGCGGGACGAAAACCTC
+CTCGCCGCCTGCCAGCTCTGCCACCTGCGCATCGACCACGGCCACCACCAGGTCACCCGC
+GCACGCACCCTCGACGCCCGTACGGCGGCCACCGGACAGCTCGGCATCCTCGACAACGCC
+GACCTGGTCCGAACCGAACCACCCACCCCGCCGCCCCGGCCGCCCGCACCCCGCACAACA
+CCCGCCGACCGCCAGCAACTCACCCTCACCGACCAGGAGGCCCCCTGA
+>orf00290 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCAAGCAGCCCCAACCCCCGCGCACCGTCCTGGAGCGCTTCCCCGCCGGAGGCCCC
+CGCGGCTCCTGGCCCGCCGAAGCGTTCGCCGCCGCCCAGCGCGCTCAAGGTGCGCGGGTG
+CAGGTCGTCATGGACCTGCACACCGACCAGTTCCTCGTGGTCACCGACACCACTACCCAC
+TGA
+>orf00292 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACCGAGACCGAGACCACCCGCTACACCGCCGACGTGGTCGCCCTGACTCCCGACGGC
+AACGTCCTGCTGATCGAGCGCGACTGGCCGCCCTTCGAGGGCGCCTGGGCGCTGCCGGGT
+GGCCACCAGGATGAGGGGGAGACCAGCCGCATGGCGGCTGCTTGGGAACTCCTGGAGGAG
+ACCGGGGTCCGCGTCGACCCCGACCAGCTGCGCACGATCGGCACATGGGACCAGCCCGGC
+CGCGACCCGCGCGGCAGGTACAGCACCGACGCCTACCTCGACGTCGTCCCCACCGGCACT
+CCGATCACCGCCGGGGACGACACCCGCACCGCCCGCTGGTGGCCTCTGGACGCACTTCTG
+GAACGGCTCGCGTTCGACCACGCCGACATCCTCCACGCGGCCACAGCGTCCAGCGCCTGA
+>orf00294 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGTCGTTTTGACGGCGCTCCACACGGGGCAGGAGCGGTGGATGAGTACCGCCCGCCGC
+CGCCTGGGCACAGGCCCCCAGCCCGGTGTCCCGTTCTTGCTGGCCAAGAGGGTCGCGTCG
+GATGTTGAGCCCCGCATCCCTGCGGAACGGCTCCTCGACGTGCCCGAGGCGGTCCGGGCC
+GCCGCCACCCGCGCGGTGGCGGACGGGCGCCGTGTGCTCGGCACGAGACCGGCCCTCCTG
+AAAACGTGA
+>orf00295 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACCGACCTGGTCGGCGGGCTGCGGGATCACGGCACGGATGCCTCGCCGCCGGAGATG
+CTCACGGATCGCGCGGGATGCATACGCGCGGTCCGCCAAGACGGCGTCCGGCCGGGCAAG
+ACCCGGGCCGAGCCGGCCGCACCCGTTGGCAGGCCTCCCGTCACGCTGTAG
+>orf00297 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGTCTTTCGACACCCCGACGGCGACTATGCGATCACCGCAATCTACTCCGTGCCCGAT
+GACGCCTGGCATCTGGAACTGGATCTCGTGGCCGGGCAACGGAGTCTCGTGACCGCAACC
+ACCCCCGACGAGGATCCGGCACGGGAGCCGACAGTGCGCTTCAACCCGAGCGCAGAACAC
+ACCGACGTCCCGTACGAGGTCATGCGCTGGTTCATGCACCAGGTTGATGAAGAGATCCGT
+AGCTCCCGTGCCTGGATGCGGCTGAGACCGGAGCTCGTCGAGATCGTCTATCAACTACGT
+CAGGAGCACATGGGTGTCATCGACGATGACGCCTTTCCCCAGGTTCTGGCGGACATGCGT
+ACCACGGTGCCTGAGGAGGACCTCCCCGCCGTTCTAGAGGCCGCCTTCGGGCGGAACCCT
+GACGGCACCACCAAGACCACCCGCAAACGCCCCAGCCTGTAG
+>orf00299 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCCTCCCCCACCGAGCTGCCCCCTCACCGGATCAGCCTGAACCCGGACAACCCGCGC
+TCCTCCCTCGGCGACCTCACCGACCTCGCCGGAAGCCTCAAGGACCACGGGCAGAAGCAG
+GCCATCACGGTCATGAACCGCGACGCATACATCGCCGCGAACCCCGCCGCCGAGGAGAAA
+CTCGAACCCGACACGGCATACGTCGTCGTCGACGGCTCCAGCCGTCTCGCAGCAGCCCGC
+GAAGCCGGCCTCACCACCGTGAAGGTCATGGTCGACGACGGCCAGGGCGGCACCAGCGAA
+GAGATCCTCGAATCCGCCCTCGTCGCCAACATCCACCGCCGCGAACTCTCCGAACTGGAC
+GAAGCCCGCGCCCTGCAACGACTCCTCGCCCTCCACGGCTCACAACGTGCCCTCGCCGCA
+CGCCTGCACCGCTCCCAGCCATGGATCTCGACGCGCCTCGCACTCCTCGGACTCTCCGAA
+GAGATGCAGAACCTGGTCGGCACCGAGAAGATCGAACACCTCCGAGCCATCGGCAACAAA
+CCGGCCGAGGAGCAACCCGCAGCGCTCCAGGCGCTCAAGGACAAGGAATCCACGCAGCGC
+ACCGTGCGGAGCCGGAAAGGTGCGGCCACCCAGGCGGCCGACACGGGGGAGCGGGCCGAG
+AATGATTACGGCGTAATCGCCTCACCGAACGTGCCCGAGAGCAGAAAACAGCCGGCGCAT
+GATTACGCCGTAATCACCTCCGCCCCCGCCTCATCATCCGAACCGCCTGAGTCGTCGCAG
+CCGCCGCGCCCTCCACAGCCCGCAACTCCCCGCACAGCGCCAGCAGCTCTCATCCCGGTC
+ACAGCGATCCCATGGCGGCACGTCAACGTTGTCCACCGGATCCTGCGGGAGCACATGACG
+CCGGAGGACTACAAGGCGCTCCAAGAGCTCATGGCCACATGA
+>orf00300 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGTTAGTAACATCTCACCCATGAGTCAGCCCAGCGACCGCGAAAAGGTCGTCTCCAAA
+CTCCCCGCCAGCCTCCGCCAACAACTCAAGATCCGTGCGGCACAACATCGCCTCGACATC
+CAGATCGCCGTGGAACAAGCCATCCACGCCTGGACCGCCCTCGCCGCCTCCCCCGCAGCC
+GTTGACGTCAGCGGCGCCAGCTCCTTCGCGACCTTCCTCCCCCCGGGCCAGTGGGACACC
+TTCAAGAAGGCTGCCGCCGCCCGTGACGTGACTCTTACTCAGGGCCTGGCACAAGCCGTG
+CAGCTGTGGCTCGACATGAACCCCTCCCCCGAGGTCATCCGTCCAGAGACAACCCGCCGC
+ATCATCGTCTGCAACCAGAAAGGCGGTGTCGGCAAGACCGCCATCACGGCAGGGACAGGA
+GAAGCCCTGGCCGAGAACCCTGACACCCTGCGCCCGGTACGAGTCGCCAAGCAGCTCGCC
+GCCGCACAACTCGCATCACCGGAAACTGACGGCAGCAGCGACGCGCTCGAGGTAGAAAAC
+CTCCCCGGCCTCGGCTTGCGCGTCCTCCTGATCGACTTCGACCCCCAATGCCACCTCACC
+CGCCAGCTCGGCGCCGAGCCCCTCCCCCTCGACGGCGACAGCCTCACCAAGCACATGGGC
+GGAGAGGCAAAGGGCGAACTCCGCGACCTGATCGTCGCCGTCGACCAGGAACACTTCGGC
+GACCGGCTCCACATGCTGCCCGGCTGCAACGACGCCTTCCTCCTCGACGTCAAACTCGCG
+TCCGTTCGCGCCAGCGAGAAAGCCCTGGAACGAGCCCTCGCCCCCCTCGAAGGTGATTAC
+GACGTAATCATCGTCGACTGCCCACCCAGCCTCGGCCTCTCCATGGACGCCGCGATCTAC
+TACGGCCACCGCCGCGACGGCGAAGCCCCCGGACAGTCAGGCACCCTCATCGTCGTCCAG
+GCCGAAGACAGCTCCGCCGACGCCTACGACATGCTCACCACCCAGATCGACGACCTCCGC
+AGCGACCTCGACGTCGTCATCGATTACCTCGGCATCGTCGTCAACCTCTACGACGCCCGC
+CGCGGCTACATCGCCACCAGCTCCCTCCAGGGCTGGGTCGACATAAAGGACCCCCGCGTC
+GTCGGCCTCGTCGGCGACCTCAAGGAGCAGAAGGAAGCCGTACGCATGCAACAACCGCTC
+CTGTCCTACTCCCCCACCTGCACACAGTCCGTCGCCATGCGCGCCCTCGCCCGGGAGCTC
+GCATGA
+>orf00302 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAGCGAGCTGCCGAGCGTGTGGGACCTTCTGGGGCGTCTGGGCCTGGCGGGCGGGGTG
+GTGGTGGGGGTGGTCGGCGCCGTCGTCCTGTCGCTCGTGATCGTGCCCGCCGAGGACTTC
+AACCGCGGTTTCGAGACGGGCGTGCGGGCAGTGGTGCGGTACCTGTCCGGCCGCGAGCTG
+GGCAGCGGGACCGCACCAGGTGACGCGACGTGGTGGCGTCCGGCGACGAACGAGGCCCCG
+GCGCCGCCCCCGAGGGCCCGGCCCCTGCGGGCGGCTGCGACGGCGGTGAAGCGGTGCGCG
+GTACGCGCGAGGACGTCGGGAGTTCGGTACGGGCGGCGGGTGCGGGGACGGGTGCGCGAG
+CGGTTCCCGGACGTGCTGCGGGCGGCGGGGCGCGGGGTGAGGTCGGCGGCGGGAGCGGGC
+CGGGCCGCGCGGTCCCTCGCGCAGTGGCCGGCACTCGGACGGGCCGTCGCCCGGACGCTC
+GCGCGGAGCGGACCGGCGGCATGGGCCGCAACGGCGGCGGCCGGGGCGGCGTGCGGGCGC
+GGGGCGGGCCGGGCCGGGCGGTGGACGGTGCGGGCCGGGCGGGCGGCGTACGCGGCGGCG
+GTGCGGTCGGGACGTGCCGCAGGGCGGGTGGTGAGCGGCGCGGCCGTGGGAGTGGTGCGG
+GTGCTGCGGGCGTGGGGGCGGTGGCCGTACGCGGCGCGCGCGGCCGTACGGATCGCGCCG
+GGGGTGCTGGCGTGGGGGGTGCTCGCGGCGCCGGGGACGACCCGCGCCGTGGTCCTGGTG
+CTCCTCGGCGCCGTCGTGCTCGCAGCGCTGAGCGGGCCGTCAGGGGCCCGGTGGTGGTGT
+GTGCCCCCGGCACGGGAACGGCGCGCCTAA
+>orf00303 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGACGGCCCGACCGAAGAGACCCTGTGCGTGGACGGCGCGCGGCTGCGGCGCGCGCGC
+GAAGCCCGGCACCTGACGCGCCCGCAGCTCGCCTCCCTCCTCGGCGTGGGCCCCGACTGG
+GTGAAGAGGGTGGAGACGGGGCAGCGCACCGAGGACAGGCTGCCGACGCTCTACCGCCTG
+TGCCGCGTCCTGGGCCTGACCGACGTCGCGGAGCTGACGGGCGGGCAGACGTCCATGCCC
+GTGGCGACCGGCGGGCGCCTCGCCCACCCCGGCGTCGAAGAGCTGCGAGCCGCGGTGCAC
+GCGCCGCTCTTCGTTCAGGAGGAGCCCGAGGACGTCGGTGTCCTCGCCGGGCGGGTCGCC
+CGGACGTGGGCGATCTGGCACGGAGTGCGCGAGCAGCGCACCGCTGTCGCAGCCGTACTT
+CCCGATCTCATCCGCACCGGGCACGCCACGATGCGCGCCGCCGAGGGCCCCGAGAAGCGC
+CGCGCCGCCGTGGTCCTCTCCGAGGTCTACGCCCTCGCCCAGCAGTACGCCGCGCACATC
+GTCGACCCGCCCCTGTACTGGACGTTGGTGGACCGGGCCCGGATGCTCGCCGAGACGGCC
+GACGACGTGCTCGCGCTCGCGGGCGCCGCCTGGGTCACCGGCAACGGCTTGCGGGCGGCG
+GGGGACACGGAGGGCGCGCGGCGCGTCGCGGCCGACGCCGCCGAGACCCTGGAGCGCAGC
+ACCGAAGACGGCTCCGACCGGCTACGGGGGCTGTACGGGAGCCTGTGCCTGCACGTGGCC
+CTCAGCGCCGCCCAGGAGCGCCGCGAGGGCGACGCGTGGCACTGGTGGGACAAGGCCGAC
+CGCGCCGCTGCCCGCCTCGGCACCGCGTACATGCACCCGTGGACGGCGTTCGGCGAGGGC
+AATGTCGCCGTGCACGGGGTGAGCATCGCCGCCGACCTCGGCGCCCACGGCACCGCGCTC
+CAGCGCATGACCGAGGTGGACCCGGAGACGATCCCGAGCGTCGAGCGCCGCTCCCGCTTG
+TACCTCGACGCCGCGCGCGGCGAGCGCGCGCGGCGCCAGGTCGCCGCCGCCCTGACGTAC
+CTGCGTCTCGCGGTGGCGACCTCGCCGGAGGCGGTGCGCTACGTCCCCGCCGGGCGCGCG
+CTCGCCGAGGACCTCGCTCGTACCGCCCCCGCGCCCCTACGCCGGGCCGCGCACGAGGTC
+GCCTCACTCGTCGGCGTGCCCGTCGAGTAG
+>orf00305 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGACGGGCTCTCACGCTGAGAAGGTGCCGAACCTGGAGTACTACACCGATCTCCCGCGC
+GCGCTGCGCCGCCCCCGCCTCGACGCCGACGGGGAGCGCTGGCTGCCCGTCGCCGTGACG
+AAGGAGTGGCACAAGGAGGGGGAGGTCGTCGTGGTGTTCCTGCGGCCCGCACGCGGGGGA
+GGGCGCGAGTGGATCGTGCCCCTCCCCGACCTGGACACCCTGACCCGGGAGGCGACCCCA
+TGA
+>orf00306 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGGTCACCCTCGGCCGCGCCCCCGCCATCACGGCCCTGCGCCTCGCCGCCGTCCTCACC
+CACGCCGCCGCCGTCCTCCCCGACCTGCGCGCCGACCGCGCGGAGCCGGGCGAAGAGGAG
+GACGCGGCCGACGCCGTGACCGCGCTGCGTACCGCTCTGGACCGGGTGGGCCTGCGGCTG
+CCCTCTCTGGGCGCCGAGCGCCCCGCTGCCATGGGCACCGCCATGGTCGCGCTCGGCGGT
+GCCGCCTCCGGCGTCGCGGTGAGCCTCGCGGACGTCCTCACCCGCACCGCCGACGCCGCC
+CCGGTCCTGCGCGCCGACGCCGCCGAGCCCCCCGGCGCGGCCCGGGAGTTCTGGCCCCTG
+CCCGCCGTCCTGCTCCGCGACGGGCACTGCCTGCGGTACGGGGGCGTCACCCGCGTCGCC
+GCGCAGGCGCCCCGGCTGCCCGCCCCCCGCGCCTCCACCGCTCCCCGGCTCGAAGTGCGC
+TGCGTGGACGGCACCACCCTCCGCATGTCCCCCCGGGCCGCGCTCGACGTGTACCTCCCC
+CTCGCGTGGCGGCTCTCCCTCCAGGACGGCCCGCGCCCCTGA
+>orf00307 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCTGAGCGGAACATCGAGTTCGGCGCGTACGGCGCCCAGGGCGTCAAGGGCCACGAG
+TTCGTCGCCCGCCGCCTCGACAGCCTCGCCGGGTTCATCGCGTCCCCGGTCACCACCCGC
+CGTGGCCTGACCGCGCGGCTGCGCTACCTCACGAGCAGTGCCCGCCAGCTCGCCGCCGCC
+CGGGAGGCCGGGCTCACGATCTCGGACCGCACGATCAAGGCGCAGATGCAGGGCACACGC
+CGCCCCTCCGCCCGTACGCTCCGCGAGATCGACGCCACTTACCGCGCGGTGCGTCGTCAG
+AACGTCTCCCGGCACCTCCTGGCCCGCCTCAACCGGCAGGGCCGGGGGACCCGCGTCGAG
+TTCCACCCCGTCAATCAATCCGGGGTGGAACGCCCTCGCCAGCGGGTCGTGGAGTACCGC
+ACCCTCAACGTGCGCAAGTGGGAGCGGATCGTCGGCGCGTGGGAGGCCGGGGACGACGCG
+GGCCTGGATGCCGCGTGGGTCGACGAGGTGGTGGTCGACCTCGGTTCGCAGTGGGGTCAG
+TACGAGTACGTCACCAACATCGGCTTCGCCGCCTGA
+>orf00310 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGACTGACCTACCGCACAACGAGTACATGGCCGCTGTCGCCGACGCGCTCGCCGCCCGC
+GACATTGCGCCCGCACAGTGGTGGACCAGCGAAGACGACTCCGGCGCTGGCACCGACCGT
+CTCGACGCCGTCTTCCAGTGGCACACCGGCGTCGCGGACCGCGACCACTGGCCGCACGGC
+GTGTACCTGAGCTGGGACCAGTACGACGGATGGCGCCTCATCGAGGCCGGCGGAGGCCGG
+AACATCTACGACCTTTCGCCGGATTCCCTGATCTACTGCGACCCGCGGCAGGTCGCCGCC
+GACGTTCAGGCCCGGCTCACACACGGGCTCGACGGATGGTCCCCGGGCCCTATCTGCGTC
+GTCGGCGCCCGGTGGGACGTGCGCCCCACGATGGCCGCTGTAGAACGCTGGGAGGCGGCG
+GCCTGA
+>orf00311 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTTTTGTGGCTCCAAATTGAGACTCGACACGGGTGGTTGTGGGCGTACGACCTGGAG
+CACCTCGACTTGCTACGGCGCTTCGTCCAAGCACCGCTGCGCGAACGAGCGCCCTGGTAC
+GACACCGGGCAGAAGATGACGTTGGTCGCCCGTCTGCCACTATGGATCAAGCGCGCGAAG
+AATCGGGACGAGATCCTGCGCGGCATTGCTCGAATCCGCGCATCACTGGTCTGTGCCTGA
+>orf00316 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTGCGAGGGCGAGGGCGTGGTAGGTGGCTCGCCGTTCGAGGGCGAGCCGGAGCAGGGC
+ATCGTTCACACCCCTACCCGATCACATGTTCGATTTTTTGGGCAACCGAACCCGCGCAAA
+ACGCCACATCACCGCCGTGCGCGCGCTCTGGCCGGTCGTACCCTCGCTGGTGTGACCGAT
+TTCCCCGACGATCTCCTCGCGGCTCAGCGCGACCTCACCGCCGTACGCGCGACCCTTTCC
+GCCCGCCTCGCGGCGCTGCCGCCCTCGGCGGAGCCGATGCCCGCGTGGGAGCGGCCGGAC
+GGCTACTGGGCGGGCGCCCGTACGCACCCGGCCTCCCCGGGGTGGAGCGAGGAGGAGCGC
+CAGGAGGTCGCCGCGCTCCGCGAGCGCGAACGGGATCTCGCGGCGGCGATCGTGACGCAC
+GAGCTGTGGGCGAGCGTGCCGGCCGAGGAACGGATGCGGGCCCGCGACGCACTCAAGCAC
+GCCCACGAGACACAGGCCGCCGAGGCGGCGGGGGCCCGGGGCTGA
+>orf00317 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCCGCCCGCCCGCGCCCGCGTCCCCGCCCTCGCGGGGGACCAGGTGACGGCGGGGGAC
+GGGCGCCACCGCGTGCTCGCCGCCGTACGGGACGCGATCGCCGAGACCGGCCAAGGCCCC
+TCCGTACGGGAGATCCAGCGCGTCACCGGGCTCGCGCTCGCCACCATCGCCCACCACCTG
+AAGGCCCTGGAGGAGAGCGGCGCCCTCGTCCGTACGGGCCTGCACTGGCGCACCTGCCGC
+CTGGGCTGA
+>orf00319 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGTCGGGCCACGAAGGCGCGAGCAGCAGCGGGGCGCCGGGGGTGTGGGTGGTGCTCGCG
+GACGGGCAGGAGGTGCGGGGGCGGCTCCTCGCGCGGCGCCAGCTCCCGGACGGGTGGCGC
+TACCGCGTCGCGCTCCCGCTCTACCGCAACGTGGGCGGGGAGGGCCTGGAGGTCGAGGCG
+GCGCAGTACGAGGTGTGGGTGCGGGCCCCCGAGCATGTGCGGCCCGTCGAGGACGTCGAC
+TACACGGGCGTGCCGACCACGGCGCTCCCGGCGCCCTCGCTCGTGGAGGTGGCGCTCGGG
+CCGCGCAGGCCCGCCGGGTGGGTGCTGGCGAAGAGCGGCGGCGGGCGCCGGGGGCCCTCC
+CGTGCGGTGCTGCACGCCGTGGACTGCGCCGAGGCGCCGCCCGGCCTTCCGGTCCTGCGG
+GTGGAACAGGCGCTCAACGCTGCCGAGCACCCCGCCACCCGGGCTTGCGCCCTGTGCGGG
+GCCGGTGCGGAGCTTGATCCGCTTCTGCGGGGCTTCGACCCGCAGGAGGACGCGGTGGGA
+GACCCCTGA
+>orf00320 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGAGCTTCGGCCTGGTCACGATCCCCGTGAAAATGCTCCCCGCCGTCGGCGACCACAGC
+ATCCACTTCCGGCAGATCCACACCGCCGACGACGGCCTCGTCCGCAACCGGAAGGTGTGC
+GAACTCGACGGCAAGGAGCTGTCGGCCGACGAGATCGCGCGCGGGTACGAGGTCTCGAAG
+GACACCGTGGTCCCGCTCTCGGACTCCGACTTCGACGACCTCCCCCTCCCCACCGCGCGC
+GCCCTGGAGATCGAGGCGTTCGTCGACGCCTCTGAGATCGACCCCATCCAGATGGGCGAC
+ACCTACTACCTCGCCGCCGACGGGCAGGTCGCCGCGAAGCCGTACGCGCTCCTGCGCGCG
+GCCCTGGAGCGCACCGACAAAGTCGCCCTCGCGAAATACGCGTTCTCCGGGAAGGAGCGC
+CTGGGGATGCTCCGTGTGCTCGACCAGGACGTCATCGCGCTCCAGGTCCTGCACTGGCCC
+GACGAGATCCGCTCCCCCGAGGGACTCGCCCCGCCCAGCGTAGACCTCACCGAGGACGAG
+ATGACCGGGGCGCTCGCCCTCATGGACACCATGGCCCGCGACGGCATCGGCGACGAAGAG
+GACGAGTACCGCAACGCGGTCGAGAAGCTCGTCGAGGCGAAGGCCGAGCACCGTGCGCCG
+CCGCGCGCCGAGCGCGAGGAGCAGCCGCGCGGGGAGGTCGTGGACATCATGGCCGCCCTC
+CAGGACAGCGTGGACCGCGCGCAAAAAGCCCGCGGCGAGACCGGCAAGGACGCGACCGTC
+CACGAGATGCCGAAGAAGCGGGCCGCGAAGAAAGCGCCGACGAAGAAGACCGCAGCCAAG
+AAGGCAACGTCGAAGAAGACGACCGCGAAGAAGACGAGCCGGAAGAAGCCCGCCTGA
+>orf00322 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGAGAATCCGGGCCCATGACGGACCCTCAGCAGCCCTCGCAGACCGACCGATCGGAT
+GCCGACGACGTCGAACAGCACGCCTGTCCGAAGTGTGACACGCAGCCCGGCTCGCCGTGC
+CGCTCGCGCGGCGGCGCGGTTGCCTCCGCCTACCACACCCGCCGCTTCACGATGGTGCCC
+CGGCTGAAGAAGGCGCTGCGCGTGCCGACCCCGGCCGACCGCGGCCCGGGCCGGCCGTGG
+CGGCCGGGCACCCCGCCGCCGACGCCGATCGATCCGGACCTGCCGAGCGCGGACATCCGC
+ATCGGCTACGCACGGTGCTCGACGCTCGGGCAGGAACTCGACTCCCAGCTCGACGCGCTC
+GCGGGACACGGCGTCCCAAGGGACAAGATCTTCAGCGAGAAGATCAGTACCCGGGTGCGG
+GTCCGCCCGAAGTTCGAGGAGGCGCTGAGGACCGCGCGGGAGGTCAAGGCGCACGCCCCG
+CACTGCCGGGTCATCTTCACCGTGTACGAGATGAAGCGCCTCGGCCGCGACGCCGCCGAG
+CTCACCGCGCTCGCCGACCACCTCACCGCCCACGGCCTGGTCCTGGAGATGCTCGCCGGG
+CCCTTGCCCGGCATCTACGACCCGACCGGGCCGGGGAAGCTGCTGTTCGCGTTCTTCGCC
+GCGATGGCGGAGACCGAGCGGGAGAACATCCGGGAGTCCACGCTGGAGGGGCTCGACACG
+GCGGCCCGCAAGGGCAAACACGGCGGCCGACCCCCGGTCATCACCGACGACATGCTCCAC
+ACTGTCCTGCGGCGCCGCGCGGGCGGCGAGTCCGTCGAGCAGATCCAGCCTGACCTGATC
+ATCCCCACCGGCAAGCGCAAGGGCCACAACCCCTCAGTGGCCAGCGTCTACCGGGCCCTC
+GCCGAGCACGCCAAACGCGAGGCATACCCCGAAGCCGTCGCCCAGGCGCACGCCGACTTC
+GCTGCCCTTCGGGCCGACGACGTCCCCGGGCCCCGCCTCGCACCCTCTGACCGAGCGTCA
+CTCTGA
+>orf00325 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCTGATCGCGGGAGCCGGTATCGCCGGTCCGGCCCTGGCCCACTGGCTCAAACGGCAC
+GGAATGCAGGCCACCCTCGTCGAGCGGGCCCCCGCCCCGCGGGAGGGCGGACAGACCGTG
+GACCTGCGCGGTGCCGGACGGGACGTCGCCCGCAGGATGGGCCTGGAACACACCCTCCGG
+GACCACGCCACCCGCGAAGAAGGCATCCGCTTCGTCGACGCGGCGAACCGCACCAGAGCC
+GCCTTCACCAGCGGCGCCTTCGGCGGCCAGGGACCGATCGCCGACCTGGAGATCCTGCGC
+GCCGACCTCTCGCGCATCCTCTACGAGGCCACCCACCCACACACCGAGTACCTATTCGGG
+GATGAGATCACACAGCTGTCCGACACAGGAAAGAAGGTCGACGTCACCTTCCGCAACGGG
+CCGGACCGTGCATTCGACCTCGTCATCGCCGCCGACGGAGCCCGCTCCCGCACCCGCGAC
+CTGATCTTCGGCGACACCACCGACATCCGCCCCGTGGGCCTGACGACCGCGTACTTCACC
+ATCCCCCGCGAGCCCTCGGACGGCACCTGGGCCCGCTGGCACAACGCCACCCATGGACGC
+ACGGCGACCCTGCGCCCCGACAACCGGGGCACCACCCGCGCCTCCCTGTCCTACCTCTCC
+CCGCCCCGCGGAGACGAACGCCTGGCACCCGACGCACAGAAGCAACTCCTGCGCCGCCTG
+TTCACCGGCGCGAGCTGGGAGATTCCACGCATCCTCACCGCCATGGACACCGCCGACGAC
+TTCTTCCTCGACTCCGTCATCCAGGTCCGCATGCCTTCCTGGTCCCGGGGGCGGATCGCT
+GTCGTCGGCGACGCCGCGTACTGCGCCTCGCCCCTCAGCGGCATGGGCACCAGCCTCGCT
+CTCACCGGCGCCTACGTCCTGGCCGGTGAACTCGCCCACCACGCGCATCACGGCAACGCG
+TTCGCCCGCTACGAGCACATCCTCCGCCCCTACATCACCCGCGCCCAGCATCTACCGCCC
+GGCGTTCCTCGCATCGCCTCACCCCGCACCCGGGCCGGCATCCGGGCCCTCAACACCGTC
+CTGTACGCCGCCTCCCGGCCCCGCATCGCCAAAGCGCTCAACCGCTTCCTCGTACCGCCA
+GCCGACACCTTCACACTGCCCCCGTACGGCCTCTGA
+>orf00326 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGTGACCCGTCCCCCACCCGCGAGGAGACGACCGAGCCCTACCGGTGGCGGTGGCTG
+ATCCTGGCGGTGATGATCGTCGCGGAGATCATGGACCTCCTGGACGCCTCGATCGTCAAC
+GTCGCCGGACCGGACCTGGAGAAGTCCCTCGGCGCCGGCTCGGTCGGACTGCAGTGGGTG
+ATCGGCGGCTACGCCCTCACCCTGGGCGCCGGTCTGGTGCTCGGCGGGCGGCTCGGTGAC
+CGTTACGGCCGGCGCCGGATGTTCCTGATCGGACTCGCGGCCTTCACCACTGCATCGCTG
+CTGTGCGCGATCGCGCCGAACATCGAGTCGCTGATCGCCTTCCGCCTGCTGCAGGGCACC
+GCCGGAGCGATGCTGCTGCCCCAGGGCCTGGGTCTGCTGCGCGAGAACTTCTCCGGCCCC
+GAGCTCACCAAGGTCTTCGCGATCTTCGGCCCCGTCCTCGGACTGGGCGGCATCATCGGC
+CCAGTCCTGGGCGGCTTCCTCATCGAGGGCGACTTCTTCGGCCTGGGCTGGCGCTCGGTC
+TTCCTGATCAACCTGCCCATCGGCATCGCGGCACTGATCGTCGCCGCGAAATTCGTGCCC
+AAGAAGGCGGGCGACCGCACGGTCCGGGTCGACATGACCGGCGCCGCCCTGATCGTGGCG
+TCCTGCGCCCTGCTGGTGCTGCCGCTCAACCAGGGCCAGGAGAGCGGCTGGCCGCTGTGG
+ACGTGGCTGTCCATGGCCGCCTCCGCGATCGGGTTCGCCCTCTTCGCCCTCCAGCAGCGT
+CGCACGGCCGCCGTGGGCCGCGAGCCGCTGGTGACCCCCGGCCTGCTGCGCAAGCCCGCC
+TTCACCGTCGGGCTCGGCGGCATCGCCCTGTTCTTCGGCGGACTCATCGGCACCCAGCTC
+GTCCTGACCCTGTTCCTCCAGATCGGCCAGCACTTCACCGCTGGTGACGCGGGCCTTGGC
+AACCTGCCCCTCGCGGTGGGAACCGCGATCGGCGGCGCCATCAGCGGCGCGTTCCTCGCT
+GACAGGATCGGCCGCAAGGTGCTCCAGATCGGACCGCTGGTCCAGCTGGCCGGCGCCGCC
+GTGCTGTGGTTCGAGCTCGACGGCCTCGACTCCGCCTCGTTCTCGATCTGGGACATCGTC
+CCGGGCACGACAGTGGCGGGCATCGGCGCCGGCATGGTGATCGCCGCACTGTTCAGCTTC
+ATCCTGGCCGCGGTCGACGACGACGAGATCGGATCCGCCTCCGGGGTCCTGTCGGCGGTC
+CAGGCGGTCGGCGGCTCCATCGGCGTCGCGGTCTTCGGCTCGGTGTTCTTCGCCCAGGCC
+AAGACCGGCGACTTCACCGGCGGCTTCCACCGGGCCCTGATCGTCCAGGCATGCCTGCTG
+GTGGTCTTCTTCGCGATCACCTTCCTGCTGCCCAAGAAGGGCCGCCCCGAAGACGAGCAG
+CACGGCATCACCCCCGAGACCACTGCCGACGACTCCGGCACCAAGCAGCACCTCGCCATC
+TGA
+>orf00329 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGCGTGACGGGGTCGCTCAGCAGCGTGAGCGGCTGATGGAGTCGCTGAGGATCTACGGT
+GGCCACTACTCCGAGCTCAGCCGGCGCTTCGCCGCCTGGCTGGGCCTGCACTCCACGGAC
+GCGACGGCGGTCCTGGAGATCGCCGCCGCCGAGGAACGCGGCACCCCCCTGTCACCGGCG
+CGGCTGAGCGAACGGATCTCCCTGTCCACCGGCGCCACCACCGCGCTGCTGAACCGCCTC
+GAAGCGGCCGGGCACATCACCCGCGCCCGCGAGCACTCCGACCGGCGCATCGTCACATTG
+CACAGCGGCGAGCACATCCAGGAGCGGGCGGACGAGTTCTTCGGCCCGCTCGCCCACCGC
+CTCGACGCCGCGATGTCGCCCTACCCGCCCCAGTTCCTGGAACAGGTCGAAGCGTTCATG
+GCCGACCTGAACGCCACCATGGACGGCCACCTCACGGAACAGAACGCAGTGGCACCGCGC
+TCCCTCCGCACTCCCTGA
+>orf00330 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGATCAGCCCGCGGTGAAGTCGCCGTCCGCGGCGAGTACGGCGCCCGTAACGAAGGCG
+GATCGCGGGAGACCAGGAAGCACAGGACTTCCGCGACCTCGTGCGGCTGCGCCACCCTGC
+CCAGGGGGTGGACGTTCCCGAAGGACGCGAGATAGGCGCGGCTGTACGGCCACGGTGGGC
+CGGCTGTCGGCGGCGACCCGGTCCCGGCTGGACGACCTGGTGGCCGAGGACGCCGGCGGG
+GAGGAGTCGGCGGGCGGCGGGGTGTCATTCTTCTCCGAGCTGAAGGCGGACCCGGGCGCG
+CTGGGGCTGGACAGTCTGCTGGCGGAGGTGAACAAGCTCCAGCGGGTGCGTGCGCTGGAG
+CTGGCGCCGGAGCTATTCGGGGACGTGTCGGAGAAGCTGGTGGCGGCGTGGCGGGCGCGG
+GCGTCGAAGGAGTACCCCTCGGACCTGCGGGCGGCAGCCGGGCCGGTGCGCTACACGCTG
+CTGGCCGCGCTGTGCCATGTGCGGCAGACGGAGATCACCGACTCGCTGGTGGAGCTGTTC
+ATCCAGCTGGTGCAGCGGATCAACACGCGGGCGGAGAAGAAGGTTGAGGGCGAGTTCACC
+AAGGATCTCAAGCGGGTCCGTGGCAAGGAGGGGATTCTGCTGCGGCTGGCGGAGGCCGCG
+GTCGCGGAGCCGGGCGGCACGGTCCGCAAGGTGATCTTCCCGGTGGCCGGGGAGTCCACG
+CTGAAGGCCCTGGCGGCGGAGGCCGCGGCGAACGAGGCCCGCTACCGGGCCCGGGTGCGC
+ACGGTGCTGCGGTCGTCGTACTCGGGGCACTGGCGGCGGATGCTCTCCCCGCTGCTGGGG
+GCGGTGGAGCTGAAGTGCAACAACACCGCTTACCGGCCGGTGATGGACGCCATCGACCTG
+CTGAAGCGGTACCTGGACCAGCCCATCGCCAAGGAGGGCGCGTTCTTCGACGAGTCGGAG
+AACATCCCGCTGGCCGGGGTGGTGCGCGAGGAGTGGCGCAAGGCAGTGGTGGACGAGCGC
+GGCCGCGTCGAGCGCATCCCGTACGAGCTGTGCGTGCTGGTCAGCCTGCGGGACGCGCTG
+CGGCGCCGGGAGATCTGGGTCCCGGGCGCGGGCCGGTGGCAGAACCCCGAGGGCGACCTG
+CCCCCCGACTTCGAGGACAACCGCGATGTCCACTACGACGCGATCCGCCAGCCGCAGGAC
+CCTGGGTCCTTCATCGGGGCCCTTCAGAAGCGGCTGCGGGAGGCCCTGACCCGGCTCGAC
+ACCGCGCTGGAGCTGGGCACCACGGGCGGCGTGGACATCGTCCGCAAGCACGGCGAGCCG
+TGGATCAAGGTCTCGCCGCTGGGCAAGCAGGCAGAGCCGGAGAACCTCGTCGCGCTGAAG
+GCGGAGATCGAACGCAGGTGGGGCACCATCGACCTGATCGACATCCTCAAGGAGGCCGAG
+TTCGCCACCGGGTTCACGTCCGAGTTCGCCTCAGTCGCCACGAGGGAGGCGGTCCCGAAG
+GCGGTGCTGCGGCGCCGGCTGCTGCTCGTGCTGTTCGCGCTGGGCACGAACATGGGCATC
+AAGCGGGTCGCGGTCACCGGCAAGCACGGCGAGAGCGAGGCCGTCCTGCGCCGGGTGCGG
+CACCTGTTCGTCAACCGCACCAACCTGCGCGCCGCCCTGGTCCGCCTGGTCAACGCCACC
+TTCGCCGCCCGCGATCAGGCGTGGTGGGGCGAGGGCACCGCCTGCGCGAGCGATTCGAAG
+AAGTTCGGGTCCTGGTCCAGCAACTTCATGACCGAGTGGCACCAGCGCTACCGCGGGCCC
+GGGGTGATGATCTACTGGCATGTCGAGCGGAAGTCGCTGTGCGTCTACTCCCAGCTCAAG
+TCCTGCTCGGCCTCCGAGGTCGCGGCGATGATCGAGGGCGTGCTGCGGCACTGCACGGAC
+GTGGAGATCGACCGCCAGTACACCGACACCCACGGGGCCTCGATCGTCGGGTTCGCCTTC
+GCCCACATGCTCGGCTTCAACCTGCTCCCCAGGTTGAAGAACGTCGGCTCGGCGCGGTTG
+TACCGGCCGGCGGCTGGGGAGGACGACACCTGGCCGCATCTGGCGCCGGTGCTGTCGACC
+AAGACGATCGACTGGGACCTGATCGCCCAGCAGTACGACCAGATCGTGAAGTACACCACC
+GCCCTGCGGCTGGGCACCGCCGAGGCCGAGCAGGTCCTGCGGCGCTTCACCCGCGGAGGC
+CCCAAGCACCCCACCTACCGGGCGATCGAGGAACTCGGCCGGGCGGCACGTACGGCGTTC
+ATCTGTGACTACCTCGCCGACGCCGACCTGCGCCGCGAGATCAACGACGGACTCCAGGTC
+GTGGAGAACTGGAACTCCGCCAACCACGACCTGCTCTACGGCAAGGACGGTGATCTGACC
+GGCTCCGACAAGGAGTCCCAGGAGGTCTCGATGCTCGCGCTGCACCTGCTCCAGTCCGCG
+CTGGTGCACGTCAACGCCCTGCTCCTCCAGGACATCCTCGCCGAGGAGAAATGGCAGAAG
+AAGCTCACCGACGCCGACCGGCGGGCCCTGTCCCCGCTGTTTTGGACGCACGTGAACCCG
+TACGGCCGGTTCGAGCTGGACATGAATTCCCACCTGGACCTCGTCGCCGCCGTGGCGGCT
+TCGGTGCCCGGCCCGCGCAGCGGCGAGCCGGCCACGTCCCCGGCCTGA
+>orf00332 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCGGGAGAGAGAAACATTCGAAGAACAAGGCGCGGCGGGCGGTGAGGGGCGACGCACG
+CGTCGGCACGATCCGCGCCGTCGGGAGCGGGTGCTCGACGCCGCGCTGGAGGTGCTCGTC
+GAAGACGGGGTCGCCGGGATCACGCACCGCAAGGTGGCGGCCCGCGCCGACGTGCCACTG
+GGCTCCGTCACCTACCACTTCGCAAGCCTGACCGAACTGTGCACGCAGGCGTTCGCCTGG
+TACGTCGAACAGCGCACCGCCGAATATGAGGCCCTGTTCACCCAGGTGGCATCGCGCGAA
+GACCTGATCGACGTCCTGGTGACGGTGGTCCAAGGAGGACCGGCCCGGCATCGCAGCGCG
+GTTCTCGGCTTCGAACTGCATTTGGCGGCGCTGCGCGATCCCGCGCTGCGCGTCCTAACC
+CAGCAGTGGACCAGCTCCAGCCGGGCGGTGCTGGCCCGCTTCACCGGGCCGCGGGCCGCC
+GCCCGCCTCGATGCCCTCCTGGAAGGAATGATCATGCACGCACTGCTCTCCACGGACCAG
+GAACCGCCCGAGGCGACCCGGGAGTCCCTGGCGCAGACGCTCGGCCCGGCCGCCGGGCCG
+AGTAAGTGA
+>orf00333 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGGCCTGGCCGGGGCCACGTGGGCGTCCCGCCTGCCGCAGATCCGGGACCGCATGGAT
+CTGGACGCCGCGGCAGTGGGTCTCCTGTTGCTCCTCCTCGGGGTCGGCGGTCTGGTGGCG
+TTGCCGCTGGCCGGTCTCCTCGTCACACGGGTCGGGCCGCGCCGGGCCGTCACCACGGTG
+GGCGCGTTCGTAGGTGCCGGCCTCGCTGCGGTGTCGACCGGCTTCGCTCTCTGGCCACCG
+TTGCTCCTCATCGGCCTCTTCGTCCTGGGCACTGCCACGGGCTTCTGGGATGTCGCGGTG
+GCCGTGCACGCCGCAGCCCTCGAACGACGACTCGGTCGCGCTCTGATGCCCCGCTTCTTC
+GCCGGGTTCAGCCTCGGCACCGTCGTCGGCGCCTGCCTCGGCGCGCTCCTGACGGCGCTG
+GGCGTAACGGTGAGCCTGCACATCGGCGCGGTGGCCCTGCTCATCACCGTGCTGACACCC
+GTGGCGGTTCGCCGCTTCCTCCCCCGGAGTGCACCCCCGGCATGGCCACCACGCAGGACG
+ACGCAGGAGCCCGGACAGCGCGCATGGCGCGACCCACGCACGGTCGTCCTCGGCCTCGTC
+GCCCTGGCCTTCGCGTTGGCGGAAGGAGCGGGAAGCAACTGGGTCAGCCTCACTGTCATC
+GACCGCCACCGCACCACGGCCGCAGTCGCTACGCTCGCCTACGCCGCCTTCCTCGCGGCC
+GTCACCCTCGGCCGCTGGCTCGGTCCGCTGATCGTCGGCCGCCTGGGCCGGCCAGGAGCA
+CTGCGCGCGTCTGCGTTGGCCGCCTGCCTCGGGGTGGTCTTGTTCGCGGCCGGGCCCAGC
+CTCTGGGCGGGGTTCGCGGGGACGCTGCTGTGGGGAGCGGGCGCGGCACTCGGCTTTCCC
+CTCGGTCTGAGCGCCGGTTCGGACGACCCCGCCCAGGCGGCCGCGCGGGTCGGCGTGATC
+ACCTCGATCGGGTACTGCGGCTTTGTCTGCAGCCCGCCCCTGTTCGGCGCCCTCGCCGAC
+CGGACCGGCCTCGCACCGGCGTTGCTGGTCGTAGCCGCCGTCATGGCCGCGTGCCTCCCC
+CTCGCGGGCGCCCTGAGGGACACCTCGCGGGTTGTGTATGAAGAGGCGACCGACGGCGTC
+GCGCCGGGGCCCTTGCACTGA
+>orf00335 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGAAGGAGCACACCGTGCCGACCAGCACACCCGTCATCCAGGTCGCCGACGCCGACCTG
+GAAGACCTCCGCACCCGGCTGCGCGCCACTCGCTGGCCCGAGCCCTGGCCGGTCGACGGC
+TGGCAGGCGGGTACCGACGCAGCCGAACTCCGCCGCCTCGTCATGTACTGGGCCACCGAC
+TACACGTGGCGCACCCACGAAGCCGCCGTCAACGCACTGCCCTCCCATTTTGCCGACATC
+GCCGGCACACGAGTGCACTACCTGCGTTACGAGGCCGAACACCCTGACGCCCTGCCGATC
+GTGCTCACCCACGGCTGGCCGAGTACCGTCATGGAACTCACCATGCTCGCCGAACGACTC
+GCCGCCCCCTCCCGCCACGGAGGAGACGCCCGCGACGCCTTCACCGTCATCATCCCCTCC
+CTGCCCGGCTTCACCTTCTCGCCACAGCGCCCCGCCCTCACCGACGCCGAGCAGACCCAT
+GACCTCTGGCACCGGCTGATGCACGACCACTTGGGCTTCCAACGCTACGCGGCCCACGGC
+GGAGACCTGGGCGCCGGCGTCACCTCACGGCTCGCCGAGGCCCACCCCGAGGCCGTCGTC
+GGCATTCATCTGCTCGCTGCCGCGGCCCCGGCAGAGTACGATCCGGCCTCGCTCACCCCT
+GAGGAGAAGACCCACCTGTTGTCCGCCGCGGCCTGGCAGGCAGAGGAGGGCGCCTACATG
+CACCAGCAGAACACCCGTCCCCTCACCCTCGCGCCCGCACTGAACGACTCGCCCGCCGGA
+CTGCTCTCCTGGATCCTCGAGAAGTACCGCGCGTGGACCGACTGCGGCGGCGACCTGTCC
+ACCCGCTTCGGCGACGACTTCCTCCTCACCCAGGCATCGCTCTACTGGTTCACCGGCACG
+ATCTCCACGTCCTTCCGCCCGTACTACGAGTACGCGCACCAGCTCACCCGGCGCGTGCGG
+CGGGTCGACGTCCCCACCGCCCTCGCCCTGTTCCCCGCAGACCTCGCCCAACCGCCCCGG
+AGCTGGGCCGAGCGCACCTACCACCTCACGCGTTACACCCGTATGCCTCGCGGCGGCCAC
+TTCGCCGCGCACGAGGAACCGGCCTTGCTTGCCGACGACATCACCGCGTTCTTCGGCGAC
+CTCCGTTAG
+>orf00336 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GTGGATGGACTGCATGGGAGCCCACTTCATAAGAGGCTCGACGAACACTGCGCTGGCCGA
+TTCGGGATCGCACCACCGCTAACCGGGGAAATCACCACGAAGATCAACCACTGA
+>orf00337 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+ATGCCCACCGAGACCCTGCCGCCCGAGGTGCGGAATTTCATCGACGATGCGCGGCGTCAC
+CTGGCTTTCTGCGCCGGGCTGCGCGCGGGCGAGGACCCGGCGTACGCGACCGTGCTCCTG
+GCCGCCGCCGAGCAGGGAGAAGAAGTCCTCGCCCGGTACGAAGGCCGCGTAGCTTAG
+>orf00339 gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+TTGGCTTGTCTGCCTCGTGAGGAGTTTCAAATTTCTGTTTCTCGGGTTCCGTTGCGGAAA
+CATCAGGTGGAGCTTATGTCGGACCTCAGGAAATGGGTTCGGGTGGCTGCCCGGGAAAGC
+GCCCGTTCGGGGCGGGGGGCGCGGGCGACGGTGGTGTCCGCTACGGGTACGGGGAAGACG
+ATCAGCGCGGCTGTTGCGGCGTTGGAGTTGTTCCCTTCGGGGCGGGTTCTCGTGATGGTG
+CCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGCGGGCGGTGGGGCACACGGCG
+CCGATGGTCGGGGTGTGCTCGCTGCCCGGGGATCTGCTCCTGGAGGAGTTGCGGGTGCGG
+ACGACGACGCACCCGATCCGGCTCGCGCTGTGGGCCGGGCAGGGGCCTGTGGTCGTGCTG
+GCGACGTACTCCTCGCTCGTGGGCGGGGACGGGCAGGGCGGGCCCCTGGAGGCCGCCCTG
+GCGGGCTCGGGGTTGTACGGGCAGCGGATGGACGGCTTCGACCTCGCGGTCGTGGACGAG
+GCGCACCGTACGGCGGGCAGCGCGGCGAAGCCCTGGGCCGCGATCCACGACAACGCCCGT
+ATCCCGGCGGCGCACCGGCTCTACCTCACCGCCACCCCGCGCGTCCTCGCGCCCGCCCGC
+CCCGACAGGGACGAGGACCAGGAGGAGGGCGGCGGGGAGGCGCCGGCACTCGTGACGATG
+GCGAACGACCCGGAAGGCGAGTACGGGGCGTGGATTCACGAACTCGGGTTGTCCGAGGCG
+ATCGAGCGGAAAATTCTTGCGCCTTTCGAGATTGATGTTTTGGAGATTACCGATCCTGAG
+CCGGAATTGATGGAAGGAATGGACCGGGAGGCGCGGCGTGGGCGGCGGCTCGCCCTGCTC
+CAGACTGCGTTGCTGGAGCACGCGGCCGAGCACAATCTGCGCACCGTGATGACGTTCCAT
+CAGCGGGTGGAGGAGGCGGCGGCTTTCGCGGAGAAAATGCCGGAGACAGCGGCGGAGCTT
+TACCGGAATGAGGTGTCGGCGGAGGATCTTGCCCTAGCCGAGGAGCTCCCGGCCTCCGAG
+GTGGGCGGGGGCTTCTACGAGCTGGAGCCGGGGCGGCATGTGCGGCCGGAGCGGGTGTGG
+TCGCGGTGGCTGTACGGAGAGCACCCGGTGGCCGAACGCCGTGCGGTGCTGCGGGAGTTC
+GCGAACGGGATGGACTCGGCAGGGGTGCGGGTGCACCGCGCGTTCCTCGCCTCCGTCCGC
+GTGCTCGGCGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTCGCC
+GACGCGCGCGGGTCCCAGGTCGAGATCGTGCAGAACATCGGCAGGGCGCTGCGCCCGAAC
+CCGGACGGGCAGACGAAGACGGCGCGGATCATCGTGCCCGTCTTCTTGGAGGCCGACGAG
+GACGGGGAGGGGATGGTCGCGAGCGAGGCGTACCGGCCGCTCGTGGCCGTGCTCCAGGGG
+CTGCGCTCGCACTCCGAGCACCTGGTCGAGAAGCTGATGCTCCGGGCCCGGGTGCGGGCC
+GAGAGCGCGAGCGCGCGCAGCGCGGAGGAGGCCGGTGCGGGGCCCGCGCGGGTCCTGTCC
+GACTCCGGGACCTCTTCCCCCGCCTCCCAGGCCTCCGGGGACGTCGAAGGCGAGAACGAG
+GACGACGTCGAGGCGGGCGCGGACGGCGCTGAGGCGGGCGCGGACGGCGCTGAGGAGTCG
+GAGTCGGTGTTGTTGCGGTTCTCGACGCCGCGCTCGGCGTCGACCATCGCGGCCTTCCTG
+CGGACGCGGGTGTACCAGCCGGAGTCGACGGTGTGGCTGGAGGGCTACGAGGCGCTGCGC
+GCCTGGCGGGCCGAGCAAGGGGTGCGCGGCTTGTGCGCGGTCCCGTACGACGCCGAGGTC
+GCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGACCACCGCGCAACGCCGCGCC
+CGCCGCGAGGGCACCCTCAGCGCACACCGCATCGACCTGCTCGACGCGGAGGGCATGGTG
+TGGGAGCCGCGCGAAGAGGAGTGGGAGCGCACGCTCGCCGGGCTTCGCTCCTACCGGGCC
+GCGTACGGGCACCTCGCCCCCCGCCGGCGCGAAACCTGGGGCGAAGACGAGGGTGAGGAC
+GTCGTACGCGTCGGGGACCTGATGGCGAACCTCCGCCGCAAGGACGGACTCGGGCGGGAC
+GCGGAGCGGGCCGCCGCGCGCGCGGCCCAGCTGAGGGCCGTCGATGCGGACTGGGACTGC
+CCCTGGCCGCTGGACTGGCAGCGCTGCTGTCGGCAGCTCGCGCTCCTGGCCGCCGACGAA
+CCCGACGGACGCGCGCCCCGGATCGCGCGCGGGGTGCGCATCGACGGGGACGACCTCGGC
+GCGTGGGTCGCGCGGCAGCAGGAACCGCGGGTGTGGGCGAAGCTCAGCACCGAGCAGCGG
+GCGCGACTCGAAGCGCTCGGGCTCCGGCCTACCGAGACGGCCCCACGGCGGGGTGTGGAG
+GGCACGGGGGCGGCGGGGAGCGGGAAGCGGACGGCGGCGGCGCGAACGGCCTTCCAGCGC
+GGCCTCGCGGCGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGAGAAACCCGTACCCCGC
+AAACACACCGAGACCGTGAGCGTGGACGGTGAGGACGTCGACGTACGCCTCGGCGTGTGG
+GTCTCGAACGTGAAGAGCCGCTTCGACGGGATGGGCGAGGACGAGCGCGGCCAGCTCACC
+GCGCTCGGAGTGCCCTGGGCGGTGTAG
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/longORFSTestOutput.dat	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,1 @@
+00001     173     182  -2   1.026
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/orf_aa.fa	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,20 @@
+>PROKKA_00001 <unknown description>
+MSQVTEQSVRFQTALASIKLIQASAVLDLTEDDFDFLTSNKVWIATDRSRARRCVEACVY
+GTLDFVGYPRFPAPVEFIAAVIAYYVHPVNIQTACLIMEGAEFTENIINGVERPVKAAEL
+FAFTLRVRAGNTDVLTDAEENVRQKLRAEGVM
+>PROKKA_00002 <unknown description>
+MSKGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF
+>PROKKA_00003 <unknown description>
+MPDRTEANPNELNQDDARYGFRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAY
+ANLHTDQERDYFMQRYHDVISSFGGKTSYDADNRPLLVMRSNLWASGYDVDGTDQTSLGQ
+FSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVL
+YGNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDL
+QERVLIRHHDYDQCFQSVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS
+>PROKKA_00004 <unknown description>
+LVLLLAVLLLLLLVAPCLNCLEAVKKPPPVAFKVMCLLPITIL
+>PROKKA_00005 <unknown description>
+MAKAGKGLLEGTLQAGTSAVSDKLLDLVGLGGKSAADKGKDTRDYLAAAFPELNAWERAG
+ADASSAGMVDAGFENQKELTKMQLDNQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQ
+NEMLAYQQKESTARVASIMENTNLSKQQQVSEIMRQMLTQAQTAGQYFTNDQIKEMTRKV
+SAEVDLVHQQTQNQRYGSSHIGATAKDISNVVTDAASGVVDIFHGIDKAVADTWNNFWKD
+GKADGIGSNLSRK
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/orf_nc.fa	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,46 @@
+>PROKKA_00001 <unknown description>
+ATGAGTCAAGTTACTGAACAATCCGTACGTTTCCAGACCGCTTTGGCCTCTATTAAGCTC
+ATTCAGGCTTCTGCCGTTTTGGATTTAACCGAAGATGATTTCGATTTTCTGACGAGTAAC
+AAAGTTTGGATTGCTACTGACCGCTCTCGTGCTCGTCGCTGCGTTGAGGCTTGCGTTTAT
+GGTACGCTGGACTTTGTGGGATACCCTCGCTTTCCTGCTCCTGTTGAGTTTATTGCTGCC
+GTCATTGCTTATTATGTTCATCCCGTCAACATTCAAACGGCCTGTCTCATCATGGAAGGC
+GCTGAATTTACGGAAAACATTATTAATGGCGTCGAGCGTCCGGTTAAAGCCGCTGAATTG
+TTCGCGTTTACCTTGCGTGTACGCGCAGGAAACACTGACGTTCTTACTGACGCAGAAGAA
+AACGTGCGTCAAAAATTACGTGCGGAAGGAGTGATGTAA
+>PROKKA_00002 <unknown description>
+ATGTCTAAAGGTAAAAAACGTTCTGGCGCTCGCCCTGGTCGTCCGCAGCCGTTGCGAGGT
+ACTAAAGGCAAGCGTAAAGGCGCTCGTCTTTGGTATGTAGGTGGTCAACAATTTTAA
+>PROKKA_00003 <unknown description>
+ATGCCTGACCGTACCGAGGCTAACCCTAATGAGCTTAATCAAGATGATGCTCGTTATGGT
+TTCCGTTGCTGCCATCTCAAAAACATTTGGACTGCTCCGCTTCCTCCTGAGACTGAGCTT
+TCTCGCCAAATGACGACTTCTACCACATCTATTGACATTATGGGTCTGCAAGCTGCTTAT
+GCTAATTTGCATACTGACCAAGAACGTGATTACTTCATGCAGCGTTACCATGATGTTATT
+TCTTCATTTGGAGGTAAAACCTCTTATGACGCTGACAACCGTCCTTTACTTGTCATGCGC
+TCTAATCTCTGGGCATCTGGCTATGATGTTGATGGAACTGACCAAACGTCGTTAGGCCAG
+TTTTCTGGTCGTGTTCAACAGACCTATAAACATTCTGTGCCGCGTTTCTTTGTTCCTGAG
+CATGGCACTATGTTTACTCTTGCGCTTGTTCGTTTTCCGCCTACTGCGACTAAAGAGATT
+CAGTACCTTAACGCTAAAGGTGCTTTGACTTATACCGATATTGCTGGCGACCCTGTTTTG
+TATGGCAACTTGCCGCCGCGTGAAATTTCTATGAAGGATGTTTTCCGTTCTGGTGATTCG
+TCTAAGAAGTTTAAGATTGCTGAGGGTCAGTGGTATCGTTATGCGCCTTCGTATGTTTCT
+CCTGCTTATCACCTTCTTGAAGGCTTCCCATTCATTCAGGAACCGCCTTCTGGTGATTTG
+CAAGAACGCGTACTTATTCGCCACCATGATTATGACCAGTGTTTCCAGTCCGTTCAGTTG
+TTGCAGTGGAATAGTCAGGTTAAATTTAATGTGACCGTTTATCGCAATCTGCCGACCACT
+CGCGATTCAATCATGACTTCGTGA
+>PROKKA_00004 <unknown description>
+TTGGTGCTATTGCTGGCGGTATTGCTTCTGCTCTTGCTGGTGGCGCCATGTCTAAATTGT
+TTGGAGGCGGTCAAAAAGCCGCCTCCGGTGGCATTCAAGGTGATGTGCTTGCTACCGATA
+ACAATACTGTAG
+>PROKKA_00005 <unknown description>
+ATGGCTAAAGCTGGTAAAGGACTTCTTGAAGGTACGTTGCAGGCTGGCACTTCTGCCGTT
+TCTGATAAGTTGCTTGATTTGGTTGGACTTGGTGGCAAGTCTGCCGCTGATAAAGGAAAG
+GATACTCGTGATTATCTTGCTGCTGCATTTCCTGAGCTTAATGCTTGGGAGCGTGCTGGT
+GCTGATGCTTCCTCTGCTGGTATGGTTGACGCCGGATTTGAGAATCAAAAAGAGCTTACT
+AAAATGCAACTGGACAATCAGAAAGAGATTGCCGAGATGCAAAATGAGACTCAAAAAGAG
+ATTGCTGGCATTCAGTCGGCGACTTCACGCCAGAATACGAAAGACCAGGTATATGCACAA
+AATGAGATGCTTGCTTATCAACAGAAGGAGTCTACTGCTCGCGTTGCGTCTATTATGGAA
+AACACCAATCTTTCCAAGCAACAGCAGGTTTCCGAGATTATGCGCCAAATGCTTACTCAA
+GCTCAAACGGCTGGTCAGTATTTTACCAATGACCAAATCAAAGAAATGACTCGCAAGGTT
+AGTGCTGAGGTTGACTTAGTTCATCAGCAAACGCAGAATCAGCGGTATGGCTCTTCTCAT
+ATTGGCGCTACTGCAAAGGATATTTCTAATGTCGTCACTGATGCTGCTTCTGGTGTGGTT
+GATATTTTTCATGGTATTGATAAAGCTGTTGCCGATACTTGGAACAATTTCTGGAAAGAC
+GGTAAAGCTGATGGTATTGGCTCTAATTTGTCTAGGAAATAA
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/streptomyces_Tu6071_genomic.acgt	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,123 @@
+>gi|333022496:2500-3701 Streptomyces sp. Tu6071 chromosome, whole genome shotgun sequence
+Position  Length     As     Cs     Gs     Ts  Other    %GC
+       1      10   20.0   30.0   50.0    0.0    0.0   80.0
+      11      10   30.0   30.0   40.0    0.0    0.0   70.0
+      21      10    0.0   50.0   50.0    0.0    0.0  100.0
+      31      10   10.0   30.0   40.0   20.0    0.0   70.0
+      41      10   20.0   30.0   30.0   20.0    0.0   60.0
+      51      10   10.0   50.0   30.0   10.0    0.0   80.0
+      61      10   30.0   30.0   40.0    0.0    0.0   70.0
+      71      10   10.0   50.0   20.0   20.0    0.0   70.0
+      81      10    0.0   50.0   30.0   20.0    0.0   80.0
+      91      10   20.0   20.0   60.0    0.0    0.0   80.0
+     101      10   10.0   60.0   20.0   10.0    0.0   80.0
+     111      10    0.0   30.0   60.0   10.0    0.0   90.0
+     121      10   20.0   10.0   50.0   20.0    0.0   60.0
+     131      10   10.0   40.0   20.0   30.0    0.0   60.0
+     141      10   10.0   40.0   40.0   10.0    0.0   80.0
+     151      10   10.0   30.0   40.0   20.0    0.0   70.0
+     161      10    0.0   30.0   60.0   10.0    0.0   90.0
+     171      10   10.0   30.0   30.0   30.0    0.0   60.0
+     181      10   10.0   10.0   30.0   50.0    0.0   40.0
+     191      10   10.0   30.0   40.0   20.0    0.0   70.0
+     201      10    0.0   10.0   60.0   30.0    0.0   70.0
+     211      10   10.0   40.0   30.0   20.0    0.0   70.0
+     221      10   20.0   30.0   50.0    0.0    0.0   80.0
+     231      10    0.0   50.0   30.0   20.0    0.0   80.0
+     241      10   10.0   30.0   30.0   30.0    0.0   60.0
+     251      10    0.0   30.0   60.0   10.0    0.0   90.0
+     261      10   20.0   20.0   50.0   10.0    0.0   70.0
+     271      10   30.0   30.0   40.0    0.0    0.0   70.0
+     281      10    0.0   10.0   60.0   30.0    0.0   70.0
+     291      10    0.0   20.0   60.0   20.0    0.0   80.0
+     301      10    0.0   30.0   70.0    0.0    0.0  100.0
+     311      10   10.0   20.0   50.0   20.0    0.0   70.0
+     321      10   20.0   20.0   40.0   20.0    0.0   60.0
+     331      10    0.0   40.0   40.0   20.0    0.0   80.0
+     341      10   20.0   20.0   40.0   20.0    0.0   60.0
+     351      10   10.0   30.0   30.0   30.0    0.0   60.0
+     361      10   30.0   20.0   40.0   10.0    0.0   60.0
+     371      10   20.0   20.0   60.0    0.0    0.0   80.0
+     381      10   20.0   40.0   40.0    0.0    0.0   80.0
+     391      10   20.0    0.0   60.0   20.0    0.0   60.0
+     401      10    0.0   30.0   40.0   30.0    0.0   70.0
+     411      10   10.0   30.0   30.0   30.0    0.0   60.0
+     421      10   20.0   40.0   40.0    0.0    0.0   80.0
+     431      10    0.0   20.0   40.0   40.0    0.0   60.0
+     441      10   20.0   40.0   40.0    0.0    0.0   80.0
+     451      10   20.0   30.0   30.0   20.0    0.0   60.0
+     461      10   10.0   30.0   40.0   20.0    0.0   70.0
+     471      10   20.0   20.0   40.0   20.0    0.0   60.0
+     481      10   20.0   50.0   20.0   10.0    0.0   70.0
+     491      10   10.0   40.0   30.0   20.0    0.0   70.0
+     501      10   10.0   30.0   30.0   30.0    0.0   60.0
+     511      10    0.0   30.0   60.0   10.0    0.0   90.0
+     521      10    0.0   40.0   30.0   30.0    0.0   70.0
+     531      10   30.0   20.0   40.0   10.0    0.0   60.0
+     541      10   20.0   10.0   60.0   10.0    0.0   70.0
+     551      10   10.0   20.0   40.0   30.0    0.0   60.0
+     561      10    0.0   60.0   10.0   30.0    0.0   70.0
+     571      10   30.0    0.0   60.0   10.0    0.0   60.0
+     581      10   20.0   20.0   40.0   20.0    0.0   60.0
+     591      10    0.0   20.0   50.0   30.0    0.0   70.0
+     601      10   30.0   20.0   40.0   10.0    0.0   60.0
+     611      10   20.0   30.0   50.0    0.0    0.0   80.0
+     621      10   20.0   20.0   30.0   30.0    0.0   50.0
+     631      10    0.0   30.0   40.0   30.0    0.0   70.0
+     641      10    0.0   30.0   60.0   10.0    0.0   90.0
+     651      10   20.0   20.0   50.0   10.0    0.0   70.0
+     661      10   20.0   20.0   40.0   20.0    0.0   60.0
+     671      10   10.0   40.0   50.0    0.0    0.0   90.0
+     681      10    0.0    0.0   70.0   30.0    0.0   70.0
+     691      10   20.0   40.0   30.0   10.0    0.0   70.0
+     701      10   20.0   30.0   50.0    0.0    0.0   80.0
+     711      10   20.0   10.0   30.0   40.0    0.0   40.0
+     721      10   20.0   30.0   50.0    0.0    0.0   80.0
+     731      10   10.0   40.0   20.0   30.0    0.0   60.0
+     741      10   30.0   20.0   50.0    0.0    0.0   70.0
+     751      10   20.0   50.0   30.0    0.0    0.0   80.0
+     761      10    0.0   30.0   50.0   20.0    0.0   80.0
+     771      10   10.0   30.0   60.0    0.0    0.0   90.0
+     781      10    0.0   30.0   50.0   20.0    0.0   80.0
+     791      10   10.0   20.0   60.0   10.0    0.0   80.0
+     801      10    0.0   30.0   60.0   10.0    0.0   90.0
+     811      10    0.0   30.0   70.0    0.0    0.0  100.0
+     821      10   10.0   30.0   60.0    0.0    0.0   90.0
+     831      10   20.0   20.0   30.0   30.0    0.0   50.0
+     841      10   10.0   30.0   40.0   20.0    0.0   70.0
+     851      10    0.0   30.0   50.0   20.0    0.0   80.0
+     861      10   30.0   10.0   50.0   10.0    0.0   60.0
+     871      10   10.0   30.0   40.0   20.0    0.0   70.0
+     881      10   20.0   30.0   40.0   10.0    0.0   70.0
+     891      10   10.0   30.0   20.0   40.0    0.0   50.0
+     901      10   10.0   40.0   40.0   10.0    0.0   80.0
+     911      10   10.0   20.0   60.0   10.0    0.0   80.0
+     921      10   10.0   50.0   30.0   10.0    0.0   80.0
+     931      10   30.0   10.0   40.0   20.0    0.0   50.0
+     941      10   10.0   20.0   40.0   30.0    0.0   60.0
+     951      10   20.0   40.0   40.0    0.0    0.0   80.0
+     961      10   20.0   30.0   50.0    0.0    0.0   80.0
+     971      10    0.0   40.0   30.0   30.0    0.0   70.0
+     981      10   10.0   40.0   50.0    0.0    0.0   90.0
+     991      10   10.0   50.0   40.0    0.0    0.0   90.0
+    1001      10    0.0   40.0   40.0   20.0    0.0   80.0
+    1011      10   20.0   20.0   50.0   10.0    0.0   70.0
+    1021      10    0.0   50.0   40.0   10.0    0.0   90.0
+    1031      10    0.0   20.0   60.0   20.0    0.0   80.0
+    1041      10   10.0   40.0   30.0   20.0    0.0   70.0
+    1051      10   10.0   30.0   60.0    0.0    0.0   90.0
+    1061      10   40.0   10.0   30.0   20.0    0.0   40.0
+    1071      10   10.0   30.0   40.0   20.0    0.0   70.0
+    1081      10   10.0   30.0   30.0   30.0    0.0   60.0
+    1091      10   10.0   50.0   10.0   30.0    0.0   60.0
+    1101      10   30.0   40.0   20.0   10.0    0.0   60.0
+    1111      10   20.0   30.0   50.0    0.0    0.0   80.0
+    1121      10   10.0   10.0   70.0   10.0    0.0   80.0
+    1131      10   10.0   30.0   40.0   20.0    0.0   70.0
+    1141      10   30.0   30.0   10.0   30.0    0.0   40.0
+    1151      10   30.0   40.0   20.0   10.0    0.0   60.0
+    1161      10    0.0   50.0    0.0   50.0    0.0   50.0
+    1171      10   10.0   30.0   30.0   30.0    0.0   60.0
+    1181      10    0.0   30.0   20.0   50.0    0.0   50.0
+    1191      10   30.0   20.0   40.0   10.0    0.0   60.0
+    1201       2    0.0  100.0    0.0    0.0    0.0  100.0
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/streptomyces_Tu6071_genomic.fasta	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,20 @@
+>gi|333022496:2500-3701 Streptomyces sp. Tu6071 chromosome, whole genome shotgun sequence
+CCGAGGAGGCGAAGACCGGCGCGCGCGCCGTGGCACCGTGATCCGCATGGGCGGCACCTCGACCAGAGCG
+CCCGCATCGTGGTCCTCGCCAGGCGGCAGGCGCCTGACCCGGGCGGTCGCACGTGGAGGTCGCTCAGCTT
+CCCGAGTGCGCGCGGATGCTTGGCGGCGGCCATCGGCGTTTTTAGTGGCTGCCCGATGTGGTGTCGGTGG
+ACGGCTTGCCAGGGAGCCCGTCTGCGCCCGTAGCGTGCTCGGTGGCGGCCCAGGTGGCGAGAAGCCGCAG
+GGTGTCGTGGTCGGGGGTGCCGGGGGCGGCGCTGTAGGCGGTCAGGGTCAGTCCCGGCTGAGCCGGTAGT
+TCCATGGCGTCGAAGTCGAGGGCGAGGACGCCGACAGCGGGGTGGTGGAACGCTTTGCGGCCCGTGTGAT
+GCAGGCGCACGTTGTGCCTGGCCCAAGCGGTGCGGAACTCATCGCTGCGGGTGACGAGCTCCCCGATCAG
+TCCGGTCAGCCCGGTGTCATGCGGGGCTCGTCCGGCTTCGGTACGCAGGAGGGAGACGGTGGTGTTCACG
+GCTTCCTCCCAGTGGGGGAAGAATTCGCGGCCTGTGGGGTCGAGGAACTGGAAGCGCGCGATGTTGACCG
+GTTCGCGTGCGCCGGTGGCGTAGAGCGGGCTGTACAGGGCGCGGCCCAGGGGGTTGGTGGCCAGGACGTC
+AAGGCGGCCGTTTCGGATGAAGGCCGGGCATTCGCCCATGGAGCGCAGGACGCGCAGCACGCTGTCGGGC
+AGGGGGCCGCGGGCGCGCTTGGTGCGACGGGCGGGCCGGTGGGCGGCGGCGCGGGCCAGGTCGTACAGGT
+GAGCGCGTTCGGCGTCGTCGAGCTGGAGAGCGTTCGCGAGCGCGTCAAGGACTTCTTCGGAGGCTCCGGC
+GAGGTGGCCGCGCTCCAGGCGGACGTAGTAGTCGATGCTGACGCCGGCGAGCAGGGCGACTTCCTCGCGG
+CGCAGGCCGGGCACGCGCCGGTTGCCGCCGTAGGCGGGCAGCCCGGCCTGCTGCGGGGTGATCCTGGCGC
+GGCGGGAGCCAAGGAATTCGCGGATGTCGCTCGCGGTACTCATGCCTTCCACGCTAAGCCGGACGGCGCA
+GACGTGGGGGGGCCTGTCAGTACCTGTAACAGCAAGCCCTTCTTCCCCTTCTTGACCTGGTGTTTCCTCG
+AAGTCGCAGGCC
+
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/streptomyces_Tu6071_plasmid_genes.fasta	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,1937 @@
+>lcl|NZ_CM001166.1_gene_1 [locus_tag=STTU_p0001] [location=183..2918]
+TTGGCTCGTCTGCCTCGTGAGGAGATTCAAATGTCTGTTTCCCGGGTTCCGCTGCGGAAACATCAGGTAG
+AGCTTATGTCGGACCTCAGGAAATGGGTCCGGGTAGCCGCCCGGGAAAGCGCCCGCACGGAGCGTGGGGC
+GCGGGCCACGGTGGTGTCCGCTACGGGTACGGGAAAGACGATCAGCGCGGCTGCTGCGGCGTTGGAGTTG
+TTCCCTTCGGGGCGGGTTCTCGTGATGGTGCCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGC
+GGGCGGTGGGGCACACGGCGCCGATGGTCGGGGTGTGCTCGCTGCCCAGGGATCTGCTCCTGGAGGAGCT
+GCGGGTGCGGACGACGACCCACCCGATCCGGCTCGCGCTTTGGGCCGGATCGGGGCCGGTGGTCGTGCTG
+GCGACGTACTCCTCGCTCGTGGGCGAGGACGGGCAGGGCGGACCCTTGGAGGCCGCTCTCGCCGGGGCTG
+GCTTGTACGGGCAGCGGATGGATGGCTTCGACCTTGCGGTCGTGGACGAGGCGCACCGCACGGCGGGCAG
+CGCGGAGAAGGCGTGGGCGGCGATCCACGACAACGCCCGTTTTCCGGCGGCGCACCGGCTGTACCTCACC
+GCGACCCCGCGCGTCCTGGCCCCGGCCCGTCCCGCCAGGCACGAGGGCGAGGAGGGACGCGGGGAGGCGC
+CGGCACTCGTGACGATGGCGAATGATCCGGCGGGCGAGTACGGGGCGTGGATTCACGAACTCGGTTTGTC
+CGAGGCAATCGCGCGAAAAATCGTCGCGCCTTTTGAGATTGACGTTTTGGAGATTACTGATCCTGAGCCG
+GAATTGATGGAGGGATTGGATCGGGAGGCGCGGCGTGGGCGGCGGCTTGCGTTGCTTCAGACCGGGCTTT
+TGGAGCACGCGGCCGAGCATAATATTTGCACCATGATGACGCTTCATCAGCAGGTTGAGGAGGCGGCGGC
+TTTCGCGGAGAAAATGCCGGAGACGGCGGCGGAGCTTTACCGGAATGAGGTGTCGGCGGAGGATTTTGCC
+CTGGCCGAGGAGCTCCCGGCCTCCGAGGTGGGTGGGGGGTTCTACGAGCTGGAGCCGGGGCGTCATGTGC
+CGCCGTCGCGGGTGTGGTCGCGGTGGCTGTATGGGGAGCATCCTGTGGCCGAACGGCGTTCTGTGCTGCG
+GGAGTTCGCGAACGGGATGGACGCGGAGGGGCGGCGGGTGCACCGGGCGTTCCTCGCTTCCGTACGGGTC
+CTGGGTGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTTGCCGACGCACGCGGGT
+CTCAGGTGGAGATCGTGCAGAACATCGGGCGCGCGTTGCGCCAGAACCCGGATGGGCGGGCGAAGACGGC
+GCGGATCATCGTGCCGGTCTTCCTGCGGCCGGACGAGGACGGGGAGGGCATGGTGGCGTCGGAGGCGTAC
+CGGCCGCTCGTCGCCGTACTCCAGGGCCTGCGCTCGCACGACGAGCACCTGGTCGAGAAACTCATGCTGC
+GGGCGCGCGTACGGGCCGAGAGCGCGAGCGCGCGCAGCGCGGAGGAGGGCGGTGCGGGGCCCTCGCGGCT
+CCTGTCGGACTCCGGGACGGCGGCTGCGGCCTCCGAGGGCGTCGAGGGCCAGGAGCAGGGCGAGGACGGC
+GCCGAGGCGGAGTCGGTGCTGCTGCGGTTCTCCTCGCCGCGCGCGGCGTCGACGGTCGCGGCGTTCCTGC
+GGACGCGGGTGTACCAGCCCGAGTCGCTGGTGTGGCTGGAGGGGTACGAGGCCCTGCGCGCCTGGCGGGC
+CGAGCAAGGGGTGAGCGGGGTGTGCGCGGTCCCGTACGACGCCGAGGTCGCCGCGGGGGCCTCGCGGCGG
+TACCCGGTCGGGCGGTGGACCGCCGCGCAACGCCGCGCCCGCCGCGAGGGCACCCTCAGCGCACACCGCG
+TCGAGCTCCTCGACGCGGAGGGCATGGTGTGGGAGCCGCGCGAGGAGGAATGGGAGCGCACGCTCGCGGG
+GCTTCGCTCCTACCGGACGGCGTACGGGCACCTCGCCCCCCACAGGCGCGAAACCTGGGGCGAAGACGAG
+GGTGAGGACGTCGTACGCGTCGGGGACCTGATGGCGAACCTCCGCCGCAAGGACGGACTCGGGAAGGACG
+CGAAGCGGGCCGCCGCGCGCGCCGCGCAGCTGAGGGCCGTCGATGCGGACTGGGACTGCCCGTGGCCGCT
+GGACTGGCAGCGCTGCTGCCGGAAACTCGTGCTCCTGGCCGCGGACGAGCCCGGCGGGCGCCTGCCGGAG
+ATCGCGCCCGGGGTCTGCCTGGACGGGGATGACCTCGGGGTGTGGGTCGCGCGGCAGCAGGAGCCGCGGG
+TGTGGGCGCGGCTCAGCACCGAGCAGCGGGCGCGGCTCGAAGCGCTCGGGCTGCGGCCCACCGAAGCGGC
+CCCGGGGCGGGGTGTGGAGGGCACGGGGGCGGCGGGGAGCATGAAGCGGACGGCGACGGCGCGAACGGCT
+TTTCAGCGGGGTGTGGCGGCGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGGGAAACCCGTACCCCGCA
+AACACGTCGAGACCGTCAGCGTCGACGGCGAGGACGTCGACGTACGCCTCGGCGTATGGATCTCGAACAC
+CAAGAGCCGGTACGACGGGCTGAGCGAGGACGAACGCGCGCAGCTCACCGCACTCGGAATGCCCTGGGCA
+GGATGA
+>lcl|NZ_CM001166.1_gene_2 [locus_tag=STTU_p0002] [location=complement(2995..3171)]
+GTGCTCGCCGCCGTACGGGACACGATCGCCGAGACCGGCCAGGGACCGTCCGTACGGCAGATCCAGCGCG
+TCACCGGGCTCGCGCTCGGCACCATCGCCCACCACCTGAAGGCGCTGGAGGAGAGCGGCCCCCTCGTCCG
+TACGGGCCTGCACTGGCGCACCTGCCGCCTGGGCTGA
+>lcl|NZ_CM001166.1_gene_3 [locus_tag=STTU_p0003] [location=complement(3195..3407)]
+GTGACCGATGAACTGCTCCGCCTCGCCCAGGAGAGGCGTGCGACCTACCGCGACCTCACCCTCGGCGGCC
+CCGCCCGCCCCCCGACACCTCTGCGCCGGGCACTGATCCGGCAGTCCGCCCGCCTGCTCGACGGCCCGCC
+CACCACGGCCCGCCGGGCTCTGCTGTGCCGCCCGCCCACGCCCGCGTCCCCGCCCTCGCGGGGGACCAGG
+TGA
+>lcl|NZ_CM001166.1_gene_4 [locus_tag=STTU_p0004] [location=3510..3866]
+GTGACCGATTTCCCCGACGATCTCCTCGCGGCTCAGCGCGACCTCACCGCCGTACGCGCCACCCTTTCCG
+CCCGCCTCGCGGCGCTGCCGCCCTCGGCCGAGCCGATGCCCGCGTGGGAGCGGCCCGACGGCTACTGGGC
+GGGCGCCCGTACGCACCCGGCCTCCCCGGGGTGGAGCGAGGAGGAGCGCGAGGAGGTCGCCGCGCTCCGC
+GAGCGGGAGCGGGATCTGGCCGGGGTGATCGTGACGCACGAGCTGTGGGCGAGCGTGCCGGCCGGGGAGC
+GGATGCGGGCCCGCGACGCACTCAAGCACGCCCACGAGGCCCCGGCCGCAGCCGGGGCGGCGGGGGCGCG
+GGGCTGA
+>lcl|NZ_CM001166.1_gene_5 [locus_tag=STTU_p0005] [location=complement(4344..5609)]
+ATGTCACAAGCCAATCACAGGACATCCGGCACTCCCACGGCCGAGCCCGTTGGAACAGCAGAGGAGATCG
+TCATGGCAAGTAGCAACCGCGCCGTCACCTTCCAGAACCCGAAGGAGATGCGCGTCGAGTCTCTGGATTT
+CCCGAAGCTTCAGATGCCGAACGGGAAGAAAGCCCCGCACGGCGTCATCCTCAGGATCGTCGCCACCAAC
+ATCTGCGGGAGCGATCTGCACATCTACCGTGGGTCCTTCCCGGTGCCCCAGGGTATGGTGATGGGCCACG
+AAATGACCGGGGAGGTCATCGAGGTCGGCCCCGACGTCGAGTTCCTCAGCGAGGGCGACCTCGTCTCCGT
+CCCCTTCAACGTCGCCTGCGGCCGATGCCGCAACTGCCGGGCCCGCCGGACCGACGTCTGCGAGACCACG
+AACCCTGAGGTGTCCTGCGGAGCGTACGGCTTCAACCTGGGCGACTGGACCGGTGGACAGGCCGAGTACT
+TGTTCGTCCCTTATGCCGACTTCCAGCTCCTGCGCTTCCCGGACAGGGACCAGGCCATGGCGAAGATCCG
+TGACCTGGCGCTGCTCTCGGACATCCTGCCCACCGCGTTCCACGGCCTCATGGAGGCCGGCGCCAAACCG
+GGCTCCACCGTGTACATCGCCGGCGCCGGCCCGGTCGGCCGCTGCGGCGCAGCAGCGGCGCGGCTCCTCG
+GGGCGTCCTGCATCATCGTCGGCGACTACCACAAGGACCGCCTGGAGCTGATGAAGAAGAACGGCTGCGA
+GACGATCGACCTGAGCCAGGACGCAGCGCTCACCGACCAGATCGAGGCCATCCTGGGCGAACCCATGGTC
+GACTGCGCAGTCGACTACGTCGGCACCGAGGCACACGGCATCGGCCGCGAGGCAGAGGACATGGACCCGG
+CCCACGCCCTCAACCAGGTGCTCGACGCCACCCGCGCGGGCGGAGCCACCGGAGTCATCGGCGTCTACGG
+TCCCGACCCGCTCGCGAAGTCGAAGGCCGAGCAGCAGGGAACGTACCCGATCGACTTCGGCAAGGCCTGG
+ATCAAGTCGCCGCGGCTCGCCGCCGGGCAGGCACCGATCATGCACTACAACCGTGAGCTGATGATGGCGA
+TTCTGTGGGACCGCATGCCCTACTTGAGCGCGATGCTCAACACGAAGGTGATCAGCCTCGACGACGCCCC
+TGACGCCTACGCGACCTTCGACACCGGCGTGTCCGAGAAGTTCATCATCGATCCCCACGGCCTCATTGCC
+GCCTGA
+>lcl|NZ_CM001166.1_gene_6 [locus_tag=STTU_p0006] [location=complement(5617..6174)]
+ATGACCAACGACTTGCACGGCAGGAAGATCGCAATCCTGGCCACGGACGGCGTTGAGCGCGTCGAGCTCG
+AAGAACCTCTCGGCGCACTGCTGGGTGCTGGAGCGCAGGCTGAACTCCTGTCCCTCCACACCGGCGAAAT
+CAACGCGCGCCAGATGGACATCGAGCCGGCCGGAACCTTCACCGTGGACAAGAAGGTCGCCGACGCCCGG
+ATGGGTGACTACGACGCGCTCCTGCTGCCCGGCGGCACCATGAACCCCGACCAGCTGCGCGCCGACCCCG
+ACGCCGTCGCCTTCGTGAGGGGGTTCGTGGAGACAGGGAAGCCCGTTGCCACCATCTGCCACGGACCCTG
+GACCCTGGCCGAGGCTGACGTGCTGCACGGTCGCCGCCTCACCTCTTGGCCCAGCATTCGGACTGACCTG
+CGCAACGCCGGCGCCGAGGTCGTCGACGAGGAGGTCGTAATTGACCGCCAGCTGATCTCCAGCCGCGGCC
+CGCAGGACCTCTCTGCCTTCTGCAAGGCGATCGTCGAACGCTTCGCCAACGCACCGCAACCCACCTGA
+>lcl|NZ_CM001166.1_gene_7 [locus_tag=STTU_p0007] [location=complement(6230..6499)]
+ATGTCTTGCGGAGGTGGGGCAGCAGGAGAAGATCTCTTCGTGCGGTACTCCGTCCCCCGGGGACGCGCCC
+GCACGACTGCGGGGACCGGCCCGGCCAACGTCAAGGCGTACAACCGGCAGCTGTGGGCCCTGATCGCGCA
+GGGTAAAGCCAAGCTGGCCTGGATCGTTTTCCAGGAGCTGTCGCTGGACCGAGCACCGAGCCTCCCAGCA
+CCTTCGGCCACCGAGAGGGCAGTCGGGCCAAGGTCCTCCTCCCTCATCGACGGCAGCTGA
+>lcl|NZ_CM001166.1_gene_8 [locus_tag=STTU_p0008] [location=complement(6829..7137)]
+ATGACAACGCAGGTCAGCAAAGCGGTTCTGGTGCGCCTCGAAGCGCTGCCCGGCAGGGAAGACGACGTCC
+GCGACTTCTTGAACCAGGCGCTGTCGGTCGTCATGGGGGAGCCCAAGACCGTCAGGTGGATCGGAATCCA
+GTTCGGACCATCGTCGTTCGGGATCTTCGATGCCTTTCCCGACGATGAGGGACGTCAGACGCATCTGTCG
+GGTGCGGTCGCCAAAGCGCTCGGCGAGAAGACGGGTGAGCTCTTCGAGGAGCCCACAATCGAGCAACTCG
+ATGTCGTCGTGGAGAAGCAGCCCGCGTAG
+>lcl|NZ_CM001166.1_gene_9 [locus_tag=STTU_p0009] [location=complement(7191..7337)]
+GTGAGGAATCTCCACGGCGTCCAGGTCACCAACAGGGGCTGGATGAGCATCTTCGTCAGCAGTATCTCCT
+ACACCGCGACAGTCAAAGCGTCAAGCGGTAGGGGTGATCGGCGAGCAGTGGCAGATGGGTCGGCGCATCG
+GGCGTAG
+>lcl|NZ_CM001166.1_gene_10 [locus_tag=STTU_p0010] [location=complement(7773..7934)]
+GTGCCGGCAGACACCATCGTACTGTTCCGGCAAAAAGCGCTCATTCTCCACAACGCCCGGGATATCGCCG
+AGATCGTCCGCCAGCTGCTGGGGGAGCCCTGGCCGGTCGAGCCGGAGAACCTGTCGAGCCGGAGGACCTA
+TCGAGCATCTCGCCCTATCTGA
+>lcl|NZ_CM001166.1_gene_11 [locus_tag=STTU_p0011] [location=complement(7994..8878)]
+GTGGACTTGGTGGTCCAAAGCCTTGGCCACCGTTACATCCAGGAGGAAGTTATGGCGGATCCGCGGGCGG
+TCAGCCTTCCTTGTGGGGTTGCGGTCACGGCGCTCGGTCAAGGTACCTGGGGGATGGGGGAGAATCCCGG
+GCGCCGCGCGGCCGAGGTGTCGGCCTTGCGTGCCGGGCTGGACCTGGGGATGACTCTTGTCGACACCGCC
+GAGATGTACGGGGACGGCGCGGCGGAGGAGGTGGTCGCCGAGGCGGTGGCCGGACGGCGGGACGAGGTCT
+TCTTGGTCAGCAAGGTGCTTCCCTCCCATGCGGACGCCCGCGGAGTGGCCGAGGCCTGCCGGGGGAGCCT
+GCGCCGTCTGCGCACGGACCGGATCGATCTGTATCTGCTGCACTGGCGTGGAGCCGTGCAGCTGGAGGAG
+ACGGTTGAGGCGTTCGAGGCCTTGGTGCGGGAGGGTGCCATCCGCTCCTGGGGTGTGAGCAACCTGGACG
+TGGATGATCTCGCGGACCTGCCGCCTGGAGCCGGGCCGCAGACCGATCAGGTGCTGTACAACCTCAGCCG
+TCGAGGGCCTGAGTACGGTCTGCTGCCCAGGTGTCGTGAACTATCGATCCCCGTGATGGCGTACTCGCCG
+GTCGAGCAGGGCCGACTGCTCCGCCACACGGCGCTGCGGGACGTGGCAGCCGCCCACGGTGCGACGCCCG
+CGCAGATCGCCCTGGCCTGGGTCCTGCGGCACGAGGACGTCATTGCCATCCCGAAGGCGTCCTCCCGCGC
+GCACGTCGAGGAGAACAGAACAGCTCTGGAGGTGGACCTGACCGCCGAGGACCTCGCGATGCTGGACCGG
+GCGTTCCCGCCCCCGAAGAGCAAACGCCCGCTGGAGATGCTGTGA
+>lcl|NZ_CM001166.1_gene_12 [locus_tag=STTU_p0012] [location=9096..9602]
+GTGGGTGGTGCTCGTGGACGGGCAGGAGGTCGGGGGCGGCTCCCCGCGCGGCGCCAGCTGGCGGACGGGT
+GGCGGTACCACGTCGCGCTCCCGCTCTACCGCACCGTGGGCGGGGAGGGCCTGGAGGTCGAGGCGGCGCA
+GTACGAGGTGTGGGTACGCGCGCCCGAGCACGTACGGCCCGTCGAGGATGTCGACTACACGGGCATGCCG
+ACCACGGCGCTCCCGGCGCCCTCGCTCGTGGACGTGGCGCTCGGCCCGCGCAGGCCCGCCGGGTGGGTGC
+TCGCGAAGAGCGGCGGCGGGCGCCGTGGGCCCTCCCGTGCGGTGCTGCACACCGTCGACTGCGCCGAGGC
+GCCGCCCGGCCTCCCGGTCCTGCGGGTGGAACAGGCGCTCAACGCCGCCGAGCACCCCGCCACCCGGGCC
+TGCGCCCTGTGCGGCGCCGCCGCCGAACTCGACCCGCTCCTCCGGGGCTTCGACCCTCACGACGAGGACA
+CGGGCGCTTCTCCCTGA
+>lcl|NZ_CM001166.1_gene_13 [locus_tag=STTU_p0013] [location=9685..9906]
+ATGGCACCGGCCGACGTCTGCCTGGAGGCGGTCTGTGAGGAGCCGCGCGAGCGGGTCGACGGCGTGCTCT
+ACGCCTGCCCCGCCCACGGGGCCGAGGCGGCCTCGCGGATCACCGAGGCGGGATGGACCGCGCTGGTCAA
+AGTGATGGGGCCCGCGAGCCGGGCCAGGTGCGAGGTCTTCGACGGCGCCACCCGCGAGGCACGTCACCTC
+CTGGGCGCGTAG
+>lcl|NZ_CM001166.1_gene_14 [locus_tag=STTU_p0014] [location=complement(9913..10197)]
+TTGCTCGGGGGCCACGTTGGTCACACATCCTGCCGCACTTGCCCCACGCTCTCGTGGAGCCAGCCCATAC
+AGCCACGGCACCCTCAACCCCGACACGATCACCCTCGTACGTTTCACACTTCCCCCATTAGCTCGGCAGT
+CGAGTACCGCATCCTGAACGTCCGCACGTGGGAGGCCGGGGACGACGCGGGCCTGGATGCCGCGTGGGTC
+GATGAGGTCGTGGTGGACCTCGGTTCGCAGTGGGGCCAGTACGAGTACGTCACCAACATCGGCTTCGCCG
+CCTGA
+>lcl|NZ_CM001166.1_gene_15 [locus_tag=STTU_p0015] [location=complement(10356..11891)]
+ATGAACAAGGGCTTCAAGAAAAAGCGGGTAGTCGCTATAGCGGCCGCGTCCGTCATGATGCCGCTCGTGG
+CCGCCGTTCCGGCGAGTGCCACCACCGGCGCGGAGGTCCGGGACGGTGCACGGTCCTTCACCGTCCGCCT
+CGACATCGGGAAGGGCACCCGGGGCTGTTCCGGGGTTCTGGTCGACGCCCAATGGGTCCTTACCGCGCGA
+AGCTGCTTCGCCGACAACCCGGCCACGAGCATCGACATCCCCGCAGGAGCGCCCGCGCTCCGCACGACCG
+CCACTGTCGGCCGTACCGACCTCACCACAGGGACCGGCGAGGTCCGCGAGGTCGTCCAGCTCGTTCCGCG
+CACCGACCGCGACGTGACGCTCGCCCGGCTCGACAAGCCCGTCGCCGGGGTGGCTCCCGTCACCGTCGGT
+ACTCAGCAGCCGAGCGCCGGCGAGGCCCTGACCGCCGCCGGATTCGGCCGTACGAAGACCGAGTGGGCCC
+CGCTGCGCCTGCACACCGCCACCCTCGGCATCGACGCCGTCCAGAGCCAGGACATCAGCTTCCACGGGCA
+GGACGGACAGGCCCTGTGTGCGGGGGACACCGGCGGCCCGCTGCTGCGCGAGAGTGGCGGCAACGCCGAA
+CTCGTCGGCATCAACTCCCGTTCCTACCAGGGAGGGTGCTTCGGTATCGAGGCGACGGAGACCCGCTCCG
+ACGGAATCTCCTCGCGCGTCGACGATCTCGGCGACTGGATCGCGAAGAACAGGCTCGCCGCTCGCGCCCC
+GGAGCAGATCAAGCACCTCACCACCGGCGACTTCAACCGCGACGGGCACCCCGACATCGCGGCGATCCTC
+GACGACAACAACTTGTACGCCTTCTACGGCACGAGTGACGGCAAGCTCACCTATGGCCGCGAGCTGTGGG
+CGCACGACGGCACCTGGGGTTCCAAGGCCCGCATCCTGGGCGGCGACTTCAACGGCGACGGCAACGCCGA
+CATCGCGGCTCTCAAGGACGACGGCGCCTTCCACAACTACGCCGGAACCAGCGGCGACCTGCTCAGCCCG
+GCGGCAAGCATGTGGAAGGACAAGACCTTCGCGAGCTACCTGCCGACGACGTACCGTGCCAAGGGCTGGA
+CGCGCGACGGCCTCGTTGCCATCGCGCCCACCGGCCGCCTCTACGCGTACGCGACCGGGGCCAACGGCAT
+CCTCACCGACAGTCGCACCGAGGTGTGGCACGACGCCACCTGGGACAAGAAGTTCCTCACCAGCGCCGAC
+TTCAACGGGGACGGCCTCAACGACATCGCCGCGATCTCCCAGAAGGGCGAACTGGCCCTCTACCCGGGGA
+AGACGGACGGTACATTCGCCAACGCCAAACTGATGTGGGACGACGCGAGCTGGGGCGGCTTCCACGCCCT
+GCTGAGCGGCGATTTCAACGGTGACGGCAACGCCGACATCGTTGTTCTCAACAGCGTCGACCACCTCTAC
+CTCTACCCCGGAGACGGTAAGGGCGGGCTCGGCACCCGCCGCAGCATGTGGCCCGCCATAGGCTGA
+>lcl|NZ_CM001166.1_gene_16 [locus_tag=STTU_p0016] [location=complement(12110..12643)]
+GTGTCCGTGACGACTACGGATGCACAGATGACACTGAATTCGCGCTCACGCGCCCTTCTCGCGGTCGCCG
+CCGCGACGCTCTCGCTGGCCGGCGTCTCCACACTGGCCTCCGCCGACGGGAAGGACTCCCCGTCCGTCCA
+AGCGGCAGCGGCGGAGCAGCCCGGGTACGCGGTCGAGACCTTCGACTATCCCGGCGCCGACCGCATCGCC
+GCCGAGCAGGGCATCACGCTGCGCCGGGGTGACGGCCACATCGTCCTCGCGGAGTGCGACGACTCCAGCC
+CCATGATCAAGGTGTGGACCCGTAAGAGCGCGGCCGGGAGGTTCTGCTTCCGCAGCACCGCCTCCACCGG
+GTCCCTCACCCTGGAGGTCCCCGACGTCTACGCCATCGAGACCGTCCAGCGGGCCGTGCACGCGGAGTTG
+GAGGCCGAGGGCAAGTCAGTGGAAGTGGACGTGAAGAAGGACGAGTTCAAGGGAGTGGGCGAGGGAGTCG
+GCGACGCCCCCACGGTTCTCCTCGAACTCCGCGTCACCGGCTGA
+>lcl|NZ_CM001166.1_gene_17 [locus_tag=STTU_p0017] [location=12978..16529]
+GTGGGTGTCGCCGTGCTGCTCGCCCTGACGGCCGGGATGCTCGGTCCGGCGCCGGCCTCCGCGCTCGACC
+CCGACCCGGACGAGGACGACTACACGCCGGTCGCGTACCTGCCGGCGACCGACCGGGGAAAGGTGCTCAC
+GGCGTGGGAGGAGGGCGGGCCGGGCGTCAAGGCAGCCGCCGAGGCAGCCCTGCTCGGCTCGGACGCCGAC
+GTACGGAAGTTCCTGGACGGGGAGGAGGCGCTCGCGCGGACGGCGGACGACCGCGTCGCCACGGTCCAGA
+TCCTCTCGCTCGGCGGGCGCGCCGTCCGCGAGGCGGCCGAGGAGGCCCTCGCGGGCCCCGAGGAAGGCCT
+CGCCGACTTCCTGAAGGACGGCTGGAAGGAGCCTCTGGAACAGGACCAGCGCGTCCAGGTCACCCAGATC
+ATCTCCTCCGCGGCCGGACCGCAGGTGGCGGCCGACGGGCGCAAAGCGCTCAACGGGGGTATGGAGGAGG
+TACGGAAGTTCCTCTCCGAGGGGCAGTACACCGCCGCTGACAACGATGCCAGGGTGCAGGTCGTCCAGAT
+CATGAGCACCGGCGGGCAGGCCACCAAGGAGGCCGCCCGCGTCGCGCTCAACGGCGACATCAACGACATC
+CGCGAGTTCCTGGAGGTCGGGCAGCACACTGCCCGTGCCCGCGACCAGGAGCAGGCCACGGTGGCCGATC
+TCGCCACGCAGGCCACCGAGGCCGGGCGGCAGGCGCGGGTGGAGACCGACCGCGCCAAGGAAGCGTCGGA
+TCGCGCGATCAAGGCGACGAAGCTCGCCAAGGAGGCGGCGCAGAAGGCGGCCAAGGAGACCGAGGCCGCG
+AAGGACGACGCCGTCAGGGCGTCGAACGCGGCAGGTCGTGCCGCCGACGCCGCGCGCGGTGCCGCACGGG
+CCGCGCAGGTGGCCATCGACGCCGCCAGCGCCGCCAACCGGGCCGCCCGCGTCGCGGCCAACGCCGCCGC
+CCAGGCAGCCTCCGCGGCAGCCGCCGCGGCCAACGCCGCCGCTCGGGCCCGGAACGCCGCCGCGGCAGCG
+GCCACCGACGCGGGGAAGGCGTCCGCCGCCCGCTCCGCGGCCGAGGACGCCCTGGACGCCGCCAAGGGCG
+CGAAGAAGGCCGCCCAGGCCGCCGACTTCGCCGCCACCGCCGTCGTCGAGGCGGCCGGCGCCGCCCAGGC
+AGCCGCCAGTGCCGGGCAGAACGCCGACGCCGCGGCGTCGGCCGCGTCCGAGGCGAGCGGCCAGGCCGGC
+GTCTCCGACGCGCAGGCCGCACGGGCCAGGGCCGCCGCCGCCGAGGCGCACCGGCACGCCGCCGAGGCGA
+CGGCCGCCGCCAACCGGGCCGACTCGCTCGCGGCGAAGTCGGCCAAGGCGGCGCGTGAGGCGAGGGACGC
+CGCCAACGCCTCTGCCGAGCACGCCGAGAAGGCGGCTGCCGCCGCCAAGGAGGCCGCGGAGCACGCGGGC
+GAGGCAGCCACCGCCGCGGCCGAGTCCACCAAGCACGCCGCTGCCGCGAAGACCGCCGCGGACGCGGCGA
+GCGCCGCGGTCCAGCAGGCCAAGGACACGTTCACGCTCGCCCGCGAGGTCGAGGCCGAGGAGCTGGCCTC
+CCGCACGGCCGGAGCCGTCGAGCAAGCGCGTTCGCTGCGGGACCAGGACGACGAGCGCATCGCCGAGGGC
+AAGAAGCAGGCCGACGCCGCCGCCGCGCTCGACTCCGAGGCAACGGAGCTGGCCGAGGAGATCTCCGCGT
+CCGGCGAGAACACCGACGCCCTCGCGCCCAAGGCACGCAAGGTCGCGCTCAACACCGTCAAGACACGAGG
+CCCGTGGAGCGTCAGCGCCGCCGAGGTCGCCCTCGCGGGCTCCGCCGACGACGTCGTGCGGTACGTGGCC
+GAGGGCCGCGAGGAGGCCGCCGCTCTCGATCGGCGCGCGCGTGCCGAGACGCTCGCCACCGACTCGACGT
+CGGCGGACGTGCGGACAGCCGCCGCCGCTGTCGTGGAGGAAGGCGACGCCCCGATCCAGGAGTTCCTGAG
+GACGGGACAGTTCCAGGCGGTCTCCAATGACCTCCGCGTGCGCATCACCCAGTTGATGAACGGTGCGGGC
+CCCGGCGTCAAGGAGGCGGGCCAGGCCGCGCTCAACGACGGTTCCCCCGCGAAACTGCGGGACTTCGTCG
+ACAGCGGCTACTACGTGCAGCGGGCCAACGACGAACGCGTCCAGGCGACGCAGCTCGTCGGTTCCGGGAC
+ACCGGAGGAGAAGGCCGCCGCGCGCATCGCCCTGGAGGGACCGCCGCAGGTCCTGCACGCCTTCACCGAG
+ACCGGCCGTTTCAAGGCCAAGCGGCAGGACCTGCTCACCGCGACCCACACGGCGCGAGTCCAGGGCCTGA
+TAGCCAGCGCCGCCAAGGTGGCGGCCGTCGCCCAGCAGAACGCGGCGCTCGCCGGTGAGACGGCGGCGAA
+GGCGCGCAAGGCCGCCGCCGAGGCGAAGAAGTACGCGGACCAGGCGAAGGCGTCGGCCGAGCAGGCCGCG
+TCCTACAGCAAGGACGCCGACGCCTCCGCCGACGCGGCGCAGAAGTCGGCCGACCAGGCGGCGAAGTCGG
+CGAAGACGGCCCGCGCCGCCGAGGCCGACGCCCACGCCGCCGCCCGGGACGCGGACCACTCCGTCGCCCG
+CGCCGAGGCGTCCGCCGCCTCCGCGCACGGCTCCGCCAACTCCGCCTGGGCCGCCGCCGGTGCGGCACGC
+GCCTCCGCCGAGGCGGCGGGCAAGGACGCCGACGCCGCGGCCGAGGCGATGACCGAGGCGCTGAACGTCG
+CCGCCGAGAAGCAGTGGGCGGAAATCCGCAAGGCGCTGGAGGACGAGCAGGACCGGGCCGACCAGGCGTC
+CCTCCAGGAGCTGGAGGAGTACTTCGCCGACCTGGCCAAGCAGCAGGAGAGCGGCGACACCGACTGGTGG
+GACCTCGCCACCCTGGGGCACACGGTCCTGGACACGGCCGGGCTGGTGCCCGGTTTCGGGGAGATCGCCG
+ACGGTATCAACTGCGGCTGGTACGGAGCCGAGGGCGACAGCCTGAACGCGGGCCTCTCCTGCGCGGCGAT
+GATCCCCTTCGTCGGCTGGGGCGCGACCGGCGGGAAGTGGGGCAAGCGCGGTGTTGACGCGATCGAGGCG
+TTCAACAAGGCCATGCGTGCGGAGGGGAAGGTCCCGCACATATGGTCGGCCAATCCTCGCAAGGGCCGCA
+ACAACGTTCAGAACGCCTACAGCCACTGGAAAGACCACGGCGCCCAGTTCCCCGAGCTGAACAACGCGCT
+GGACTACGTCAAGAAAGCGCGGCAGTACGGGGACATGGCACTGGCGCAAAAGCCGGTGAAGGGCTATCGC
+GTCTTCTCGCAGAACGGCGGTGCGGTGGCGATCTTCGACGAGAGCAACGGCGCTTGGGCCGCCTTCACGA
+AGGACGGGATCCCGCAGACCATGTACAAGCCCGAGCCACGCAGCCAGAGCAATCCCAACGGGTACGCGAC
+CACCATCGAGGACTGGCTCGCCGAGCCCGGCCGCGGCACAGAGATACGCTGA
+>lcl|NZ_CM001166.1_gene_18 [locus_tag=STTU_p0018] [location=16534..16818]
+GTGGCTGAAGAGGAAGAGTGGACGAAGGTCCCGGTCGAAGAGGTCTGCCGGGTGTGCGGCCTCTATGCCG
+AGGGGGCCCTGTGGGACGAGTACGGGGCGCCGCAGTACCTCACCTGCCCTTGCTGCGGTGTGGAGTCCGG
+GCTCGGTGACGCGTCCTACGAAATGGTCACGTGGAACCGGGCGCGATGGCTTGAGTCCGGCGCGGAATGG
+CAAGAGCCCGAGTTCCGTCCCACGAACTGGAGCCTGGAAGAGCAACTGGCCTGTATTCCCGCCAAGTGGC
+GCTGA
+>lcl|NZ_CM001166.1_gene_19 [locus_tag=STTU_p0020] [location=complement(17296..17580)]
+GTGCTGACGCGCTCGGCAGGCCTGACGGCCAACCAGCGCCTCGTCCTCATGCTCTACGCGACGCACAAAA
+CCGACCGCTCCGGCGCCGTCCCGGTGACCGCCGCCGAGCTTGCCGCGCACCTCGGGCTCGCGCCCACCGT
+GTTCTCCCGCACCCGTCGCCAGCTCGTCGCGGGTGGATGGCTGGAGGAATCGGAACGGTTCGGTCACATC
+CGCTTCTACCGCCTCGCCCCGAAGAGCACCGGAGAGCAGGTCGTGGTCCCCCTGCGCCGGACCGGCACCC
+GCTGA
+>lcl|NZ_CM001166.1_gene_20 [locus_tag=STTU_p0019] [location=complement(17607..18065)]
+GTGGGAGCCGTGCGCAGGCTGGTCGACGAGGCCACCGGCGAAGTCGTGCCCTATGCCCCGTACGCCTTCT
+CCGGCGGCGGACACGTCCAGGTCGACAAGGCGCGCGTCGCGGCCATCACCGAGAGCCGCACGTTCACGCC
+GAGCCAGAAGTACTTGATCCTGTGGTGGATCGGCACGTCACCGCCCGGCATGGAACCGCTGCGCCTCACC
+GGCGCGGACATCGCGAAACGGGTCGGCATGACCCCCGACGCGGTCGGCAAGATCAACCGGGCCCTGCGCC
+GGCGGCGCATCCTGATCGAACGCGGCCGGGTGGGCAGCTACCGCTTCTACCGGATCAGCCCCTACATCGC
+TTTCCACGGCAGCGGAGTCGAGCAGCGCGAAGCGATCACGCTGTGCAACCCGCCCGACATCCCAGGCTTC
+GACAAGGACGCCCGCACGGCAGCGCAGGAGGCGCAGTGA
+>lcl|NZ_CM001166.1_gene_21 [locus_tag=STTU_p0021] [location=18119..18415]
+GTGCATGTGGGACGCCTGAGGGACGGGCTCATCAACATGGACGCACCCCACCCCTTCAACGCGGGGCCGG
+ACGGGTCCCGGACGCCGGTCGAGGAATGCAAGAGCGTCAGAAGCCCACGAGGACCTCATGCCCGATTCCG
+GGAAGCCACCCCCCCCTCCCTCATGTACTCCACGTGCATTTACCCGGTTCCTGGGAACTGGCAGGCAGAT
+CCTGGGAACTGGCAGGCAGATCCCAGGATCGTGGTGTCCGACAACGTTTCAGCAGGTCGGAGGGGATTTC
+CTGGCGCCGCCCTCTAA
+>lcl|NZ_CM001166.1_gene_22 [locus_tag=STTU_p0022] [location=19059..19361]
+ATGAAGCCGATGTTGGTGACGTACTCGTACTGGCCCCACTGCGAACCCAGGTCGACCACGACCTCGTCGA
+CCCACCCGGCACCGGCGCAGGTTGAGGGTGCGGTCCGAAATCGTGAGCCCGGCCTCCCGGGCGGCGGCGA
+GCTGGCGGGGGCTGCCGGTGAGGGGGCGCAGAGGGGCCGTGAGGTGACGGCGGGTGGTGACCGGGGAGGC
+GACGAAGCCCGCGAGGCTGTCGAGGCCGCGGGGCGCGACGACGCTCTCGTGCACGGCGAGGCCCGCGCGC
+CACCGGAATATGCGCACGCCTGA
+>lcl|NZ_CM001166.1_gene_23 [locus_tag=STTU_p0023] [location=19390..20079]
+GTGCACGTGTCCACGTTTTCCGGAGGACTCATGAAGATCGGCATTGTCGGCGCGGGACACATCGGCGGGA
+ACCTCACCCGCCGTCTGACGGCGCTCGGGCATGACGTGAGCGTGGCCAATTCGCGTGGCCCACAGACGCT
+GTCCGAGCTCGCCGAGGAGACCGGGGCCACCGCGGTTCCCGTCGCCGAGGCGGGGCAGGGCGCGGACATC
+TTCGTGGTCACGATCCCGGTGAAGAACATCCCCGACCTGCCCGCCGGGCTCCTCGACGGCGCGACGGAGG
+GGTTCGTCCTCATCGACACCGGCAACTACTACCCGCAGCGCGACGGCCGGATCGCCGGGATCGAGGACGA
+GGGCCTCACCGAGAGCCGATGGACCGAGCGTCAGCTCGGGCACCCGGTGGTGAAGGTCTTCAACGCCACC
+TACGCCCAGGACCTCCTGGACAAGCCGCGCCCCGCAGGCGCCGCCGACCGCATCGCCCTGCCCCTCACCG
+GTGACGACGAGGAGGCGAAGAAGACCGTGACGTCCCTGCTCGACGAACTCGGCTTCGACGCCGTCGACGC
+GGGCGGCCTCGACGAATCCTGGCGCCAGCAGCCCGGCACCCCGGTCTACGGGCTGGCCGCGGGCGCCGAC
+GAGGTCGTCGCCGCGCTGGCCGCCGCCACCCCGGAGCGTCCAGCGCAATTCCGCGCCTGA
+>lcl|NZ_CM001166.1_gene_24 [locus_tag=STTU_p0024] [location=complement(20276..20899)]
+GTGGAGTTCATGCTCTGGGCCGGAGACCTGATCTGCGTACGCCGCACCCCCACCTGGCAACGCCTCCTCG
+ACCTCCCCGAGCGCCACCTGGCCACCGCACTGCACACCAACCGCCTCACCGACGAGGAATGCCTCACCGC
+CCTCCTCACCCACGCCGCCCGCGCCCTCGGCATCGCCACCACCGCCGACCTCGCCGACTACCTCCGCATC
+TCCACCCGCACCACCGCCGCTCTCCTCCCGCACACCCCACTGCTGCCCGCCACCGTCGAAGGATGGACCG
+AACCGGCCTGGGCCCACCCCGACGCCCTCACCCCACCCGCCCCGGCAGACGACCCACCCGTCTTCCTCGG
+CCCCTTCGACAACCTCATCTTCAACCGCCCCCGCACCCAACGCCTCTTCGGCTTCACCCACACCCTGGAG
+GCCTACAAACCCGCCGCGAAGCGCGAGCACGGCTACTACGTCTGCCCCCTCCTCCACCACGACCAGCTCA
+TCGCCCGCGCAGACCTCACCCGCACCACACACGCCGTCACGATCACCCAGACAAGCACCGAAACCAACGC
+GCCCGGGAACGCCAGCGCTCTTATCCACGAAGCTCTGCAACACCTCACCCACGCCGCACAGTGA
+>lcl|NZ_CM001166.1_gene_25 [locus_tag=STTU_p0025] [location=complement(21382..22413)]
+ATGGGCACCGCCACGATGACCCTGACCGCGACCGCCGCCGGGAGCGTCGCCGCCCGCTGGCCCTGGTGGA
+CGACCCTCCTCCTCGTCCTCGCCGCCAACCTCACCAACCCGCCCCTCAACGCCGCCCTGCGTTCCTCCTG
+GCGGCGCCTGGTCACCACACCCACCCAGCTCAAGACGGTCCACTCGGCCGACAGCATCCTCGAAGAAGCC
+GGCTTCGTCGTCGCCCCCCTGACCGCCGGAGTCCTCATCACCTGGCTCGGCCCCGTGGCCGCCTACGAAA
+GCGCCACCGCCCTCTACCTCACCGTCATCGCCCTCTACCTCACCGCCGCCCGCCTCTGGGGCCTCACCCC
+CACCAAACCCCCCGCCGCGCAGGCCGGGCGGAGCGAGCGCGCGCGGCGCGCGCACCGCTGGCTCGGGCCA
+CTCGCCCAGCCCCGCATCATCGGGATCATGATCCCCATGCTCGTCATGGGCACCCTGTTCGGCGGGACCA
+GCATCTACGTCCCCGCCTACAGCCAGCACGAGCACGCCACCACCCTCATCGGCCCCCTCCTCGCCGCCAC
+CAGCGCCGGCGGCGTCCTCGGCGGCCTCCTCTACGCCCTCCTGCCCACCCAGCGCCTGGCCCCCTGGACC
+CTCTACCGGCTCCTGACCGCAGGGTTCGCGCTGCCCGCCTGCTTCCTCCTGGCCGCCCGCCCCCCCTGGG
+CCCTCGCCCTCCTCCTCCTGCTCAGCGGCTTGTTCGTCACCCCGCTGTTCATCACCGCGTTCCTCCTCAT
+CGACACCCACGCCACCGACGACGTCCGCACCGAGGCCAACACGTGGGTAGGCGCGAGCACGGACGTGGCC
+AACGGCGTCGTCGCCGCCGTCATCGGCGCCCTCACCGCCCACAACAGCTTCACCACCGCCCTGACCGTCC
+TCACCGCCTGCGCCGCCCTCGGCCTCCTGACCGCACTCCTCCTCCCCGCCCCCGAGAAGAGCACCGTGCC
+CGAAACCTCCCCACACGTGCCCGCCAACGACGCACCGGCCACGACCGCGTGA
+>lcl|NZ_CM001166.1_gene_26 [locus_tag=STTU_p0026] [location=complement(22689..23459)]
+ATGGTTGATGTCGCGTTCACCGCGCTCTACCCGTGGAGCCTGCCGCCCGACAAGCCGCGTACCGACCGGG
+CGGCCGCCCGGTCGGAGCGCGACCTGTACGCGGCGCATTTCCGGCACGCGCGGATCGCCCGGCTGCCCGC
+GGACTGCCCGCCGTGGGCGCTCGGCCAGGATCTCGGCTGGGTGGTGCGCTCCCCGGTCACCGCGACCCTG
+ACGCCGCTGTCGGACACGGACGTCGCCGTGCCCGAGGACGAGGACGTCAGAGCGGTGAGCCGCCGCGCGG
+GCGGCGGGCAGATGTGGCGCCGCGGCCCCGACTGGATCGCCGTTCCCGACCAGGGCGGAAGCTGGCTGCG
+CCGCTACGACTTCCGCAACTCCAGCGGGCAGTGGGAGGCGATGTTCCTGCCCAACGGACAGGGCACCGTG
+GAGTGGCATCTCGGCGTCGCGGTCCGCCTCCCGCAGCCGTACTTCCTCATGGTCCTGCCCCTGGACCCGC
+CCCTGCCCGGCCTCCACGTCCCCGTCGGGATCATCGGCGCGAAGACCGTGAACACCATGACGGACATCAG
+CATCGCCATCCACCCCACCCACCCCGTCGCCGTCCGCCGCGAGCAGCCCGTCGCGCGCCTCGTGCTGCTG
+CACCCCGACACCCTCCGCGCCACCAGCACCACCACCCCCCTCACCGCCGCGCCCCCCGCACCCGCGTCGA
+GCCCACCCGACCCCGCCGGGCCGGCCGCACCGGTCGCTGCGCCCAACACCACGATCCTGGACGCCTCATG
+A
+>lcl|NZ_CM001166.1_gene_27 [locus_tag=STTU_p0027] [location=complement(23592..24644)]
+ATGGCACGTAACGTCGAGTTCTTCTCGACCGACACCGACGACGGCACGATCTCGGTCGTGGCGAAGGCCG
+GGCCTGGCGAGCACCGGCGGATCGACCAGATCCGGGTCGGCAACGCGCCGCGCGGCGGCGTGAAGTTCAC
+GAGGTCCGGGCGCGGGTTCGTGTGCAACACCTCGCAGAACACGATCAGCGAGATCGACCCGGTCGCCCAC
+ACCGAGGTGCGGCGGATCGAGGTCGGGCACGGCCCGCGCGGCCAGGGGCTGCTGCCCGGCGACACGTACC
+TGCTCGTCTCCAACTCCGGCTCCGACACCGTCAGCATCGTCGACCTCGAGCTGAACGTCGAGATCCACCA
+GGTGCCGGTGGGCCGCGACCCGCGGCACATGGGGATCAGCGCGGACGGCCGGAGTGCGTGGGTGTGCGTG
+TGGGGCGCCGGCTACGTGAGCAAGCTCGACCTCACGGCGCTGGTGGAACGGCAGGACGCCGCCGGGGTCA
+CCGAGGTCGCGCGGATTCCCGTCGACGCGAAGGCCCACCCCTACAGCCTCGGCATCGACCCCTCCGGTCG
+CAGGGTGTTCGTCGCGAACACGCAGGCCACCTACGTGACGGTGATCGACACCGCCACCCACGAGACCCAC
+CGTGTCGACGTCGGCTTCATCGGCGGCCGTGGGGTGGCCTTCTCCCCGGACGGGCGCCACGCGCTGATCA
+CGGTCGAGTCCATCAGCCGGGTCTACGTCATCGACGTCGACACCCTCGCCGTTACCCGGCACATCCCCGT
+CGGCGGCGGCCCCCGCGGCCTCGTCGTCGACCCCGCCGACTCCACCGCGTACGTCACGAACTTCTCCCGC
+ACGAACCTGCGCGCGGTGGCCCCGGAGCTCGACTACGACCCCAACACCCTCACCGTCATCGACCTCGGCA
+GCGCGCCTCTCGACCGCGAGGAGGGCGTCTTCGACACCGAGCCCCTCTACGTCGGCTTCGGCCCCTGCTC
+GGTGACGATGTTCGACCTCGACACCCTGCCCGAGCAGGAACGCCAGCGCCGCACCGAGCGCCTCACCACC
+TGA
+>lcl|NZ_CM001166.1_gene_28 [locus_tag=STTU_p0028] [location=complement(24697..25320)]
+ATGCAGGCGTTCGCCACGCCCGTGGCGCGGTGCCCGTACCCGGAGGCCGCAGCCGTGCGGGATGTCCTCA
+CCGAGGCGGTCCTCTCCCGCCTGGGGGAGGGGAAGGTGTTCGGCTACAAGCAGGAGACCTCCCGGGACCT
+GACCACATGGGGTGTGGCGGAGCTGGACGCGCTGACGGGCTGGGTCGGCCGGATGACGCGTCAGCTGGTG
+GAGAAGCTGGCCGGCGTCCCGCTGGGGGAGGCGTTCGCGCGCTCGGCGGGCCGGGAGGGCGAGGGTGCGG
+GGGTGCGGGCGGCGGGGATCGTGGCGTCGCGGAGCTGGGCGAGCGTGTACCGGGCGGGTGACCGGCATGC
+GGCGCACTTCCACCCGAACACGGCCTGGTCGGCGATCTACTACCTGACCGCTCCCGGTGTGTGTGAGCTG
+GACCTGCTCGATCCCCGCCCCGTGGGCTACTTCGATGCGGGGATCGTCTTCGCGGGGGAGGACCAGCGGA
+TGCGGCTCTCCTGCTCACCCGGCGACCTCGTGATCATTCCGGGGTGGCTGCGTCACGAGGTGCCCGAATT
+CCAGGACGACGAGGTGCGTATTTCCCTTTCCTGGAACCTGAACTACTCGCTCCATCGCGGCTGA
+>lcl|NZ_CM001166.1_gene_29 [locus_tag=STTU_p0029] [location=complement(25613..25759)]
+GTGCGGGCTCGCGCGGGGCGGCGGCGGTGCGGGGCCGGGGACCTTGCGGGTGCCGGTGCTGTGCGCCTGT
+GGCTGCGCCGCTTCTGCTCCCGTGCGGGGCAGGTTTTCTCTGTGGTGCTGCAGGTGGGGGTTGCGTTTTG
+GTGGTAG
+>lcl|NZ_CM001166.1_gene_30 [locus_tag=STTU_p0030] [location=complement(25840..26139)]
+GTGGATTGGGACGCTCACACCGAAGAGGTGCGCCTCGCGACCATCGCGCTGCCCACGGTGGTCTCCGATC
+TCCTCGGGCGCCTCACGGACGAGATCGAGAAGCTGACCAGGTCGTCACCACTCGCTGCGGCACGCGCCGC
+GCACCTCATGCAGGTCGCTGCGAAGCAGGCCGGCCGGTGGCCCGCGCAGAAGGCCCTGAACGACACCGAC
+CGACACGATGCGGCCGTTGCGCTGGTCGTCAGCGAGAACGGCGCGCGCTCGTTGCTGGCGCATCTCGGTG
+ATGTCAGCCTGTACGGCTGA
+>lcl|NZ_CM001166.1_gene_31 [locus_tag=STTU_p0031] [location=complement(26139..26732)]
+GTGTCTCACAGACGAGGCAGCGGCCCGGGCACTGAGGCCGCGCTTGCCCACGAGTTCTCCCAGCGGATCC
+TGATCGCCATCTCCAACGGCACCAACGCCGTCGCGGCGAAACAGTCATCCGCCGACGCGGTCGTCGCCTC
+TGGTGCGCTCGCCTGTTCCCTCGAGAGCGGCGTGCGGGCTCGGAGCGGGCGGCGACTTTCTGGTTTTTGG
+GGCGGCGGCGGCTGGGAGGGGGCATTGTCGGAGCACCGTATCTGTAGCGCGGGTGGCGAGCGGCGGGTGG
+AGGAAGTTGTGGTGGAGCGGGAGACGTGGACGGACCCGGAGTTCGGCTCCGAGCACGAGGGATGGGTCGG
+TGTTCTGCTTGAGGACGGCACGGTCCCACCACCTGTTTTCTTCGGCTCGGAGAGCAGCGCTCATCACAGC
+GAGGTGGCTCAGTGGAGCGTGTACATCGGCAGGTACCCCTACGGGCCGCGCGCCGCTGCGCTGCGGGGAG
+CCTGTGCGTGCGGCTGGACCGGGCCCGCGCACGTGCTGGACTGGGGAAGATCGGCGACCGGGAACTGCAA
+CTCGCCGGAGCCAACGCAGCGGACAACTGTGTAG
+>lcl|NZ_CM001166.1_gene_32 [locus_tag=STTU_p0032] [location=complement(26773..27093)]
+TTGCGAGACCAGTACGCCGACCACCTCAGCGCCTTCGGCGCCGCGGCAACTGAAGGAATCCAAGGTGTCC
+TGGACGAGAGCAACTACGGGCAGCTGAGCTCCCTCGACTTCGACGAGACCGAGCAGGGCATCTTCGTCTC
+TTTCACGATCGACCTGAGCGGCGAGGTCGCGGAGCGCTGGGGATCCGACGTCTACACCCGCCGCTACCTG
+ATCATCAGGACGCAGGACGGACCTGTTGACCCGGTGGAATTCGGTGCCTCTCTCCTGCACACGAGTGTGA
+TGGAAGACCTGGACACCGCTGGCAGACGCTCCGCGCGGTAG
+>lcl|NZ_CM001166.1_gene_33 [locus_tag=STTU_p0033] [location=complement(27096..27581)]
+ATGCGACGCGCGGCCATCGCTACCGGAGCCAGCATCGCCAGCACCATCGGGCTCCTCATCGCCGGCACAG
+TCCCTGCACATGCGGCGGGTGAGAACTGGGCCGTCTACTCCACCCACTTCTCGCCCAAGGGACACGACAT
+CCCGCTGCGGTACGGGCGGCACGACAACACGGCCGGGCACACGACGGGCTTCGGGAAATACCACATCGAG
+GACCGCGGACACCTGCTCGGTGTCTCCTGGAGCACGTTCAAGAAGGACATCGACGAGACTCTCGACAGTC
+CGACCATCAAGTGCAGCAAAAAGAACACCACATGGACGTGCGACTCCAACAAGATCAACGGGGTGAACTC
+GACGTGGGGCAACATGAAGGTGTCGTACACCCACAGCACCTCGGGCACCCCCGACGGCCGCGCCCGTGGG
+ATCATCACGGCCTACTACCTCAACGACTGCGGTTGCTTCGCCGCTGAGGAGAAGACCTCAAAGTGA
+>lcl|NZ_CM001166.1_gene_34 [locus_tag=STTU_p0034] [location=complement(27778..28059)]
+GTGGTCAAGGTGAGGGAGTACTGGCGCGGCGGCACGAAGGTACGGGCGCATACCCGCCTGCCTCCCGGCG
+CGCGCAAGCAGCTGACCATCGCTCTCGTCGCCGTGGCGGCCGTCTTCGTCTTCAGCCACACCGGCCCCGC
+CACCGAGGCGTCAGAGCCGCGCCGGCCATCGACGAACCGCTCCACACCGCCACCTGCGCCCGCAAGGGAG
+AAGGAGGAGCCGAGGCCGGGGCCGAGCTGGACCGTCACCTACCCCATCCCCTGGGACCGCGACGGCTCCT
+GA
+>lcl|NZ_CM001166.1_gene_35 [locus_tag=STTU_p0035] [location=complement(28478..28843)]
+ATGACCTCCCGCACCCTGGCCGCGACCGCCGCCGCCTTCCACGCCTTCTACGACCTCAACCACTTCGCCT
+ACCGCGACTACGCCGGCGCCCTCCTCCCCACCGATGAAGCCCACATCCTCGTCACCCACGTCTTCACCCT
+CCTTGCCACCGACTGGCCCCGCGTCATCGGCCGCCCCAACCCCGCCGCCTTCGCCTGGGCCCTCTTCACC
+CACCACATCGCCCTGCGCACCGGCACCCCACGCACCCCCGCACAGGACGCCGCACTCCTCTACGACACCC
+TCCACCACAGCATCAACACCATTGCCACCCTCACCGGAACCGAACCCACCCTCGTCGGCACCCTCATCAC
+CGCCACCCGCCGCTAA
+>lcl|NZ_CM001166.1_gene_36 [locus_tag=STTU_p0036] [location=complement(28851..29921)]
+ATGAGTGTTCGCCCGCCCGCGCCCCGCTCCTGCCAGGACTGCGGCACACCGCTGGAACCCGAGCCCGCCC
+GCTCCGGCCGGCCCGCCGCCCGCTGCGCGCACTGCCGTACCCGCACCCCGGCCCAGCGGCAGAAAGAAGA
+AGAGGACCGGCAGACGCGCGCCTTCTGCGAAGACGTGCTGCACGCCGCCACCGACACCGTCGCCCGCCAC
+GCCGCGGCGCTGCTGCACCAGGCTTACGGCACCACGGCCCCCACCGGCGACCTCCTCACCACCGTCGCGT
+GCCTGCAGCGCGCGCTGACCGTCGTGGAGGCCGCCACCGTCGCCCGGGCCCGCGCTCTGCACGAAACCCA
+CGCCACCGTCGCCGCCCACCTCTCCGTCTCGGCGGACCACGTCCGCAAGAAGTACGACAAGAAGCACCTC
+GACCGCGTCCTCGCCCCCTACATGGACCCGTGGAACCCGACCCCCGTCTTCGCCGCGACGGACTCCGAAG
+GCCCGCCGGGCCAGGAGCCCTCCCTGCCCCGCGCCCAGGAGTGCTCCGAACGCCGGGCCGCCGACCGCCT
+GCGCGCCGCGCTCTCCCACACGATGCGCCGCTCCGCGGCCTCGCAGCGCGCCGTCGCCGAGGCGATCAGA
+AGGCACCCCTCCTACGTCTCCCGGCTCCTGTCGGGGGAAAAGCCCCTGCACTGGCCCCACGTGCGGGACT
+TCGCCCGCGTCCTCGGCATCGCCGAGCGCCTCCTCCTGCCCCTCTACAACGTCGCCGCCGGCATCGAACC
+GCCCCCGGAGACCGATCCCGTCGCCTACCTGCGCGACTACCTCGCCGGCCTCCTCCTCTCCTGCGGCCAC
+ACCCCCCACACCCTCGGCGACGCCCTCGCCTCCACCGTGCACCCCACCGCTGTCCGCGAAGCCCTGCACG
+GCCCGGGCGTCCCCGACTGGGCCGTGCACAAGCAACTCGCCGCCGCCCTGTTCAGCCTGCCCAGCGACAT
+GCGCCCCCTCTGGCAGGCCGCCCACCACCACGCCGTCGCCCAGGCACGCACCTCGACGCCCTCGCCGTTG
+CGCGCCGAGCACTTCGGCTGA
+>lcl|NZ_CM001166.1_gene_37 [locus_tag=STTU_p0037] [location=complement(30069..30230)]
+TTGGCGGTCACCGTGCGCGGAAACCTCCTCACCGGGGCGCTCACCATGCCCTGGCTCCTCATCACGGGCA
+CCTCGTCGCCCTGGACCGCTCCCGTCCTGGCCGCGCTGAGCACGGCCGCGGTCGGCTCCAGCGTCGTCTA
+CCGGCGCGTTTGGCAGCGCTGA
+>lcl|NZ_CM001166.1_gene_38 [locus_tag=STTU_p0038] [location=complement(30862..30981)]
+GTGCGCCACGGCTCCGGGATGGACTGCGCAGAGCGGGCCGGCATGTTCGTGACCGAGCGCGCTCAGGGCC
+AAGCTGAATCACGGGAGAGGCCGGGTGTGCGGGTCTGGGGTATCCCGTAG
+>lcl|NZ_CM001166.1_gene_39 [locus_tag=STTU_p0039] [location=complement(31284..31400)]
+ATGCCTGGTGCGCGACATCACTCGCCGCGCCGATGCCGCGCGAACCGGCAGCGTCCGGTCGGGCGGCGTG
+CGGGTGCCTCGATGCCGGCGACGAGGATCTGGGCGCGCGCGGCGTGA
+>lcl|NZ_CM001166.1_gene_40 [locus_tag=STTU_p0040] [location=31454..31849]
+ATGATGATCAACGAGATCGGCCCTCGCATGGCCGGGGAGCGTCTGATGTACAACCGGGCCGTCAGGGTCG
+ACCAGCCACGTAGTTGGCTGTTCGTCTCGGGGCACGAGGCTCGCGACGACGACGGCGGCATCGCTCACCG
+GGGCGACATGGCCGGACAGATGGAACTGACGCTGCGGCGGCTGGGCGAGACCGTGGCCGAGGGCGGAATG
+AAGATGGCGGACGTGGTACAGATCCGCGTCTTCACCACCGATCTCACCTCGTGCAAGGCCCACTACGGCG
+TCCTCTTGGATGCACTCGCGGCGGTGGACTGCCGACCTGCCAGTCTGCTGGCAGAGGTCAGCGCTTTGTC
+CGACGAAGACATGCTGATCGAGATCGAGGCCGTAGCGGTGTGCTGA
+>lcl|NZ_CM001166.1_gene_41 [locus_tag=STTU_p0041] [location=32021..32137]
+ATGCATCGCATCCGGACGGTCTGGCCCGGCTTCCGGCCCTTCTCGGTACGCCGGCTGGTGCTCGTGGGCG
+GGTTCGCGCGGGGGCGCTTGAGGCGAGCTGTTGATGGGGAGATATGA
+>lcl|NZ_CM001166.1_gene_42 [locus_tag=STTU_p0042] [location=32171..33139]
+GTGGGGTGGAAAGATGAGTTTCAGATCGCGATGGGACAACTGGGCGAAATACGGGAACAGTTGGGGCGTC
+TCGAGGGGCGCCTCGACGATCCGACGGCGGGGCTTGTCGCCCTGCATGGACAGGTCGAGCAGGCCCGGAC
+GAAGATCCTGGAGAACGTGCAGGGAGGCACGACCGGGCTGCGCGAGGAGAATCGCGAGCTGCGACGTCGG
+CAAGAACGCATGATCAGCGATCTGAGCGAGGCGAGGGCGGAGCTGAGCCGTCCGGCCCCGACCCGTGCGG
+ATCTGTTGGAGAGCCCGGTCTCACACGTACCGGAGCTGGCCGAGGAGAAACCGAGTCAGGAGACCGACGC
+GCCCGGCCCGGCCCTCACCGTTGTGGGATCCCAGGACGGCAAACGCCCCACCACGGATGAGCCGGAGCAC
+GCCCTGCCCACGAATGACCTCTCGGGAGACAGCATGCGCAACTATGACCGGGCCGTCCGTGCGGAGCGGG
+ACCAAGACCGTGATCTGCGGCCGTCGGTCGAAGCCGCCTACCGGGGCACCAGCGCCCCCGCCGGCCCGGC
+ATCGACCTCTGGCTCTCCGGAGAAGGGCCTCCGGGTTGCCCACGGCGTCCTGCTCCTACGCGCCGCGGGG
+GTGGCCTCGGCCGAGGTGGTCGCGCACCGGGACACCTGGGAGTGGCTGGCTTCTCTCGCCTCCGAGCACG
+CCCACTTCCGCGCCCCGTTCGCGGTCGAGGACTCCGGAGAGGGGCGGGTACGGGTCGTGGTGTCCGGGCG
+TTCACTCATCGCGCTGCTGATCACGTTGTGGGACACGCGAGCCGACGCCGAGTCCCCGGACGGGGACTGG
+GCGATGGCGGTGACGACCTACACCAGGATGGCGAACGAGCTCTCCGAGGCCACCGGCGGCGACCACGAAA
+TAGCCGGCGCCATCCGCATCGTCCTGGACGACGGCGTTCCGGAGGAGCGGAGGGAGTAG
+>lcl|NZ_CM001166.1_gene_43 [locus_tag=STTU_p0043] [location=complement(33671..34279)]
+GTGAAGGAGAGGGTGCCCTTCCCTTTCGGGATGATCCCTGAGCGCTGCTATTCCGGCGGTGGCGTACGGG
+CCGCGCAGGGCGACGGTTATGACTGCGACTCCTACGGCACTGTCCAGACGACGAAGGAAACCGGCACCGC
+CGGCACCCAGAACCCCTACCGCTTCGTCGGCGGCACCTACGACCGCACCACCGGCTACGTTAAGTTCGGC
+CAGCGCTGGTACGACCCCACCACCGGCCGCTTCACCACCCAGGACAAGTACAGCTTCCTTGCCAACCCCG
+GACGGGGCAACCGCTACGCCTATGCCGGCGGCGATCCAATCAACAACACCGACCCGCTCGGGCTCTTTTC
+GTTCGCTGATACGGTCGGGATCGTCGCTGGTGGCCTGGCAGGAGCTGCCGGGGTGGCTGTGGTGGCGGGT
+ACGTGCGCGCTGACAGCTGGAGCAGGATGCGTGGCGGGGGCTCTCATCACCGGTGCCATGTGGGGTGCAG
+GTGGAGGGGCGCTCGGATCTACTCTCGCTGGCGGAGACTCTGCCGAAAAAAGCAATGGGACACTTGGCGG
+TCTCGTCGGGGGAGCCACGGGCGGACTCGCGTCTCTGCTTTTCGGATAG
+>lcl|NZ_CM001166.1_gene_44 [locus_tag=STTU_p0044] [location=complement(34590..34754)]
+ATGCGAGACAAAGAGATCGCTCTGTACGTGGCGGGGGTTTGCCTTACTCTGGGGCTCGCCTTCTCTCTAT
+ATAGAGAAAATTACACCCTCGCAATCCTGGCGGCATTTGCGCTGATCGTCAACGGATTCGCAATCTCTCA
+GGAGAGGAGAAAGAAAGGCGACTAA
+>lcl|NZ_CM001166.1_gene_45 [locus_tag=STTU_p0045] [location=complement(34754..38242)]
+ATGTCTTCATCCAGCGTCCGCAGACGCTCGGTTCAGGTGGGGATCGCGACGGCTGTTGTGTCGGCCGTGG
+CGGTGTGGGGAATGCCGGCCGCGTACGCGGCGGCTCCTGACGCTCCGTCGCAGCTGGTGGCGCTGACGGA
+GAGCACGGCGCCGTACGTGACGGCGAAGGTGGTGGCGCCGTCGGGGAGCGGGAAGGTGACGGCGAAGTTC
+TACGCCGGCACATATGCGGCCAACGGTGACAACGACCTCGCGGACGGCAAGGAGGTGACGGTCGATTCGG
+GTGAGGTAGCACGGCTGAAGCTGCCCGACATGCGGATCGGGACGCAGTTCACCTGGCAGGTCAAGGCCTG
+CGTCGACGACGACTGCTCCGACCTCTCCCCCCTCCAGACCACCCGGGTCAGCCCGATGACGGGCGCGGGC
+GAGAGGCCCGGGGCCACGCGCCTGCAGTTCTCGACGGGCGACTCGACGGCCGCGCAGGTCGATGTCGGCT
+CGGGCAATCTTCTGGTCAACGCCTCCGGGCTGACCTTGCCGGGGGTCAGTGGTGACGTGGGCCTGGGGGC
+GGCGTACAACAGTGCGGCGATCGGCACGGATGCGACCTCGGCGAAGTCGCCACTGGGGTACGGGTGGCGG
+CTGACCCCCTACGAGGTCGAACTGAAGGAACGCGGGGACGGCTCGGTCACCTACTACGGCCAGGGCGGGA
+TCACCGGCCTGTTCGTGAAGTCGGGCAGCGGGTTCACGACGCCGGGCGGGTTCAAGGCCGACCTGAAGAA
+GAACAACGACGGCACCTACACCCTCACCGACCACGGCTCCCAGTCGAAGCAGACCTTCACCAGCGCGGGC
+AAGCTGACGAAGATCACCGACCGCAACGACAACGCCACCACGCTCTCGTGGAACGGCGACCTGCCCGACA
+CCATCGTCACCACCCGCGGCACCAAGACGCAGCGCACGGCCGTGTACGCCTCGGCGAACGGGCGGGTCAC
+GACGCTGACGCAGACCGCCTCGGACGGCAAGAAGCGCTCCGTCACCTACACCGTCGATGCTGCCGGAGAC
+CTGGTGTCGATCAAGGACACCCTGGGCCGCACCACCAGCTTCACCTACACCGGGCACAAGATGACCTCGG
+TGACCAATCCCGGGGGTGGGGTGACGCGTTTCGAGATCGGCGCGATCGGCGCCACGAAGATCACCCAGGA
+GAACAAGGCCGCCGGCTCGCCCGGAGACTCCGTCACCCGCCTGTCCTACGCGGACCCGGACAAGACGGTG
+ATGGCGTCCCCCAACACCGACCAGACGAAGACCGTGACCGCCGTTCCGCACACCACCTACGAGCTGACCG
+ACAACAACTCGGCGCGGGTGGCGAAGGCGACGGACGCGGAGGGCCGGGAGCGCTCGAAGACGTACACGGC
+GAACTTCGACACCGCCTCCTCGACGGACGGCTCGGGCGCGAGCGCGGGCACGACCACGAACACCTTCGGC
+GCCAACGACGGCGAATCGCTGACCAAGTCGCAGGGTGCGGACGGCTCGACGTTCTCCGCCGCGTACGGCA
+ACACGGCGGCGGGCTCGAAGTTCTCGCCCTCGGAATCGACGGACGGGCAGTCGAACAAGTCCGCCTACTC
+CTACAACGGCGCGGGGAACCTGGCCTCCTCGAGCAACGCGGAGGCGGCCGAGGCGAAGGTCGACTACAAC
+GACGACGGCACCGTCAAGACCAGCACCGACCCCGGCAACAGCACGGACACGTCGTACACGTACGACGGCG
+ACAAGCAGCTCACCAAGGTCGACCCGGCCGGCGGCTCGCTCAAGTCCCAGTCGTACACGTACGACGCCTG
+GGGCCGCCTGGCCGTTGCCACGGACGGCCGGGGCCTCACGACCACAACGACGTACGACGACGCCGACCGC
+GTGACGAAGGTCGACTACTCGGACAGCACCCCTGATGTCTCCTACACCTACGACGCTTTCGGCCGTACGA
+AGACCCGCACCGACGGGACGGGGACGGTCACCTATGGGTACGACGATCTCGGCGCGATGACGTCGCGGAC
+CGCGACGTCGGGCGGGGGCACGCTGGCGTACTCGTATGACAAGAACGGCAACCGCCTCAGCACCACTGAC
+GCGCGCGGCACCACGCAGTACAAGTACGACCAGGCCGACAAGCTCACCCAGGCGATCACCGATGCCCCGT
+CGACCAAGACGAAGATCGGGTTCAGCTACGACGATCGCGGCCGGCGCACGGACACGTACTACGGCACCAA
+CGACGCGAAGACGATCTTCAAGGCGCGCGTGCACCAGGACTACGACAAGTCCGGCCGCATCAGCCGCGTC
+TGGGCCGACCAGGGCCCGGCGACCGACACGACCCGCCAGTTCGACGCCACGTACTGCCGCAGCCTCGGCT
+CCACCTCGTCCTGCTCGACCGAGAAGGCCGACAACACCGACCTGATCCAGTGGAGTAAGGACAACCTGAG
+CGGCAAGACCACCAAGTACACGTACGACAAGGCCAACCGGCTGACGAAGGTCGCAACCGACGGGGGTGGC
+AAGACGTACACCTACACGTACGACGCCCGCGGCAACCGCAAGTCCTCGTCCGACGGCAGCGCGGATCAGT
+CCCTGGCTTTCGACGCCGCCAACCAGATCACCAGCGACGGCTACACGTACGACGCCCAGGGCAACCAGAC
+CAAGACCGCCAAGCTGTCCACGCTCACCTACGACGGCGCCAACCGCATGACCGGCGCCAAGACGGCCAAG
+GGCACCAGCAACTACACCTACGCCGGCGAGGACGCCACCGAGCTCGTCTCCCAGACCAGCGACGAGGGCG
+AGAAGACCGACTACGTCTACGGCGCCCCCGACCAGTACGGCATGCCCGTCATCGAACAGGTCACGCTGAA
+GGAGGGCACGGCGTACATCGACCACGACCCCACCACCGGCCAGCCCCTCTCGCTCCGGACAACGAACGAG
+TACGAGGCGTACTACATCGTCGACGGCATCGGAAACCCGGTCCAGTTCATCAACCAGTCCACGGTCCAGT
+CCACGATCTACGACTACGACCCCTACGGCACCGTCCAGACGACGAAGGAAACCGGCACCGCCGGCACCCA
+GAACCCCTACCGCTTCGTCGGCGGCACCTACGACAAAACCACCGGCTACGTAAAATTCGGCCAGCGCTGG
+TACGACCCCACCACCGGCCGCTTCACCACACAAGACAAACTCAGTTTCTTCGCGAATCCCGCACGCGGAA
+ACCGCTACGCGTACGCAGGAAGTGATCCTGCCAACGCGGCAGACCCAACCGGCCAGGATTACTACGACTG
+CGCCTTCGCGGGACTCGTGTTTGTCGGGGCAGCGGGAACGGCAGTTCTCAGCAGCGGAGGCACAGCCCTT
+TTCGGTGGCGCCGCTGCGGTAGGAGCCGGTGGTCAGTCGTACAGGGCTTGCCCCAAGGAAGCCAAAGAGG
+GTCCCGGGCGGAAGAACTCGCTGAAGGCAGCAATAACCCCGATATGGAAAATTCTGTAA
+>lcl|NZ_CM001166.1_gene_46 [locus_tag=STTU_p0046] [location=complement(38557..38748)]
+ATGGGTGGCGGGGCTGGTTCGGGGGTGTTGGTGGTGGCGGATGGCGGTGGCGAGCAGCAGTCCCACGACG
+CAGGCGGTGAGGCCCCAGAGGCCGAAAGCGAGGGCGAGGGTGTGAAGGCTGGGCATGGAGCGGGCTCCGT
+GATCTGTGCGCTCGACGACACCGAGTGCGGCGAAATTGTGTTTTCTGAGTGA
+>lcl|NZ_CM001166.1_gene_47 [locus_tag=STTU_p0047] [location=38936..40114]
+GTGTCGAAGCTCGCGGAGCCGTGCTCGGGGTTGTTCGCAGGGCGCCGGGGTACCACGGCGGCGGGCAGTA
+CGGTGATCGGACCAGAGAACGAGACGACGGGAGCGCCGGTCGGGTCCATGGTCGCTTTGGCGACGGTTCT
+CGAGCCGAGCTTGCCCGCAGTATGTCTCGTGACTCGGCGTCCCGCTGAGGGCACACGCCCGCCCGGGGGG
+CAGAGGTCGTGTGCGTCGGTGGTGACGGGTCGCAAGCGCATGCTGAGCATCTGGCGGATGCCATGCCGTC
+CCGTCATCACGCTCCGCGCAAGCCATGCGGCATGTGAGCCCGCATGCCTACATCTCCCCGGCGAGCGCCT
+CCCGTGCCTCTTCGGGGCCGGACCGGCTGCGCAGGGCGTCGCTGAGGCCGGTGACCTCGAGCAGGCGCAG
+TACTGCGCCACCAGCGCCGGCCAGGGCGACGGGGCGGCGTGCACGGGTTTGGAGGAGGAGATTGAGGGTC
+TGGGAGTCGGCGAAGGTGACCTCGCTCAGGTCGAAGACGACAGGTCCTCCGAAGCGGCTCAGGGCATCGT
+CCACTGCTTCCTCCACGTCCTCGGCGCTGTCCATGTCGATGTCCCCGCCCAGAGCGATGAGCCACACGCC
+CTGCCACAGCGTGCTGCGCAGGACCGGGTGACCCGCTCTCCTTCCAACATTTGTCATGCGGCAACTATCC
+AGGGCCCCTCTGACAATGCCGCCCCCGGGTGTCCCTCCGGGCAACGCACACGCTCAGGGGTATCCGTTCG
+CGGACAGAGGGTAGGCGCGAGCTATCCGAAAAGAGGAGCAAGGGTGCTTTCCCTGGAGTCCGCTGAACTC
+ACCGCCGTTGACGCGCGACTCCTGGCACAGACGTACGCGGCCGCCCACTGCCCGCGCGTGGACCGTGCCG
+CGGTGGCCCTGGTCGTGGCCGAGCTGCTCGCGAACGCCGAACGTCACACCGCTGGGAGCTGGCGGCTCGT
+GGTCAGCCACAGCACTCGCCTGCTGAGCATCGCCGTCCACGACCTGGGCCGTCTTCTCCCTCTACCTGGC
+AAAGTGGCGTTCGACGGCACCGGGCAATTCGGTCTGCGCATCATCCGCGGTCTCAGCGATCACTTCTCCG
+TCCACTCCGGCCCGACGGGAAAGACCGTCACCGCACAGTGGCACCTCGCCACCCTCTGA
+>lcl|NZ_CM001166.1_gene_48 [locus_tag=STTU_p0048] [location=complement(40801..41478)]
+TTGCGCCTGTCCCGCACCATCCCCGCCGCCCTCACCGCGCTCGCTCTCAGCACCGCGCTCGCCCCCACCG
+CGGCCGCCGCCGACCTTCCAGCCGCTCCCGGCGACACCGTGACCCTCCCGCTCCGCAAGGCCATCGCCGC
+CCTCGACACCCGGGCCGAGAAGCGCACCGGCTACGAGCGGACAAAGTTCAAGCACTGGATCGACGAAGAC
+CGCGACGGGTGCACCACGCGCAACGAGGTCCTGCTCGCAGAGGCCGTCACCGCGCCCGAGGAAGGCGCCC
+GGTGCAAGCTGAGCGGCGGCACATGGCACTCCGCCTACGACGACACCACCATCACCGGGCCCGGCGGTCT
+CGACATCGACCACTTCGTCCCCCTCGCCGAAGCCTGGGACAGCGGCGCCTCCGAGTGGAGCGCGAAGGAC
+CGCGAGCGGTACGCGAACGACCTTGGCGACGACCGCAGCTTGATCGCGGTCTCAGCGAAGACGAACCGCA
+GCAAGGCCGACCAGGACCCGGCCACCTGGATGCCACCGGCCGCCTCCTACCGCTGCACCTACGTCACGAC
+CTGGACCACTGTGAAGACCAGGTGGGGCCTGTCGGCCGATACCTCCGAGAAGGCGACCCTGGAGCGCGTG
+GCGGGGGACTGCCCGAACGTGCCGATCAAGGTCGAACTGGCCCGCTGA
+>lcl|NZ_CM001166.1_gene_49 [locus_tag=STTU_p0049] [location=42413..43333]
+GTGATCTCGGCTGGGGGTGGGTGTCGTGCGTGGCGGCGTGGGTGGGGTGAGGGTGGGGGGATGGAGTATC
+CGGTGCGGGTCGGGCTTGCCCGCGCGGCCGCCGCGCTCCCGGCCGGCGACGGGTGGTGGTACGAGCCGAA
+GTACGACGGCGACCGGTGCGTCCTGTGGCGGCTCGACACTGTCCGCCTCCAGTCCCGTACGAGCAGGGAC
+ATCACCGCCGCCTGGCCCGACCTCACCACCCCCGCCACGGACCTGCCGCGCGGAACCGTCCTCGACGGCG
+AAATCGTCATCTACCGCGACGGCATGCTCGACTTCGGCGCCGTACGGGCCCGGTCCTCCAGCCGCGGGCG
+GCGCCTGCAGGACCTCGTCACCCGCCACCCCGCCCACTACGCCGCCTTCGACGTCCTCATGCACCAGGGC
+CAGGACGTGCGGGCCCTGCCGTACGAGGCGCGACGCGCCCTGCTCCTGACCGTCCTCGAGCCGCTCGGGC
+CCCCGCTCCAGGCCACCCCCGCCACCGACGACCACGACGTCGCGACCGTGTGGATGACGAGCCTGCGCCC
+CCAGGGCATCGAGGGGATCGTCGCCAAACGCGGCACAAGCCCGTACCCGGTGGGCCGCCGCGAGTGGGTG
+AAGGTGCGTCACGCCGACACCGTCGACGGCGTCGTCACCGGCTACCAGGGCCTGCCCTCACGGCCCTCGC
+ACCTCTTCGTCCTCCTGGCCGACGGGCGGACCGTACGCTCGCAGCACCTCCCCGCCGCGCTCGCCGCCGA
+ACTCGGCCACCACCTGCCCGGGCACGACACCGGCACCACCCACGACCCCGACACCGGCCCCCTCCACCTC
+ACCGACGCCGCACTCGAGGTGGAGGTCCTCGCGGGCTCCACCCGGCACGCCACCGCCACCGTCACCCGCC
+TGCGCACCTGA
+>lcl|NZ_CM001166.1_gene_50 [locus_tag=STTU_p0050] [location=43687..43938]
+ATGGCGGCCTGCTCCTCGTCGGAAGCGGCCAGCACTGGGGGACCCGCCAATCCAGCCGCTTCGGCGAAGC
+CTGCCTCCGACAAGGGCTCCGGGAACGCGGACCCCGCGGGCGGAGGTCAGACTTCCACCACACCGGCCAG
+TGCGGACCCGTCGGACTGCGCTGCCGCCGACAAGCCGGAGTGCGTGGTCGACATCGGGTCCATCGAGATG
+GAAGAAGGCAAGCTCGCTGACGGGCCGCCCCAGACGCGCTGA
+>lcl|NZ_CM001166.1_gene_51 [locus_tag=STTU_p0051] [location=complement(44116..44634)]
+ATGCGTGCAAGCAAGCGAGCTCGGTGGAGCGTTCTGTCGGGTGCGGCGGCACTCGCTTTTTCTGTCCTGA
+CCGTGTCGCCGGCGGTGGCTGACGAGGCGCCGCCGGGGATGGTGGAAGTGACCCTCCCGGCCGACATCGA
+GATGGTCGAGGGCACGCCCGTAGCGCCGGGCGAGGAGCCTTCCACAGGGCTCTCGAAGGCGGCCGCGGTG
+GACCGTGTCTGTCTCGGATTGACGGTGACCATTGGTTCTCAGGGCTGCTTCCAGCCCTACGGTGACGTCG
+TCTTCTCCGGTGACACGCAGGCGGACGGCCGGTCCTCTGTCACCATCGTCTACACCGACTACGGTCGCGA
+GCCCTTCGGCTGTTACAACAGCACAGGGGCGAACACCTGGGTCAAGTGCAACAAGAATTACCGGGAGGAC
+GGCAACGTCTACCTCAAGGTCCTCCGCTACGACAAGCCCACGGGCAAGTACTACCAGCCTGAGGCGAAGT
+CCAGCTGGATCCCGGTCGACGGCCAGTGA
+>lcl|NZ_CM001166.1_gene_52 [locus_tag=STTU_p0052] [location=complement(44807..44941)]
+GTGCAGCGGCCCGGCACCCTGCTCCCCGCGACCCGCGGGTACTCGCCCGCCCCTCCCGAAGCGGCCCACT
+TGGTGTTGTCGGGTCAGGCGCGCAGGCGGCTGACGGTGAGGGTGGCGTGTGTGTGGGGGGCATGA
+>lcl|NZ_CM001166.1_gene_53 [locus_tag=STTU_p0053] [location=44999..45376]
+ATGGGCGAGGACGACGACAGCGGCGGGATGGAGCCGGGCGGGCCCGAGGATCCGGACTACCTGGTGGGCG
+AGCGCACCAGCCGCCCCACCGCGGCAGAGCGGCGGGAGGAGGCGGAGGGGCTGTCCCGGCCGCTCGGCGA
+CCCGGACGAGGCCGCGCACCGCTCCGCGCGCGGGCCCGCCCCCGGGCCGGTAGCGGGGAGAGAGGTGCGC
+GTTCCCGTCCAGCCCGGCCCGCAGGACCGCGAGCAGTTGCCCCGCCCCACCGAGCCCGCGCCCCAGGCCT
+CGCCCACGCCCGCATCGGGCTCGGCCGAGGAGGGCGGCGCCGGGACGTCACCGCGCCCGCACGGCCCGCA
+GGAGCCGTCGGCGCAGGCCGGAGGGTGA
+>lcl|NZ_CM001166.1_gene_54 [locus_tag=STTU_p0054] [location=45472..45900]
+ATGAGGACCACCCGGCAACAGCGGCGCCGCTCGCGCGCGCTCTTCCGCAGCGCCCGCTCGGCGGTGAAAG
+GACTGCGCCTGCCCGAGGGGGCCGGCCTCGAGGAGGCGGCCGTGCGCGTCGCCCTGCACATCGGCAGGCC
+CCTGGCTCTCCTGCCCGCTGAGGAGCTGCCCCTCAACGGCGCCCTGACTCGCGCCATGGACGGCACCCTC
+GCCGTCCGCGTCCCCGTCCGCGGCGCGTTTCGGGAGCAGCCGGATACCTATCTCGTGCACCTGGCCTGCC
+GGGGCCTGGCCCGCGCCCTCCTCGGCGTTCCCGGGGATCCCCGTGCGGGCATCGACTACCGCACCGAGCC
+GGAGCGGCTCGTCGAGCTGACCGCCACCGAACTCGGCGTGCGCCTGCGGCCCGCCACCGCCGACGCACAC
+GGCCTCTGA
+>lcl|NZ_CM001166.1_gene_55 [locus_tag=STTU_p0055] [location=46355..46636]
+ATGCGGTCGCTGCGCGCGCTGGGCGGCATGGCGCCGCTGCCGGCCCGCGGCCTCGTGCTCGGTGCGCGCG
+CAGCCGCTCCTCGAGGACGCGCTGGCGCTCGGCGGTGGGGAGGTCGGCTGCTCCTGGTCGAGCTCGGCAC
+CGAGGCGGGAGCGGTGCGCGCGGCGGACGTGGATCACGTTGCCGCAGCTCTCGCAGGGCTGGTTGGTGTC
+CAGGCTGATCCCGTCGTCGCACCGCAGGTCCGAGCAGGCCGGGCGAGGCTGCGGTGCAGCAACCACGGGT
+AG
+>lcl|NZ_CM001166.1_gene_56 [locus_tag=STTU_p0056] [location=46864..48033]
+ATGGACACCGTGCACACGACCGCTGCCCTCCTCCCGGACCCCGCCGAACTCCGCGCGCACCTGCGCGCGC
+TGGCAGTGCTGGACCAGGCGATCTGCCGCGACCCGCGGTTCCCCCGCTATTCCTTCTCCACCACCTGGGG
+GCCTGGGACGGAGGCGGCCTTGATGGACAACGGCTCGGGTGACGACTTCTCCGTCCTCTTCACCCCGGTC
+GGTGTGCTCGTCCGCGGCTTCGACCACGAGTCGGAGATGAGCCCGTACGCCACGGACGACGAACAGGTCT
+GGCCCGGTGTCATCGACGAGGTGCCCGCCGCGCTGCGCCCGCTCCTGGACGACCCGACCTTCGTCGACGA
+GGGCCTCGGCGCCCCGCGGGTCACCGCCTGCCTGTGGTGGGAGACCGGCGCCAACGCCTGGCGCACCGGC
+TCGGGCATCGAGTTCCCCTCGGGCAACCCGGACCCGGACGGCTCCGGACACCTCTTCCACCTCCTCACCG
+ACCGCTCCCCCGAGGCCGCCCAGTCCCACTTCGAGGAGGCCTACGGGCGGCCCGTCCCCCTCGACACCGT
+CCGCCACGTCCTCGCGGGCCATCCCCTGGCCCCCGAAGCCGCCCGCGGCCTCAACCCGGCCGCCCTCTCC
+GACGAGGCACTGCTCGGCCGGATCGCCGCCAACCCCGAGGTCGGGGCCTACCTCGCCCGCGACGGCGAGT
+TCGACCTCACGCGGACCGACCCCATCGAGCCGATCACCCTGCCCGGCGGTCTCCCGGTGGAGCCCGTGGC
+CGGCTGCAGCGCGGGAGGCACCCACTACCTCTGCGGCCCGGCTGGCTCCGACCGCGTCCGCCCCGTCCTC
+TACACCGACTCCGAGGGCCAGGCTTCCCTCATCGCGGAATCCCTCGCCGAGGCCCTGACCCTGGCCATCG
+CCCTTCCCTCCTGGCACGACGCCCTGGCCGGCGTTCGTCCCCCCGCGCTCAACACCGACTACCTTGAGGA
+CAACCCGGACCACCCCGAGGTCCGCGACCGCCTCCTCGCCGCCCTCCGCCTACCCCCGGCCACCGAGCCC
+GAGGTCCTGACCCGCCTCCTCACCACGGCCGCCCGCACCGTCCCGGACGGCTACCTCCCTTCGGTCGAAG
+GCGACGAAGACACCACCTTCGAACCGATGCTCCGTCTACCGACCGAGTAG
+>lcl|NZ_CM001166.1_gene_57 [locus_tag=STTU_p0059] [location=complement(48354..48935)]
+GTGGGGTCCGCTCCGCTCGCGCGGAGGTCACCCGCCGAGCTGACCGGGCCAGTCGGCTGCTGCGCCGTGG
+CCTACTCCGTTGAGCGACAGACGAATGCGCCGCATCGGCGGGTCGGCCACGGCGATCCGCGCGGTCATCG
+CATCACCCACACGAATTTCCCTGGCAGGCTCTGCTGCGAGCAGTTCGGAGCTGTGAATCAGCCCTGCAAT
+CCCATTACCAAGATCCACGAAGGCGCCGAACGGCACGACCTTGGTGACCCGACCACTGACAATGCTGCCC
+ACGCGCTCAGCCCAGACCAGCCATGGATTTTCCTGCAGGGCGGCCAAGGACAGCACAGCCTGCCCATGCA
+ACTCGGTGTCCAGGGCCAGAACCTCAGCACTCACACGCTGCCCCAGCGATACCACTTCATGGGCAGAGGA
+GATCCATTGCCACGAAACCTCGGGCGGAGGAATGAACCCGACCGAAGTCTCCGGCGCTCCGTCGAGATCG
+ACGAACACGCCAAAGGTCTCGACCCGGCTTACCATCCCAGCCACTACATCGCCTGGGCGGAGCAACTGGA
+GGAAGTCTTTCAAGACCTTTGA
+>lcl|NZ_CM001166.1_gene_58 [locus_tag=STTU_p0057] [location=49010..49252]
+GTGTTGGTGCTCGTCTACCGGTACATCGAGCAGGTGAATCGCAACCGGAGCGTCCGGATGGTCGTGTACC
+TCGTGGATCTTGGCGAGGGGGCCCTCCCGGTGAACGCGGCGAAAAACCTCCTGCTGGAGGAGGCGAGCGG
+TGGCGAGGAGGCGGCGAAGGCGGCATGGCAGGACGCGGGCCTGCCCGAAGCGGGCGTGGTGACGTACGCG
+GAGTTGGACCGGGCGCGCGGCAGACTCCGCTGA
+>lcl|NZ_CM001166.1_gene_59 [locus_tag=STTU_p0058] [location=49311..50483]
+GTGGCTATCACCTCTCACCCCCCTCTGGTTCTCCGTCTGGTCGTGACGGGGGGAGGCACGGGCGGGCATA
+CCTACCCGGCCCTGACCGCTGTGCGTACGTTGCGGGAGCTGTTGAGGGCGCGGGGGCGTTCTCTCGATGT
+GCTGTGGATCGGCAGCGCCGACAGTTTGGAGGCGCGTGTTGCCGAGGCAGAGGGGATCGCGTTCACGGCG
+GTGGCCACGGGGAAGGTGAGGCGCTCGTCGAATCCGTTGAGGATGGTCTCGCCTGCGAATGTGCGGGACA
+TGGCGCGCGTTCCGCTCGGTGTGGCGCAGGCGCGCAAGGCGGTCGCGGGTTTCCGGCCACATGTGGTGCT
+CGCGACGGGCGGGTACGTGGCTGTGCCGACGGGGCTCGCTGCCCGGATGTGCAGGGTTCCGCTTGTGCTG
+CATGAGCAGACGGTGCGGCTGGGGCTGGCCAACCGGAGGCTCGCGGGGAGCGCCTCTCGGATCGCGGTCT
+CCTCGGAGTCGACGCTGCCGCTTCTGCCGGAGAGTGTGCGCTCTCTCGCGGTGGTCACGGGAAATCCGGT
+GCGTCCAGAGGTGCTGACCGGGCATCCGGGCAAGGCCGTGGCGGCCCTGGGGCTGGGCTTCGATCTGGCC
+CTGCCCACGGTCTACGTCACGGGCGGGGCGCAGGGCTCGCAGCAGATCAACGAGGTCGTCGGCGGGGAGC
+TGCCGTGGCTCTTGGAGCGGGCCAACGTGGTGCACCAGTGTGGTCCTGCGCATTACGAGTCGCTGGCCGC
+GCGTGCGGCGACGCTTCCTGCTCACCTGGCGGTCCGCTACCACGTGACGCCCTTTGTCGGCGCGGAGCTG
+CCCGATGTGCTGGCCTTGGCCTCCGTGGTGATCTCGCGCAGTGGCGCGGGGACGCTCGCCGAGCTGACTG
+CCCTGGGCAAGCCGGCGGTCTTCATTCCACTCGCGTCGGCGGCCGGGAATGAGCAGGCCCACAATGCCCG
+GCACCTGGAGGAGTCCGGCGCGGCCGTCGCGCTCGTGGGAGAGGTCGGCGGGGAACGGCTCCGCGCGGCG
+GTGGCCCCCCTGCTGGAAGATCCTTTGCGCAGGGAGGCCATGGCTGTGGCGGCACGGGCTCAGGGTCGCC
+CGGATGCGGCGGACAGGCTGGTGGACGTGCTGCTGACCGCCGCATCGGAATGA
+>lcl|NZ_CM001166.1_gene_60 [locus_tag=STTU_p0060] [location=complement(50498..51475)]
+GTGACCTCCGGGACCGCCGCGCTCCACACGGCGCTCGTCGCGGCCGGCGTCCAGCCCGGCGCCGAGGTGA
+TCGTGCCGTCCATGACGTTCTGCGCCACCGTGCAGACCATCCTCGCCGTCGGCGCGACCCCACGGTTCAT
+CGACATCGACGCCACCACCCTGTGCGTCACCCCGGACCTGATCAAAGAAGCGATCACCGACGCCACAACC
+GCTGTGATGCCGGTGCTCTTCGGCGGCCGGGCCATCGACCTCACCCCGATCCGCGAGGACCTCGCCCACC
+GCGGCATCACGGTCATCGAGGACGCCGCGCACGCCTTCGGCTCCCGCAACCCCGACGGCACCGGATTCGT
+CGGCAGCGACAACTCAGTGCTGACCTGCTTCTCCTTCGGCGCCATCAAGAACCTGACCTGCGGCCAGGGC
+GGCGCCGTCATTCCCCGCACCCCCGACGAAGCGCACACCCTCCGCCGCCTGAGACTGCTGGGAATCGAAC
+AGTCCCAGAGCGAACGCGCCGAGACCACCACCTACCAGGTAGGCGGCTTCGGACTGCGCTACCCGCTCTC
+GGCGCTCAACGCCGCGATCGGCCTCGCCCAGCTCGACCACTTCGACGAGACCGCCGTCACCCGGCGCCGC
+CTCTGGCGCGCCTACCGCACCGCCCTCTCCGGCCTTCGCGACGTGCCCCTCATCGACGTCGGCGCCGACC
+GCGCCGTCCCGCACCTGTGCCAGATCCGCGTACCGCGACGGGACGAAGTCTTCGCACACCTGCGCAAGGC
+GCACATCGGCGTCGGCGTGCACTACCCGCCCAACCATCTCCAGCCCGCCTTCGCACCCTGGAGCCGGTCG
+CTGCCCGCAACCGAACAGGCCGGCGAGGAGATCCTGAGCCTGCCCTTCCACCAGCACCTCACCGAGGCCG
+ACATCGCCCTCGTCGTGCACGCCCTACGCGCCGCGCTCGAAGCGACAACCATCACTCCCCAGGCCTAG
+>lcl|NZ_CM001166.1_gene_61 [locus_tag=STTU_p0061] [location=complement(51646..52758)]
+ATGCTGAGCGAGGCTCCCGCTCTCCCCTTCGCCGACGCCACGATGATCATCTCGACGCGGGACGCCGACG
+CCATCGCCGACGCGCTAGGCGACGTCCGTCCCGCCGGGATCGTGGGAGGCGCGAGCGACGCCGCCCTGGC
+CACCTGGCACACCCTGAGCCAGCGCTACTGCGCCCCCTACGTGTACCCGGAGGGCGCGCTCGCCGCCGGT
+GACAAGGGAGCCTTCCACGCGATCACCGCGTCCTGCGGGGTGAGCGGATACGGGTGGATCGCGTCGGAGG
+ACGAGGAAGAAGTCGTCGCGAAGGCAGCAGGGTTGCGCTTCCCGCTCATGATCAAGCCCACGGACGGGTC
+GGGCAGCAAGGGCGTGACCCAGATCGACGCGCCAGAGGAGCTTTCCGGTGCTGTCGCGTACGCCCGCTCG
+TACTCCGCCTCCCGCACCGTGATCGCCGAGGAGTTCGTCCCGGGACGCCCCGTGACCGTCGATGTGTTCA
+TGCGCGACGGCAGGGCCGTGATGACCTCCATCAAGGATGAGGACTTCATCGACGGGGGCTTCGTCCTCCG
+GCGAATGCGCACCGCGCAGCTCGCGCCACCCGCCCAACGCCACCTCGAAGCCACCGCCGAGCGACTGTGC
+CGTGCGCTCGGCATCGACAACGGGCCGGCGAACTTCGACATGGTCCTCGGCCCGGACGGCCAAGAGCACG
+TCATCGAGGCCAACGCACGCCTCGGAGGAGACGGCATCCCGCGACTGCTCGCTGCCGCGTACGGCATCGA
+CGTCGTACGGGCGCTCATCTCCCTCGCCCTCGGACAAGCCTTCCACGACCACCTGACACCCACGCGCGCC
+GCGCACGCGGCCCTGGAGCTGATCGGCTCGCCGCACGCCACGGAAGGCGAACTGATCACGTGGGAAGGCA
+TCGCCGAAGCCCGCGGTGTCCCCGGCATCACCGATATCGAGATATACGCCAAGCCGGGCGATCTCGTACG
+CCCCCACGACCAGTCCGGCCACAAGATCGGCATGATCGTCGCCGCAGGCGCCACGGAAGCCCAAGCGCTC
+GCGGCCCTGGAAAGCGCGAGCACCCTGCTCAGGCCGATCATCCGCCCCAAGGAGGGATCGTGA
+>lcl|NZ_CM001166.1_gene_62 [locus_tag=STTU_p0062] [location=complement(52862..53890)]
+ATGGAACATGTGCTCGTCACAGGCGGCGCCGGCTTCATCGGCTCGCACTTCGTGAAGAGGCTCATCACGG
+CTGAAGACGTGGCCCGCGTCACCGTGCTCGACGCCCTCACCTATGCCGGTCATGTCGAGAACCTCGGCAC
+GGCCTTCTTCTCCGACAAGCTGCGCTTCGTCCACGGCAATGTGCAGGACGCCGACCTCGTGAACGACGTC
+ATGGCGTCCGGCCCCACCGCCGTCGTGCACTTCGCCGCGGAATCCCACGTCGGCCGCTCCTACGGAGCGG
+CGAGAGAGTTCCTGTCCACGAACGCCCTCGGGACGCAAGTGCTCGTAGACGCCGCTCACCGCCACACCAT
+CGGCAAGTTCGTCCACGTCTCGACCGACGAGGTCTACGGCCCGCTCGTCCAGGGGAGCGCCACCGAGCAG
+GCGGCGCTCCGCCCCTCCGTCCCCTACGCCGTCTCCAAGGCTGCCGGTGACCTGGTAGCGCTCGGCGCCT
+ACCAGACCCTCGGACTCCCTGTGTGTGTGACGCGCAGCAGCAACAACTACGGGCCGTACCAGTACCCCGA
+GAAGATCATTCCCCTGTTCCTCACCCGGCTCCTGCGGGGGATGCCGGTGACCTTGCACGACCGGGGCCAG
+CATGTGCGCAACTGGCTGCACGTCGAGGACAACTGCGCCGGGATCGAGGCCGTCCTGCGCGACGGTAAGC
+CCGGCGAGGTCTACAACCTCGGTGGCGGAGCCGACCTGTCGAGCAAGGACCTGACCGGATACCTGCTCGC
+CGTGTGCGGCGCGACGTGGGACGCCGTCACCTACATCCCCGACCGCCCGGCCAACGACATCCGCTACTCG
+ATCGACTGGGCCAAGGCCCGCGACCAGCTCGGCTACCGGCCCAAGCGCCGCCTAGAGGACGGGCTCGCCG
+AGACTGCGGAGTGGTACCGCCGAAACCCCGACCGGTGGGCGCCCATCGCACGCGGCAAGATCCCCGCCGT
+CCCCCTCGCCCGCACCATCCCTTCCGGAAAGGGAAGCCCGCATGCCTGA
+>lcl|NZ_CM001166.1_gene_63 [locus_tag=STTU_p0063] [location=54154..55476]
+ATGAGTCACGACGCGCTCGCGCTGCGCGTCAACGAACTCACCTGGCATGCCGGAATTCGCACGCAGTACA
+CCAATACGAGTGTTTCCAACTGGGTGAAACGCGGCATGCTCCCCCGCCCTCCGACACCCGACTGCATCGC
+CGCTGCGCTGGGCGAACACCTGGGCCGACCGGTCCACGTCACCGACATCGGCATGAGCGAACCGCGCGGC
+ACGATTCCCGACATAGGGTTGGATTTCCCGCGTGAGACCGCCGACGCCGTACACGGCGTCCTCGCCTTCT
+GGAGACACGTGGACCGCAGAGCATTCCTGAACCGCAGTTTCGCCATCGGCGCCTTCGCCGTCCCGGTCAC
+CCGGTGGCTCGCCGTCCCCGCCGACGCCGCGAGCAGTCACCACGATGCTGGAGGCCAGCGCGTGGGGCGC
+GAGGATATCGCCCACTTGTGGACCGCCGTCGAGGAGGCCCGCGTGGCGGACTCCCAGTTCGGCGGAGGGA
+ACTGGAAGGCGTCCTCCACAGCCGCATGCCTGCGCGAGTACGCCACCCCCCTGCTGAAGGGCACCTACAC
+CGAGGAGACCGGCAAAGCCCTCTTCGGGGTCACCGCCGAACTGACCCGGCAGATCGGCTGGTCCGCCTTC
+GACGCCGGGCACCAGGGCGCCGCCCAGCGGCACTTCATCCAGGCCCTGCGCCTGGCGCGCGCCGCCGCGG
+ACGTCCAGGCCGGCGCCTACATCCTCACGACCATGTCCCTGGCCGCCTTCCTGCGCGGCCACCCGACCGA
+AGCCGTCGACATGGCCGAGGGAGCCTACGAGCGCGCGAAAAACCTCCCGAACGCCGAGAAGGTCCTCTCG
+TTCGCGAAACTCGCACAGGCTCGAGCGCACGCCCGCGCCGGGCAAACACGCGAGGCGACCACCGCACTCG
+CCCTGTCAGAAAACCTCCTCGACCGGACTCGCACGGAGACGGCTCCGGCGTGGATGGCCTACTACACCCG
+CGAGCGCCTGGCCACCGACGCCACCGAGATCTACCGCGACCTGGGCCGCACACACGACGCGCTCACCTGG
+AGCCAGCAGGCCGACACCATGCCAGCCCAGCGCTACACCCGCGCGGTCGGCATCCGGCTCGCGGTGGAAG
+CATCCGCGCACCTGCACAACAACGACCTGGAACAGGGCCTGGCCGTGGCCGACCACTCAGTGCAGCTCCT
+GTCAAAAGTCCGTTCCGCTCGCGCCCACGGGTACGTCCACAGCCTCACGACCATGCTGGCGACCCGACAG
+CGCGACAAGCGCGTCACCGCCTTCATCGAACACGCTCGCCGGAACCTGCCTGCCCCAAGCTAG
+>lcl|NZ_CM001166.1_gene_64 [locus_tag=STTU_p0064] [location=55634..55990]
+GTGAAGCTGGACGACCGGCCCGGAGCATCCCCGCGCGTGGGCTCGACTTCTTGGGTGACTCTACGCGTCA
+GCCCATCTGCGGAGCATCCCCGCGCGCGCGGGCTCGACGGTGCGTGGAGTTTCGATCTCACCCCGAACGC
+CGGAGCATCCCCGCGCGCGCGGGCTCGACCCGCCGCTTCACCGGGCGGACGAGTCCCTCTCGGGAGCATC
+CCCGCGCGCGCGGGCTCGACCCGGAGCGTCCACGCCGTGTTCGTCGTGGTGGTGGAGCATCCCCGCGCGC
+GCGGGCTCGACACGGGCCAGATCGCCGCCCGCGTCGTCGCTCACGGAGCATCCCCGCGCGCGCGGGCTCG
+ACCATAA
+>lcl|NZ_CM001166.1_gene_65 [locus_tag=STTU_p0065] [location=55994..56386]
+GTGTTAAGCACTACGGCGGCTAGACGGAGCATCCCCGCGCGCGCGGGCTCGACCATCACCGTGACCAACG
+TCGCCACCGGCGAATCCGGAGCATCCCCGCGCGCGCGGGCTCGACACTTGTTGACCTGCAGTTCTACTGG
+CAGAAGTGGCCTTTTTTATTCAGTTGTTTTTGGGACGGGCGGAGAGAACAAGGCCGTCGAAGTCGACCGG
+TTGCCAGCGGTTGCGGCCTGCGGTGCGGACTGCCCAACCCTGTTCGTTGCGGGCTGGTTCGACCAGGATT
+GCTTGGCCGTCGCCGATGCGGGCGGCGAGGAGTTCCCAGAGGCGGTCTCGGATGCGGCGGCTGGGATTGC
+CGACGAAGACGCCTGCGCTGGCTTCGATCATCCAGCGGGTTAG
+>lcl|NZ_CM001166.1_gene_66 [locus_tag=STTU_p0068] [location=complement(56431..57438)]
+GTGGCCGACATCTGGTGGAAAGCCGACCCCCACGACCTGCACCGTCTCACCGACCGCGTCTCCAGCGTCT
+ACGTCGAACGCAGTCATCTCGACCGCGACGAGAACGCCGTCGTCATCATCAATAAGCGACAAACCGTCCG
+TGTCCCCGCCGCCATGGTGGCCGTCATGCTCCTCGGCCCCGGCACCCGCACCACCCACGCGGCCATCCGG
+CTGCTCGCCGACTCCGGCACCACGGTCTGCTGGGTCGGTGAACAAGGTGTCCGTATGTACGCTGCCGGCC
+TCGGCCCCAGCCGGGGCGCCGGCCTCCTGCACCGCCAGGCATGGCTCGTCACCCGGCCCAAAGAGCGCCT
+GGCCGTAGCGCGAGCCATGTACAGCATGCGCTTCCCCGGCGAAGATGTATCGGCCCTGACCATGCAACAA
+CTCCGCGGGCGCGAAGGCACACGCGTCCGCAAGCAGTACCACCACCACGCGGAACGCACCGGAGTGCCCT
+GGAACGGTCGCGTCTACGTCGCCGGCGACGCCCACGCCGCCGGCGATGACCTCAACCGGCTCCTGTCCGC
+CGCCAACGCAGCCCTCTACGGCATCTGTCACGCCGTCATCACCGGCCTCGGCGCCAGCCCAGGACTCGGC
+TTCGTCCACACCGGCAAAGCCACCTCCTTCGTCCTGGACATCGCCGACCTCTACAAAGCCGAATACACCA
+TCCCCCTCGCCTTCGACCTCACCGCCCAAGGACTCACCGAAGAACGCGACGCACGACTCGGCCTCCGCGA
+CCTCATTACCCGTGACAAACTCCTCACGCGCATCGTCACCGACGTGAAAAACCTCCTCACGCCCGAAGGA
+GCCGAGTTCGAGGACTCCGAAGCCAACCTCCTGTGGGACGAACAGGTCGGCGCAGTTTCCGGGGGAACCA
+ACTACGCCGACTCAGCAGATTTGTCCGTCTACGGAATAGGAGACAACCACATCGCGGTCATCGGTCCCGA
+TCTCGACGAAACCGGCCCCACCTCATGA
+>lcl|NZ_CM001166.1_gene_67 [locus_tag=STTU_p0066] [location=complement(57444..58196)]
+ATGCCCTACCTCTCCCGCATCCGCATCAACCCTCTGCGCACCGCGAGCCGCACCCTCCTCGCCAGCCCCC
+GCGCCCTGCACGCCCAGGTCCAAGGCGGCGTCCCGACCCTCCCGAACGAGTCCCGCACCCTGTGGCGCCT
+GGACGCGGACAACCCCCACCGCCCCGAGCTGTTCGTTCTCACCGCCGGAAAACCCGACTGGACCCACCTC
+GTCGAACAGGCCGGGTGGCCCGGCGCGGACGGCGAGCACTACGCGGTACGGGACTACGCGCCCCTGCTCG
+GACAGCTGGCGCAGGGCCGGGAGTTCGCCTTCCGCCTGACCGCCAACCCCGTCCAGAACACCAACCGCCC
+CGACAAGCCCACCGAGCGCCAGCAAGAACGCCTCGACGGCGGCACACGACGCAGCTTCCGCCTCGGCCAC
+CGCACCGCCGCCTCGCAGCTCGGCTGGTTCCTGACCCGCACAGCCCGCTGGGGCTTCGACGTCCCCGCCG
+CCTCCCACCTGGACGGCACCCGCGACGACCAAGACGAACCACCACGCGACGTGCGTATCAGCACCCGCCG
+ACGCCACTCCTTCGGCAAGCCGACCCGCGCCTCCAAGGAAGACCGGGTAATCATGCACATGGTGACCTTC
+GAGGGAAAACTCCGCGTCACCGACCCCAGCCTCCTCACCCAGCGGCTGCTGGCCGGGATCGGCCCTTCCA
+AGGCGTACGGCTGCGGGCTCCTCACCCTCGCCCCTGTGCCCGCGAAGGCGTGA
+>lcl|NZ_CM001166.1_gene_68 [locus_tag=STTU_p0067] [location=complement(58203..58775)]
+TTGCGGGACTACCACACCGTCAGCGACTACCGCGGCCGCCCGCTCCTGGCCGCCGCGGTGAACGCCAAGG
+GCACCCAGAGACTCACCGGCCCCGCCAAGTACACCCACATCACCCAGCGCTTCTACCTCCAGGACGCTGT
+CTTCCTCGCCGCGATCGAGGGCCCGGCGCACTTCATCACCACCCTCGAAAACGCGGTACGCCACCCGGCC
+TTCCCGCTCGCTCTCGGCCGCCGCTCGTGCGTCCCCGCGCAGCCGCTCGTCCTGGGGCAGCGCACCGGAC
+CGCTGGAGGAGGTACTGCGCGCGGAACCCTGGCACGTCACCGATGCCGTCCGGAAGCGGTGGGGACGCCG
+CAACGGCAACGCCGCCCACGTCGACCTGCCCCTCACCCTCGACGACCCGGCCGGCGACGACACGCGCGAG
+GACCTGCCCCTGTCCTTCGCGCCTACCAGCAGGGCCTACACCAGCCGCCGCGTCCGGCACACCTACGCCG
+CCGCCCCCACCGGCCTCACACCCCACCCCGACCAGCCGCCATCCACCGGCGGCCACGACCCCTTCGCCCT
+CCTGGGCTGGTGA
+>lcl|NZ_CM001166.1_gene_69 [locus_tag=STTU_p0069] [location=complement(58997..60151)]
+ATGCCACAGCGCCTTTTCATCGACGTGCACATCGTCCAGACGGTCCCGCCCGCCAACGTGAACCGTGACG
+ACCAGGGGAACCCGAAAGAGGCCGTCTACGGTGGCGCACGGCGCTCGCGCGTCTCCTCCCAGGCGTGGAA
+GCGGGCGACGCGCAAGCACTTCGACACCACGGTGCCCGAGCCGGACCGCGCGACCCGCACCAGGCGCCTG
+ACCAGCGAACTCGCCAAGCGGATCGTGCGTGACACGAAGCTGGAGCGTGACAAGGCCGACCGGCTCGCCG
+GCGCGTTGTTGACCCGGCTCAACCTGAGCCAGGGGAAGAAGGCCAGCGACACCGCCTACCTGCTTTTCTA
+CGGCAACGCCCAGCTCGACACGGTCGCCGCTCTCGTCAGCGGGCAGGCCCACGACCTGGCCGCGCTGGAT
+GACGAGAAACTCGCCGCAGAGCTCAAGGACTTGCCCGTCGCCGACGCCTTCAGCACCGGACACCCGGTCG
+GTGTGGCGCTGTTCGGCCGCATGGTCGCCGACATCCCCAAGCTCAATGTCGACGCCGCCGTGCAGGTGGC
+GCACGCGCTGTCGACGCACGAGACACAGCTGGAGTTCGACTACTTCACCGCCGTCGACGACAAGACCGAG
+AAGGAGGAGACCGGCGCCGGGATGATCGGCACCATCGCCTTCAACTCCGCGACGCTGTACCGGTATGCCA
+CGGTGGGTTTCGCCCAGCTCGCCGACAATTTGGGCGGTGACACCGAAGCGGCCCTCGATGCCCTGGACCG
+CTTCGTCGACAGCTTCGCCCGCTCCGTGCCCACCGGCTACCAGAACTCCTTCGCCCACCGCACCCGGCCC
+AGCCTCGTCGCCGTCGTGGTCCGCGAGGACCAGCCCGTCAACCTCGTCACCGCCTTCGAGGAACCCGTCG
+TGTCGGAAGCCGGCATCCAAGCCGCGTCGGTACGCAGCCTGGCCCACGAGTACGCGGCGGCCCGCAGCGC
+GTGGGGCGACGTCCCAGTGCACGCGGCGGCGACCCACACCTTCGCCTCCGGCAAGCCGGGCGCGACGGAG
+ACCGTGGAGGCGCTCACCGAAGCCTTCGGCACCTCGGTCCCCTTCGACGAGCTGCGCTCGGGCCTGCGCG
+CGTGCGTCAGCGCCGTCCTGGAGGCCCAGGGATGA
+>lcl|NZ_CM001166.1_gene_70 [locus_tag=STTU_p0070] [location=complement(60270..60863)]
+ATGACCGAACAGCGCTCTGCCGCGCAGAGGATCTGGCACCGCCACATCGCCGCGGACGGCACCTGGCGCA
+CCACGAAAGGCACCGCGGCCGCGAAGCGGCCGCCGGGCGAGGACCTCGCCGTGCTGCGCCGGGGCCTGAC
+CCGTCCCGCCGGCACCGTGCTGGAGATGTTCCCCTTCTACACCTGCCCCATCGACGACTTCGCCGCCCGC
+AAGGGGCAGATGTCCGCCGAGCAGGAAGCCGAGCACATCGCGCTCGCCCTGTACGGCCTGCACCAGCAAA
+GCCAGGACCGTCCCATGCACCAGCCCGGCGTCGGGCTGGGCCGGGCGATGCTCGTGTTGCGCGGCCACGA
+CAAGACCAGTGCGGACGCGGTCGACCGGCGTTTCCAGCAGACCTTCTCCACCACGTCCCTGACGGCGCTG
+CAGAGCCGGCTGCGCGGGCTGGTCACCCAGCTCAAAGACATCAAGTGCCCGCTCGACTACGACCGCCTGA
+TCCTCGACGTCCAGGACTGGAGTCGCCCCGCAACGCGCTCACGAGTGCGGCGGCGCTGGGGCCTGGACTA
+CTACGGCTGGACCCAGCGCTCCAAGGAATCGTGA
+>lcl|NZ_CM001166.1_gene_71 [locus_tag=STTU_p0071] [location=complement(60959..62689)]
+ATGGGGTTTGGGTTTTCCCTGCTCGAGGAGCGGTGGCTGCGTGTGCCGCCGGCGGTCGGCGGTCTGGCGC
+GGGAGCGTTCGCTGAGTACGGTGCTGCTGGACGCGCACGAGTTCGGGGACCTGGCGGTGGAGAGTGCCAC
+CCAGCGGCCGGCGGTACTGCGGCAGCTGCTTCTTCCGGTGGTCGTCGATGCGCTGGGCCGTCCCGCTGAC
+GAGCGGGAATGGACGCAATGGTTCGCCGCCGGGCGCTGGACGCCCGAGCAGCGCGCGCGGCTCACCGCGT
+ATCTGGACGCGTACCGTGAGGCGTTCGGTCTCTTCGATCCGGTGCGGCCATTTGCGCAGGTGGCCGGGCT
+GCACACCCCGAGGGGGGAGACGAAGAATGCCGCCCTGATCGTGCCGCACGCGGCGACCGGGAACAACGTC
+CCGCTGTTCGCCTCGCGTACGGAAGGGGACGTGTTCGCTCTGACGCCGGCGCAGGCCGTGCTCTGGCTGC
+TGCACACCCACTGCTGGGATACGGCGGCGATCAAGACCGGGGCGGTCGGCGACCCGCAGGCGAAGGCGGG
+CAAGACCACAGGGAACCCGACGGGCCCGCTTGGCCAGATGGGCGTCACGCTCCTGGCGGGCAGGACCCTG
+TTCGAGACGCTGCTGCTGAACCTCCCCGTGGGCGCCGCTCCCGTGTCGGCGGATCTGCCGCAATGGCGGC
+GACGGGATGCCGAGCATCCGCTGTCGGCCGGGACGCCGCGCTGGCAGGAGCGTCTCCCGCAGGGGCTGCT
+GGATTTGTGGACCTGGCAGTCCCGCCGGGCCCTGCTCGTTCCCGAGGCCACCGAGGAGGGCGTGCGTGTG
+ACGCGAGTCCTGGTCGCGGCCGGGGACCGGATGCCGTACACGCCGGAGATCGAGCCGCACACCATGTGGC
+GCACGGAACCCACGGGTGGCCGCAAGCCCGCCAAGAACAAGGGACGCATTGTGCCGCCGCGCCGGCCGTT
+GCGTCTTCAGCCGGGGAAGGCCGTGTGGCGGGGCCTGGACGCGCTCCTCGCCACGGAACGTGCGACGCGG
+GAGGCGGGGGAGGGGACGAGCGGGTTCGTGACGAGCAAGGTACTGGATCAGGCCGGAGGTCTCGTCGCCG
+AGCTTGGTGAGGGCTACCCGCTGCGGGTGGAGCTCACGGGTGTCGCCTACGGCAATCAGTCGGCGGTCGT
+CGACGACGTCATGCACGACGCGCTCCCCCTCCCGCTGGCCGCGCTCGAGGTGGACAGCTTCGTCCGCTCC
+GCTCTGCTGGAAGTGTGCGAGCAGGCGGAGCAACTGGCCGCCGCCGTCAACCATCTCTCCGCCGACCTGC
+GTCGCGCGCTTGGCACCGAGCCCATTCCGTGGGACCGGGGCCAGCGTCCCGGCGAACTCGTCCTGCACGC
+CCTCGATCCGCTGGTGCGGCGGCTGCTGGCCGGGATACGGCATGTGGACGACCTCGAACGTATCGATGCC
+GGGCAGCTGGCGTGGGAGCAGCTCGCCTGGAGCCGGGCCTGGGCGGTCGCGGACCGGCTGCTCCAGGCCG
+TACCGGTCAGCGCGTTCGCGGGCCGGAGCACTTCTCAGGGGGAAGGGAAGCCTGAGCGGACCCACCGTGT
+CTCGCTCGCCGAGTCGTTCTTCCTCAAACGCCGCGCGGAAATTTTGCACCGGGCCGCCGCTGCCCGGCGC
+GAGAGCACCGCGGGCGTCGCAGAACCGGCCGGCCTGCCCACCGCATCCTGA
+>lcl|NZ_CM001166.1_gene_72 [locus_tag=STTU_p0072] [location=62699..62821]
+TTGAAACCTTCTCTGTTTAACCTACGCACACCCACCACGCGCGCGGGCAGGTTTCCCGCAATCCGATGCG
+AGAATCCGTTGACCGACAACCGACCCCACCCCTGGCGCTGTCCGCGGGGATGA
+>lcl|NZ_CM001166.1_gene_73 [locus_tag=STTU_p0074] [location=complement(62922..66026)]
+GTGTCGCCGCGGCGGTGGGGGGGTGGGGGCCTGCGGGTGCGGGTCAGCCCATCTGGGTTCGGGCGGTGCC
+CTTGTATCACGGGGTCGGGGGTGGCGGGTGTCGTTTTGGTGATTCTCCTTATCGTTTGTGCAGTTCAGAG
+GGTGTTGTCGGTGGTGCCGTTTACGATCCGGTTCTCGAATTCGTGTGTGAGGTGGGGGTTTTCGGTGGAT
+GTGAATGAGCTGGCGTTGAGGTACGGCGCGGCGGTGGTGCGGGGGCTGGAGACGTTGTGGGGGAAGTCGC
+GGGAGAGGGCTGCGGGGAGGACGAGTCTTCTGCTGGGGCATCTGCTGGATACGGCGGCGGTTGCGGAGCT
+GATGTGGGAGGAGTTCTTGGCGCCGGCGACGCGTTCGGCGCTGGATGAGGTGGCGGGTGGGGTGGGGTGT
+GGGCGTGGGTTGTTTGTGTGGTTGTGCGCGGTGCATGACTGCGGGAAGGCGACGCCTGCGCATCAGCGGT
+TGTGGGATGAGGGGGCTGAGGCGGTTCGTGCTGCTGGGTTGACGTGGCACGAGCCTTCGGCTGTAGCGGG
+GGCGAAGCAGCGTTGGCGGCACGACTGGGCCGGTGGGCTGATCGTTCGGGAGTTGCTGGGGGAGGTGGGG
+TGGAGTGGCGAGCAGGTGGACTGGGTGTGGCCGCTGGTCGCCGGTCACCACGGGGCTTTCCCGACGCTGA
+AGGACGTGCGTGAACCGGGGTCCGCGAAGCGGCAGTTGCGCGGGATCGGGGTGTGGCGGGAGGTTCAGCG
+CGCACTGCTCGATGTGGTCTCGCGCGAGGTGGGCTTTGCGGGGCCGGCGGAGGTGGAGCCTGTGGTTGTT
+CCGTCGAGGGCATTGCAGTTGCAGGTGAGTGGTCTGGTGGTGATGGCGGACTGGATCGCGAGCGACGAGC
+GGTACTTCGGTGGGGTCGATGACCTGCGAGAGGTGAGTGCGGAGGGTTCTCGTCGGCGGGCCGCGGGGGC
+GTGGAAGGCGCTGGGGCTGCGTGGTGGCTGGGGTGAGCGGGGTGTGCCGGGGCGGGAGGTTTTTGCGGGG
+CGGTTCGGGTGTGTGCCGCGGCCGGCGCAGCGGATGGTCGTCGACGCGATGGGGGATATGGGGGGTGCGG
+GGCTGGTGGTGGTGGAGGCTCCGACGGGGGAGGGGAAGACGGAGGCGGCGCTGTTCGCCGCGGAGGTTCT
+GGCGGCGCGGTTTGGTGCGGACGGTGTGTTCGTGGGGATGCCGACGCAGGCGACGAGTGACCCGATGTTC
+TCCCGGGTGCGTGGGTGGCTGGGGGCGGTTTCGGAGGAGTTCGCGTCGCGGGTGGTGCTGTTGCACGGCA
+AGCGGGCGTTCAACCGGGAGTGGAAGGGGCTGGTGGAGGAGGGGGCGGGGGCGAGGGAGGCCTTTGGTGG
+GGTGGATGAGTTCGGTTTGGCTGGTGATCCGTTCGGTGTGAGCGGGGAGGGGGGTGGGGAGCTGGAGTGT
+CAGGCTCTGGTGGAGTGGTTTTTGGGGTCGAAGCGGGGTCTGCTGGCTCCGTTCGTGGTGGGGACGGTTG
+ATCAGCTGCTGTATGCGGCGACGCGGACGCGGCATGTGATGTTGCGGATGGCGGGGCTGGGCGGGAAGGT
+CGTGGTGCTGGACGAGGTGCACGCGTGCGACGTGTACATGAGTCAGTTCTTGCACGAGGCGTTGCGGTGG
+CTGGGGCAGGCGGGGGTCCCGGTGGTGGTGCTGTCGGCGACGCTGGCCCCGGCGCAGCGGCGGGGCTTGC
+TGGAGGCGTATCTGGCGGGTGCGGCGTCCGTGGAGGAGTTGCGGGTCGAGGTGCCGGCCGCTGAGGGGTA
+TCCGAGTGTGACGACCGCGTGGTCGCCGGCTGGGGGCGAGCCGCAGATCCGGGTTCGGGCGACGGGTAGC
+TGGCGGGCGGATCTCGGGGTTGAGGTGCGGGTGGTTCCTGAGGCGGTTCCGGGGCGGGGGAGTTCGCGTG
+AGGAGCGGGAGCGGGCGCAGGCTTCTGCGGATGCGCGGGTGGGGGAGTTGCTGGCCGGTGAGCTTGCCGG
+GGGTGGTACGGCGCTGGTGATCCGTAATTCGGTGGCGCGGGCGCAGAGCCTTTTCGAGGAGTTGCGGGGG
+CGTTTTGGCGGGGATGAGGTGCGGTTGCTGCACGCGCGGTTCACGGTGGCGCGGCGTGCGGAGCTGACGG
+AGGAGTGTTTGCGGCTGCTGGGGCCGGGGGCGGGGCGTTCGCGTTCGGGGCGGTTGGTCGTGGTGGCGAC
+GCAGCTTGCGGAGCAGTCTTTCGATGTGGATGCGGATGTGCTGGTCACGGATGTGGCGCCGGTGGATCTT
+TTGTTGCAGCGCGTGGGGCGCTTGCACCGGCACGAGGGCACGTGGAGGCCGGAGGGGCTGCGGGTTCCGC
+GTGTCTTCGTGACGGGTTTCAGTCCTCGTGAGGGGCGGGAGCCGGAGTTCGTGTCCGCGAGTGAGGGGAT
+CTACGGGCGTCATCTGCTGTTGCGGACGGCGGCCGTACTGCCCGGTGCGGGTGTGGGGGCGAAGGCGGGT
+GCGGGCGGGGTGTGGCCGGTTCCGGGGCGGGTGCCCGCTCTGGTCGAGGAGGTGTACGGGGATGAGGAGT
+CGCTCTTGCCCGAGGGGTGGCGTACGGCGGGTGAGGCGGCCCGGAGCGAGCAGGAGACGCAGGACCGGGA
+GCGGGCGCAGAACGCGCGGCAGTTTTTGCTGACGGGGCCGGGTGAGCACGAGCGGCGGACGCTGGCCGGG
+TTGCATTACGGCGGGGGGACGGCGGGCGGCGGTGAGGACGCGTTGCGGGCGGCGGTACGGGACGGGGACG
+AGTCCGTGGAGGTCGTGCTCGTGCGCCGCGACGGGGACGACGGAGCGTTCCGGACGCTTGCGGGGCGGGC
+GCTGAGTGTCAACGGGGACGTGGCTCCAGAGGTGCTGGAGGAGGTACTCGGTTCCGTGGTGCGGCTGCCC
+GCGAAGTTCACCAAGGCGGCCGCAGGGCTGGCGCCGCTGCCGGGCTGGCACGGGCATCCGTGGCTCGGCC
+GCAGCCGTGCTCTGGTGCTGGACGCCTCGGGTAGGGCCCGGCTGGGCGATTTCGCGGTGGCGTACGACGG
+CGTGCTGGGGTTGCGGCAGGTATGA
+>lcl|NZ_CM001166.1_gene_74 [locus_tag=STTU_p0073] [location=66048..66248]
+ATGTTCCGGGCCGCTTCGAGGAGACAGGCAGCATCGCCCGGTTGCCCCCGCGCCTGCGGGATCCTCCAAG
+CTGGACCTCATATGGCAGGACCCGTCTGGCGTCGACCCCGCGCACGCGGAGATCCTCCGTTGAGGCCGCA
+GCCGGGCATCCACTCGCTCAGGTCGCGGGTACCCTCCTACCCGTCGATCCACCGGTCGTGA
+>lcl|NZ_CM001166.1_gene_75 [locus_tag=STTU_p0075] [location=66460..66621]
+GTGGGGATCAGTCGCGCCGCCGAGCGGCTTTCGGGGGTTTTCGGGGGTTACGGTGTTGACGTGGAGGGTG
+AGAGCTGGTGGGGGCGAGCTGTTGTTTCTGTTCTGGGCTCAGTAGCCGGCCGGAAAGCAACTGAAGGAAA
+ACCGGCAGACCGGCTGGTATGA
+>lcl|NZ_CM001166.1_gene_76 [locus_tag=STTU_p0076] [location=complement(66753..67187)]
+ATGCCACTGGTCCTCATCCCGACCGACACCGTGGGAAGATCCCCGCGTGCGCGGGGCCGACAGTTCGAGC
+GCGGGCGAGCGGCCGTCCTGCGTCGGAAGATCCCCGCGTGCGCGGGGCCGACCCGTGCACCTGATCGGCG
+AACAGCTCACGACCAGGAAGATCCCCGCGTGCGCGGGGCCGACACCTTGCCCCTTGTTGTCACGCCGACG
+CTGGTTCGGAAGATCCCCGCGTGCGCGGGGCCGACGTGCCGTTCCAGATGCTCTACCGGCTGTGGGACGG
+AAGATCCCCGCGTGCGCGGGGCCGACGCCCGCTCGAGCGCGGCCTCGCTGAACGAGACCGGAAGATCCCC
+GCGTGCGCGGGGCCGACGCGCCGACGCGCCGCCAGGCGGCCCGCAGACGCGGAAGATCCCCGCGTGCGCG
+GGGCCGACCCGTTGA
+>lcl|NZ_CM001166.1_gene_77 [locus_tag=STTU_p0077] [location=complement(67221..67508)]
+GTGCGCGGGGTCGACGCCCGCCGTGCCGAGCCGGAGGCACCCGGCCTGGGAAGATCCCCGCGGGCGCGGG
+GCCGACCACCTCCCTCGCTTCGGCCTCGCGGAGGCGATCGGAGGATCCCCGCGGGCGCGGGGCCGACCGG
+AGCCGACTCGGCGGACAGGTACGGCTTGTCCGGAGGATCCCCGCGCTCGCGGGGCCGACGCGCCGACGCG
+CCGCCGCGAGGCGTGCAGCCGCGGAGGATCCCCGCGTGCGCGGGGCCGACCGGTGGAGCCTGCGACGACT
+GCCCCTGA
+>lcl|NZ_CM001166.1_gene_78 [locus_tag=STTU_p0078] [location=68014..68478]
+GTGTGCGTCGGTGTTCCCACCGATCGTTGCCCCCGCGCCTGCGGGGATTTTCCGGACCTCTTCGAGTCGT
+TCGCCGCCCTCGCCCGGTTGCCCCCGCGCCTGCGGGGATTTTCCCTCACCAGCTACGACCGTCCCACCGC
+CCGGAACGTTGCCCCCGCGCCTGCGGGGATTTTCCGAGCAGCCGCAGACCACCGACGTGTGGAACGTGGT
+CGCCCCCGCGTCGGCGGGGATTTTCCGTCCACCCCCGCCGCCTCGGCCCCGGACATGTGGTTGCCCCCGC
+ACCTGCGGAGATGCTCCGGTTCGGTGGGCGGAGTGCCACGGCTCGATCGGGGCCGGGTTGTCGCCGTGTT
+CGTTGGTGTCATCGCCTATGGGCTTCTCCTCTTCTTGGTGGATGAGGTGTTCTGCGTCCCGAGTGGGGCG
+GAAGTCGTAGGTCACTCTGGGCTGCACGGCCCCTTCTCAGCGTAG
+>lcl|NZ_CM001166.1_gene_79 [locus_tag=STTU_p0079] [location=complement(68637..68768)]
+GTGTGGTGCGAGACCACGCTCCAGCCCGGCATCGACGACATCGACCTCGGCGCCCGCCCCGCCACCCGCA
+CCGGGCCAGCCTGGTTCCCCCGCGGCTGCCGCCGCTGCTGCTACGGCAGGGACGAACGATAA
+>lcl|NZ_CM001166.1_gene_80 [locus_tag=STTU_p0080] [location=complement(68843..69370)]
+GTGATCTGCGGCAGCCCCTATCGCAAGCCCGTGCACGCCGCGACCTACGGGGCCGGGCGCAGGAGGCGCA
+GCATGACCTCGACTCTCCTCCCGAGGGCCCACCCCGGGTGCGCATGGCTGACCGAAACCCTGCTCGACCC
+GTCCCCCGCCTACGCCGACTGGCAGCGGGAACGGCTCGCGCCGGTGCCCTCGACGGGAATCTGGCGGGTC
+GTCGAGGCCCCGCTCTACCCGTCGATCGACGCCTTGTGCGTGCTCCGGATGAGCGGCAACGCCGGTCCCG
+TCCAGGGGTCCTCCGACGCTCGCCGCGCCTGGTGGCTCGTGGCCGCCGGGACCGCGACCCTCCTCACCGA
+CGTCCCGGGCACCCTCGCCCACCCCGCCGGGTGGGTGCTCGACTGCCCCGCACCCGGCATCGGCGCCGCC
+GGGCGCACTTGGCTGCACCCGCCCTACGGCACCGGTCTCCTCACTCCCGCACGCCTCCTCCGTGAAGCGC
+TCCTCGACGCGCGGGAGATGGAGGTGATGGAGCGGTGA
+>lcl|NZ_CM001166.1_gene_81 [locus_tag=STTU_p0081] [location=69530..69790]
+ATGTCGTTACGGTTCATCGGGATCGACCCGAACACAGGAGACAAGGAGAGCCCGACCGTCTGGGTGGACG
+AGGAGCACAGCGAGCTGGTCTTCCAGGGCTGGGTGCCGTCACCGGCCCTGGAGGCGGAGTGCACGGCCAC
+GGAGGTACCGGGCCACGCGAAGGGGATTCCCGAGGGGGAAGCGGTCGTCCGCATCCCGGCCCGGATGGTG
+GAGATGGTGAGGGAGGCGTGCGATGCCATCGAGCAAGCCCACGTTCGATGA
+>lcl|NZ_CM001166.1_gene_82 [locus_tag=STTU_p0082] [location=69828..70286]
+ATGCGCGACGCCTACGCCGTGGACTACGAGAAGGGTCCCTTCGCGGACTGGCGCGCCGGACACCGGCTCA
+ACCCGGCGGAACGCGAGACCTGGTGGCGTCCGTGGCTCGACCTCATCAGCGAAACGGTCGACCGCGGCGC
+GGAAGTGCGGCGCGCGCGGATCGTGTCCGAGCCGGTCAGCGAGTACACCCGCTTCCTCTACGACGGCACC
+TTCACCAATGTGGCCGCCGGGGAGCAGGTCCGCTGGCTGCCCCGACGCCAGGCATCCGACATTCCCCTGC
+CGGGCAATGACTTCTGGCTCTTCGACGGCGTGTGGGTGCACTGGAACCACTTCGCCGGGGACGGGTCATC
+GCTCGGCGCGGAGATCACCGACGATCCCCGCGCGGCGGCTGTGTGCCGTGACGCCTTCGAGCAGGTGTGG
+GAACGAGCTACACCGCACGACGAGTACAAGATCCGCTGA
+>lcl|NZ_CM001166.1_gene_83 [locus_tag=STTU_p0083] [location=70357..71166]
+GTGGCCGAGCGGCTGCGCGACCTCCGCCGAGCCGCAGGGCTCACGGTGACAGAGCTGGGGGCGGCGTGCG
+GCTGGCACCACGCAAAGACGTCCCGGATCGAGAACGCCCGTACCGCGCCCTCGGCCAAGGACATCACCGC
+CTGGTGCCGTGCATGCGGAGTTGAGGCGCTGACCGGGGACCTGGTGGCGCAGTCCCTCAACGCCGAGTCG
+ATGTACAGCGAGTGGCGCGACCAGATGCGGGGCGGAATAAAGCGCCTCCAGGAGTCCTTGACGGACTTCT
+ACCGGGAGACGCGCCTGTTCCGGGTCTACTCCTCCACGCTCATCCCCGGGCTGTTGCAGACGGAGGGATA
+CGCCGCGGGCCTCCTCACGGCCATCGCCGACTTCCGCCAGATCCCGGTGAACGACGGGGCGGAGGCGGGC
+GCCGCCCGGGTGGCCCGGTCTCGGGTCATCTACGAGCCCGGCCACCGCTTCGTCCTCCTGATCGAGGAGG
+CCGCCCTCTACTACCGGATCGGCGACGACGAGGCAATGGCCGCCCAACTCGGCTTTCTCCTCACGGCTGG
+TGCCCTGCCCGCCGTGTCGCTGGGCATCGTCCCCTCGTCGCACCCACAGCGTCGGCAGTGGCCGCACGAG
+ACGTTCCACATGTACGACGACGCCTTCGTGTCGGTCGAACTGCTCTCCGCGCAGGTGAAGCTGACCCAGC
+CCTCCGAGATCGCCCTGTATTTGCGGGCGTTCGAAGAGCTGCGGAGCATGGCCGTCTACGGCGCGGACGC
+GCGCGCTCTGGTCGTGCGGGCGATCGACGCGTTGCGGTAG
+>lcl|NZ_CM001166.1_gene_84 [locus_tag=STTU_p0084] [location=complement(71258..71626)]
+GTGACGCACGGCTACGAGGACGAGTGGGGGCCATCCCCGCGCGTGCGGGGACCATTCGATGTGGCAGTGC
+TCGCTCTGCGGCACCTGGGGGCCATCCCCGCGCGTGCGGGGACCATCCGCATCCGTGAAACCCGAGAAGG
+CGACCTTCGGGGCCATCCCCGCGCGTGCGGGGACCATTTCGACTTCCGGCATGTCGCTGACCTGCTGTTT
+GGGCCATCCCCGCGCGTGCGGGGACCATACCGTCTGGAAGTCCTCGTCGGGGGTGTCCATGGGGCCATCC
+CCGCGCGTGCGGGGACCATCAGCACGGGCATCCCAGGCCACGACCGAGCGTGGGGCCATCCCCGCGCGTG
+CGGGGACCATACTTCGTGA
+>lcl|NZ_CM001166.1_gene_85 [locus_tag=STTU_p0085] [location=complement(71631..71861)]
+GTGAACGTCTACAACGGCGGAGGATCCCCGCGGGCGCGGGGCCGACTTCTGCGAGAAGGTCGCGCAGCGC
+TTCGCCCGCGGAGGATCCCCGCGCTCGCGGGGCCGACGCCGATGAGCGCGGTGGCGGTGGAGGCCGCCGT
+GGAGGATCCCCGCGTGTGCGGGGACCATCCCACGGTCGTCTTACCGACGGACCCAGCCCGGGGGCCATCC
+CCGCGCGTGCGGGGACCATAG
+>lcl|NZ_CM001166.1_gene_86 [locus_tag=STTU_p0086] [location=72035..72163]
+GTGGGTTTCGGGGGTTACGGTGTTGATGTGGAGGGTGAGAGCTGGTGGAGACGGGCTGTTGTTTCTGTTC
+TGGGCTCAGCGGCCGGTCGGAAAGCAACTGAAGGAAAACCGGCAGACCCGCTGGTATGA
+>lcl|NZ_CM001166.1_gene_87 [locus_tag=STTU_p0087] [location=complement(72171..72287)]
+ATGCCGGGCATGGCTGCCCGGAGGATCCCCGCGCTCGCGGGGCCGACTACAGCTCCGTCCCCGAGATGTG
+GAGCTTGTACGGAGGATCCCCGCGCTCGCGGGGCCGACACTTGCTGA
+>lcl|NZ_CM001166.1_gene_88 [locus_tag=STTU_p0088] [location=complement(72469..73953)]
+GTGTGCGGGGTCGACTCCACCAGCGAGATGACCGCGAGGGGAGAGTCCCCGCGGGGACGGGGCCAACGAG
+GCGGTGCTCCTCGCCGTACGACGTACTCACGGAGGATCCCCGCACACGCGGGGCCAACTTCAACCGCGCC
+GACGAGCCCGGCCGGGGCGGCAGAGGATCCCCGCGCTCGCGGGGCCGACTTCGCACCACCATCCTGTCTC
+GTCTCGACGCCCGGAGGATCCCCGCGCTCGCGGGGCCGACTCGAGCACGGTCACGGTGTCGTGCTCGCTG
+AACGGAGGATCCCCGCGTGCGCGGGGCCGACCTGGCCGAGACCCTCGCGACCCTGTCCCTCAAGGGAGGA
+TCCCCGCGAGCGCAGGGTCGACCCGCCCCTCGCCACCCGGCCTCGGGAAGACCGGGGAGGATCCCCGCGC
+ACGCGGGGCCGACGCTCATCCGCGCGCCGGGCCAGACTCACGCGCGGGGAGGATCCCCGCGCTCGCGGGG
+CCGACCTAGGCGGCGGTGAGCGTGCGCTCGGTCAGGGCGGAGGATCCCCGCGCTCGCGGGGCCGACGCGA
+GCCGGAACTCGCCCGCCTCCGCACCGAGCGGAGGATCCCCGCGCTCGCGGGGCCGACAGGGCCCCCGCCA
+GAGTTCCTCGGAGAGCACCCGGAGGATCCCCGCGCTCGCGGGGCCGACCGCCTCGAAGTCCACGCCTCCC
+CGGACAGCGGCGGAGGATCCCCGCGCTCGCGGGGCCGACGTGGTCGAACACGATGTGCGCGGACAGGTCG
+AGGGAGGATCCCCGCGCTCGCGGGGCCGACGCGGGGCGGACCTGCATCCGGGTGCCGTCCGGAGGATCCC
+CGCGCTCGCGGGGCCGACCTCGTCGGTGACCGGGATGTGATCCCATCCCCAGGAGGATCCCCGCGCTCGC
+GGGGCCGACTGCATGGCCCGGTCGGCCGCGCGAAGGGAGAGCGGAGGATCCCCGCGCTCGCGGGGCCGAC
+CGGCCGCCGTGGCGCCGCCATAGCCTCCTCCACGGAGGATCCCCGCGCTCGCGGGGCCGACGATACCCAG
+TCAGGAGACGTCATGGCTCTACACGGAGGATCCCCGCGCTCGCGGGGCCGACCGGGGTCCCGGTGGTGCT
+GTAGCCGCCAAGCTCGGAGGATCCCCGCGCTCGCGGGGCCGACGAGCTCTGGGAGGACAAGGACGCACTG
+GGCAAGGGAGGATCCCCGCGCTCGCGGGGCCGACGCCGTCGCGGCGTTCCTCACGGTGCAGGCGACCCGG
+AGGATCCCCGCGCTCGCGGGGCCGACGCATCGGGTCCCCTGTTCGGGGGCGACCACGGCGGAGGATCCCC
+GCGCTCGCGGGGCCGACTCCTGGGGAGATGAGGTGGTGCACGTCAAGGACGGAGGATCCCCGCGCTCGCG
+GGGCCGACGGGCGCTACCGCCTCGGGGAGACCTTGCAGAGCGGAGGATCCCCGCGCTCGCGGGGCCGACC
+ACTCGCCCCTGGTGA
+>lcl|NZ_CM001166.1_gene_89 [locus_tag=STTU_p0089] [location=complement(74275..74394)]
+GTGCGCATCAAACGTCCCGCAGAGGTTGTTCCCTACCAGCACTTTCAAAGACTCCCCTTGAAATTATTTT
+TCATCGAGACTCTGAATTTCTTTTTTCCCGGCAAGCGCAAGGGGTTGTGA
+>lcl|NZ_CM001166.1_gene_90 [locus_tag=STTU_p0090] [location=75091..75234]
+GTGGTGCATGCAAAAGAGGGAGGGGCCGCTACCTGGTTGGCAACGACCCCTCGTGTGTGGCGTTTGGCCG
+ACTACGAGCAGACCCAGATCATCAGCTGGAGCTGCAACTCCATCAGGCTGACGATGAAGGTCCATAGCTC
+GTAG
+>lcl|NZ_CM001166.1_gene_91 [locus_tag=STTU_p0091] [location=75768..76622]
+GTGTCACTCCTCAACGCCGTCGTCGCCGACCCCCGCGCACGCGGGGATCTTCCGGAGTTGGCGTTCTGGT
+CTGCGGACCGGAGGGGGCCGGCCCCGCGTCCGCGGGGATCCTCCGCGGCAGACCGCCGACGCCGAGGCCG
+TAGCGCAGTCGGCCCCGCGTCCGCGGGGATCCTCCGCGGTACGTCAGGTCGTTGGTCGTCGCGTTCGGGT
+CGGCCCCGCGCTCGCGGGGATCCTCCGGCCACGACCTCGGCGGCGGCCAGGATGAGGACGTCGGCCCCGC
+GCTCGCGGGGATCCTCCGTTCACCTGTCCGCTCTTCTGCCCGGCAACCTGGTCGACCCCGCGCTCGCGGG
+GATCCTCCTTGCGAGACGCCTCCTGCACGTCCCCGAGCGCCGTCGACCCCGCGCTCGCGGGGATCCTCCG
+CGGCTGATGGTGGAGGGCGGTGGGACGATCCAGTCGGCCCCGCGCTCGCGGGGATCCTCCTCGTCGGCGG
+GAAGTCGTGAGGACGTGACGGGAGTCGGCCCCGCGCTCGCGGGGATCCTCCGGCGGCGACGGCGCGCTCC
+AGGCGCTCTCGCTCGTCGGCCCCGCGCTCGCGGGGATCCTCCGTCCATCTACGAGGACACCGCCGCGCAC
+GTCCTGTCGGCCCCGCGCCCGCGGGGATCCTCCCGAGATGAACCGGTCCGCCGCGCCGAGCCCGGCCGTC
+GGCCCCGCGCTGCGGGGATTCTCCCTCCATGCCCGGTCAACGCCCGACCCCCGACCGGACTGGCTGGAGC
+ACCGGCGAAGTCGGTGGCCGAACACCGCGAATCTCCACCTGCTGATCAACAACGAGACCGCCACCAAGAC
+CAGCCGAGCCAGTAA
+>lcl|NZ_CM001166.1_gene_92 [locus_tag=STTU_p0092] [location=76872..77381]
+GTGACGTCGACCGAAGCAGCAGCAATCGCTCTACAGGACCATGCCGCCCTCTGGAGCATGGGGGAAATCC
+GTGCGAGCGATGTCGTCAATGCCGCCTGTGAGGCGCTCGTCGCCGGACTCGACACCCCCGGCCTTCGAGT
+CCTCGCCGCCTGCACACGCGCCGAGTCGGACTACGACGTCCACGAGTTGCTTCCTGAGGCACTCAACGAA
+CTCGGCCTCACCTTTTATCCCATCGCCAGCGATGCCGGCCAAGAAGCCGCTGCCCGAGCGCTCGCACGCC
+GCATGCTCGCGGGTGAGCTGACACCTCGGGAGTTCACAGTCCGCATTCACCAGCGCTACGGACATGAGCT
+GCCACTGACTGAGCGGCTCGCCGAACTCGATGACGAGTACGACGTCCTCGAATACGGCGACGGAACCGTG
+GACCACGTTGATGTCGAGGTCACCGCCGAAGCGCGCCGCCTCGCAGCCCACCCCCACGTTCCAGCCGAAT
+CCACGGACACGCCCAGCTGA
+>lcl|NZ_CM001166.1_gene_93 [locus_tag=STTU_p0093] [location=complement(78111..79388)]
+GTGCGCGGGGCCGACATCACGGAGGGTGCCCCAGTGCGCGTGGTCGGCCTGACGCTCCGCGTGCGAGAAA
+TTGAGGGCCTGGCTGGCGAGGGCTTGGCTCCACCACCCGGAGCATCCCCGCGTGCGCGGGGCCGACGGGA
+CGTAAGGGCTGCTCACGGAGCATCCCCGCGTGCGCGGGGCCGACGTGCGGGATGTGGATACTCATGCCGC
+CACCGCCGGAGCATCCCCGGGTGCGCGGGGCCGACGTATGCGGGAGCTGCGGGCGGACGGATGGCCCAGG
+AGCATCCCCGCGTGCGCGGGGCCGACCTCGCTCTCGTCCTCGACGACGGCGGGGAGACCGGAGCATCCCC
+GCGTGCGCGGGGCCGACCCCACGCCGGTCGAGAGCGGCGCTCCACCACCCGGAGCATCCCCGCGTGCGCG
+GGGCCGACGGGACGTAAGGGCTGCTCACGGAGCATCCCCGCGTGCGCGGGGCCGACGTGCGGGATGTGGA
+TACTCATGCCGCCACCGCCGGAGCATCCCCGCGTGCGCGGGGCCGACCTCGCTCTCGTCCTCGACGACGG
+CGGGGAGACCGGAGCATCCCCGCGTGCGCGGGGCCGACCTCGGATCAGACTGGTCATCCGCTCCGGCATC
+AGGAGCATCCCCGCGCTCGCGGGGCCGACCGCGACGGCTGGGGACCCCTCGATGCCTGGTACGGAGCATC
+CCCGCGCTCGCGGGGCCGACGGCTCTCTCGGGGCCACGGCTCCAGCTCCTCTCGGAGCATCCCCGCGCTC
+GCGGGGCCGACGACCGCCACACCTATGCATCACGACCCGAAGGCGGAGCATCCCCGCGCTCGCGGGGCCG
+ACGGCGCCGGGACCTCGCCGAACGACCCGGACGACGGAGCATCCCCGCGCTCGCGGGGCCGACCTCCTCT
+CCCTGGCCGAAGTCCTCTTCGCGGTCGGAGCATCCCCGCGCTCGCGGGGCCGACTGGTCGTTGCGCAGGA
+TGGAGATGACCAGGCGCGGAGCATCCCCGCGCTCGCGGGGCCGACCGGGAAGGGCCGGAGGGCGCAATCC
+CCCGGCCCGGAGCATCCCCGCGCTCGCGGGGCCGACTGCGGACGCCTTGTAGTTGACGTGCGCGACGCCG
+GAGCATCCCCGCGCTCGCGGGGCCGACGCGCTTGGGCTCACGAGCAGCTTCGTCGTGGGCGGAGCATCCC
+CGCGCTCGCGGGGCCGACACTTGCTGACCTGCAGTCATACCAGCGAGTCTGCCGGTTTTCCTTCAGTTGC
+TTTCCGGCCGGTCGCTGA
+>lcl|NZ_CM001166.1_gene_94 [locus_tag=STTU_p0094] [location=complement(79407..79754)]
+GTGCGCGGGGCCGACCGTGGTCCGGCTGCCCGAGGAGCAGCGCGGGGAGGAGCATCCCCGCGTGCGCGGG
+GCCGACGGCCAGAGCAGCGCGTCGACAAGACCCCGCAGCGGAGCATCCCCGCGTGCGCGGGGCCGACCGT
+CGGGGCGGGACGATGTGGCCGCAGTCCGGCGGAGCATCCCCGCGTGCGCGGGGCCGACTGCGAGAGGCGG
+CTGGTGATGCGCTGGCCGAGCGGAGCATCCCCGCGTGCGCGGGGCCGACGGCCCATCGCGGGCCAACCCC
+AGTGGAACGGCCGGAGCATCCCCGCGTGCGCGGGGCCGACCTGCAGCGTCCGGTCATCGTGCGCGTAG
+>lcl|NZ_CM001166.1_gene_95 [locus_tag=STTU_p0095] [location=complement(79839..81017)]
+GTGACGACCAGCGCCCTCGTGCCGGTCGGAGGATCCCCGCGCATGCGGGGACGACCCGGGGTGAGGGTGT
+CCGTCATGACGTGCTCTCGGAGGATCCCCGCGCATGCGGGGACGACGTCGCGCGGGCGCGCAGCCATTCC
+AGCGCCCGCGGAGGATCCCCGCGCATGCGGGGACGACGGCCAGCTGCGAGGCGCAGCTTCGCGCGCACAG
+GGAGGATCCCCGCGCATGCGGGGACGACAGCTCGACACGGGCGGTGATGGCGTTGACCAGCGGAGGATCC
+CCGCGCATGCGGGGACGACGTTCGTGCACGCCGAAGGCCCCGTACGCAGAACGGAGGATCCCCGCGCATG
+CGGGGACGACCGGATCAGGTTGACGTTCTTGATGCCGTTGGCCGGAGGATCCCCGCGCATGCGGGGACGA
+CGTGACCTCCTCCAGGGCGGCCCGGGTCACGGCCGGAGGATCCCCGCGCATGCGGGGACGACCCACTCCG
+GCTCGCGCGGGTACCACCCCTCCTCGGAGGATCCCCGCGCATGCGGGGACGACCGCGTGTTGGTGCTCGC
+CTGCCGCATGTGCTCCGGAGGATCCCCGCGCATGCGGGGACGACCCGGACGTCGACAGCCCGTTGGCCGT
+CAGCGCCGGAGGATCCCCGCGCATGCGGGGACGACCACGCGTCCAGATACCGCTGGTACAACCGGTGCGG
+AGGATCCCCGCGCATGCGGGGACGACCCACGGCCCGGCTTCCACCCCGCACAAGACCGCGGAGGATCCCC
+GCGCATGCGGGGACGACCCCACCGTCCCGAGCGGCGGCAGGCTCATGGGCGGAGGATCCCCGCGCATGCG
+GGGACGACACTTTCTGACCTGCGGTCATACCGGCTGGTCCGCCAGTTTTCCTTCGGTCGCTTTTCAAACG
+GCCGCGGAGCCCAGGATAGAAACGACCGCCCGACCCCAGCCCCAGTAGCTCTCACCACCGCTCATACGAA
+CACCGTAGCCCCGCCCAGCCACCCCCGTAACGCCACCGATCCCGGGAGCGCGGGGTCGTCCCTCCTCCCC
+GTCGCCCGCACCCCTCAGGAGATCCCCACACCCGTAGGGCCGACCCGAGGTCGTCGTCGTGGTCGCCGAG
+GACGACCGGAGGGTCCCCGCGCCCCCAGGGCCAACGCCAGGAACATCTCACGAGCCTGA
+>lcl|NZ_CM001166.1_gene_96 [locus_tag=STTU_p0096] [location=81757..82050]
+GTGACCGCCCCACACGAGCACTACCAGCCCACCGACGACGCCCCGCCCATGCGGACCTTCGCCGACCTCC
+GCGCCGCACTACGCCGGCACGGCTACCCCAGCGACCTCGACCAGTTCGACAGGGAACTCGCTGCCACCGA
+CCTCGACGACCTCACTCACGTCCGCGAGATCACCCAGGCATACCGGCACCGTGTCCTCCTCCACCGCGAC
+GCGGACGCGGCCACCGCCATCTCCCGCTCCAGCCAGGACATCGAGGCGGAACTGCGGCGCAAGATGAGCG
+AGGCCGACCGGTGA
+>lcl|NZ_CM001166.1_gene_97 [locus_tag=STTU_p0097] [location=82125..82319]
+ATGGTACGCCGCCGTCTCGAGGAGCAGCCCGACCAGCCCAGCGCCCGTCCGCTGCCCGATCGAGGAACGC
+GCAGCGCGACCTACGCCTACGAGCTCCTCCCCGAGCAGACCGGCGGCCGCGGTATCAGCGTCGTCTACCG
+CTACGCCGAGAACCTCGACGCGGTCTTAATCCTGTGGCTCATCGCCGGGCCCTGA
+>lcl|NZ_CM001166.1_gene_98 [locus_tag=STTU_p0098] [location=82675..83832]
+TTGGCCCCGCGCCTGCGGGGATCCTCCGAAAATCACCGCGCACTCCGCGCGGGCAGGCGCGTTGGCCCCG
+CGCCTGCGGGGATCCTCCGTGGAGCGGCTGTTGCGCGAGCGCGCCCTGCGCGTTGGCCCCGCGCCTGCGG
+GGATCCTCCGACCGGCCGGGGCTCACGGCAGCAGGTCACGCAGTTGGCCCCGCGCCTGCGGGGATCCTCC
+CCAGCCCAGCATCGAGGACGCGTTGCCCTGCGGGTTGGCCCCGCGCCTGCGGGGATCCTCCGAGGATCGG
+CACGACGCCGTGAGCGCCGGCCACGTTGGCCCCGCGCCTGCGGGGATCCTCCTCCCTCGCCGGTGATGGG
+GTTAGGCACGGGCGGGTTGGCCCCGCGCCTGCGGGGATACTCCGCCAGTGAGCACTGGCGCCTCGCGCGA
+GCTGGCGTTGGCCCCGCGCCTGCGGGGATCCTCCGTTTCGTACGGCGGGGTCCAGGCCGGTCAGGCGGTT
+GGCCCCGCGCCTGCGGGGATCCTCCGGTCTCGCCGGTCAGGGTGACGCGGGCGACCCAGTTGGCCCCGCG
+CCTGCGGGGATCCTCCGGAGCACCAGGCGGACGGCGTCCGCACCGAGTGGTTGGCCCCGCGCCTGCGGGG
+ATCCTCCTCGCGGGCTCCCCTCTCGGTCAGGGCTCTTGGGGTTGGCCCCGCGCCCGCGGGGATCCTCCGT
+GGGCCCGCTCGAGCGCGGGGAACCTTTGCAAGTCGGCCCCGCGAGCGCAGGGATCCTCCAGATCGCGGCC
+CTCTTCGTCGGTGGGGTCATGCGTCGGCCCTGCGGGCGCGGGGATCCTCCGGTCACCAGCTCGACCACCA
+CGGCGGTCAACTTGTTGGCCCTGCGGGCGCGGGGATCTTCCGCACGGTCAGCGGAGCTACTGGCGGACCA
+ACAGGTCGACCACGCGCACGCGGGGATCTTCCGACGATCAGGCCGACGATCACGTTTCGTACCCCGTCGA
+CCCCGCGCGCGCGGGGATCCTCCGGCTGCTGCAGGCGAACTGGCGGGCGCCGGGTTGCCCTCGCGCTGGC
+GGGGATCTTCCGACCGCTCGGGGCGGCGCGCGCTGGCTGAGCCTGTCGGCACCGCGCTCGTGGGGATCAG
+TCGCGCCGCCGAGCGGATTACGGGAGTTACGGTGTTGA
+>lcl|NZ_CM001166.1_gene_99 [locus_tag=STTU_p0099] [location=83841..83984]
+GTGAGAGCTGCTGGGGTCGGGCGGTCATTTCTGTCCTGGGCTCAGCGACCGGCCGGAAAGCAACTGAAGG
+AAAACTGGCAGACCAGCCGGTATGACCGCAGGTCGGCAAGCGTCGTCCCCGCGGGCGCGGGGATCCTTCT
+CTGA
+>lcl|NZ_CM001166.1_gene_100 [locus_tag=STTU_p0100] [location=complement(83992..84606)]
+TTGGACGCCAGCACCGAAGGATCCCCGCGCCCGCGGGGACGACGATCCCTCCACCTCGGCGGCCAGACCG
+TAGCCCGAAGGATCCCCGCGCCCGCGGGGACGACGGGCGGTCAGCGTCTCGTACCCCCGCCCGGCCAGAA
+GGATCCCCGCGCCCGCGGGGACGACGACGTCCAGATCATCACGTTCAAGCGCATCTCCGAAGGATCCCCG
+CGCCCGCGGGGACGACTCGTCGCAGAAGCGGATGAGGAAGTCGAGGACCGAAGGATCCCCGCGCCCGCGG
+GGACGACCGCGCACGTGCCAGCGTCCCCGGCCGCGCAGGAGGAAGGATCCCCGCGCCCGCGGGGACGACC
+ACCGTTCGGCGGAACGGCGAGGCGAGCGTGTCGAAGGATCCCCGCGCCCGCGGGGACGACTTCTGGGCGT
+CAGATGCCGAGGTCGAGGCCGAGGAAGGATCCCCGCGCCCGCGGGGACGACGACCCCGGACTGCCAGAAC
+ACGACGCCCCTCCCGAAGGATCCCCGCGCCCGCGGGGACGACCCGGGCGAGACGAGGGCTTCACCTTGAT
+CAAGGTGAAGGATCCCCGCGCCCGCGGGGACGACTCGCGGGACTCGGCGGCATGA
+>lcl|NZ_CM001166.1_gene_101 [locus_tag=STTU_p0101] [location=84849..85730]
+GTGAGGGCGACCCCGGGAGGCCGGTCGGCCCCGCGAGCGCGGGGATCCTCCGCGGTCCTGTCCGCGCGGT
+GGTCCTGGCCAGAGGTGTCGGCCCCGCAGGCGCGGGGATCCTCCGACGGAGAACTGGGTGGTCGAGGCGA
+TCCAGGCGTCGGCCCCGCGCTCGCGGGGGTCCTCCGGTGTGCGGCGCACTTCGGGAATCCGCTTCGCCCC
+GTCGGCCCCGCGTGCGCGGGGATCCTCCGCTGGAGAGCGGCAGCACGCGCATCCTGGCGAGGTCGACTCG
+CGCTCGCGGGGGATCCTCCGGCCCCGTGTGCTCCGCCCTCGGCCCGCTGGGTCCCGGCCCCGCGCTCGCA
+GGGGCCCTCCTCCCTCGGCTGCCTCGCCGACGTGTTCAGGGCCATCGGCCCAGCGCTTGCGGGATCCTCC
+GGGACTCTTGCGCGAGGCCGCAGGCACACCGAGCGTCGACCCCGCGCTCGCAGGGATCGTCCGCGCTCTC
+GGTGTGGCTGGCCGGCGATACGGTGTACGTGTGGGGGTGAGAGCTGGTGGGTTCGGGCGGTTGTTTCTGT
+TCTGGGCTCAGCGGCCGGACCGGAAAGCCACCGAAGGGATACTGGCAGACCCGCTGGTATGACTGCAGGT
+CAGCAAGTGTTGGCCCCGCGCCTGCGGGGATCCTCCGGCCGGGGGGCTGCTCGCGTGGTCGGTGGAGCAG
+TTGGCCCCGCGCCTGCGGGGATCCTCCGGCCGGGGGGCTGCTCGCGTGGTCGGTGGAGCAGTTGGCCCCG
+CGCCTGCGGGGATCCTCCGGGGCAGCGCCTGAACTCGTCCAGCTTCGTGGAGTTGGCCCCGCGCCTGCGG
+GGATCCTCCGGTCCTCGGCAGCGGCTGGCGGGCAGAGGCTGA
+>lcl|NZ_CM001166.1_gene_102 [locus_tag=STTU_p0102] [location=85793..86029]
+TTGGCCCCGCGCCTGCGGGGATCCTCCGCTTTCGTGGACGCGTCCGAGATCGACCCGATCGTTGGCCCCG
+CGCCTGCGGGGATCCTCCCTCCTCATGGTCCGCACGGGGCGCCGTCAGGTGGTTGGCCCCGCGCCTGCGG
+GGATCCTCCGTCCACCCCCACCCCCGAGCGCGAGCCCGCGTTGTTGGCCCCGCGCCTGCGGGGATCCTCC
+GGTATTGATCGGCACACCGAAACCTGA
+>lcl|NZ_CM001166.1_gene_103 [locus_tag=STTU_p0103] [location=86034..86153]
+GTGCTGGCCCCGCGCCTGCGGGGATCCTCCCAGACGGCACATCACCGCAAATCTCTACGAACGGTTGGCC
+CCGCGCCCGCGGGGATCCTCCGACGAGAGCGGCGCCGCCGGGCCGGGTGA
+>lcl|NZ_CM001166.1_gene_104 [locus_tag=STTU_p0104] [location=86169..86306]
+GTGCGCGGGGATCCTCCGCGGCTCGCCGACCAGATCCTCAAGACCCCCGAATCGGCCCCGCGCTCGCGGG
+GATCCTCCGAGGCCCGTGTCCGCCGCGCGCCCCGCCTCCGCGTCGGCCCCGCGCGCGGGGATCTTTAG
+>lcl|NZ_CM001166.1_gene_105 [locus_tag=STTU_p0105] [location=complement(86413..87126)]
+GTGCTCCAGACCGGCCTGCACGCCCGTCGGAAGATCCCCGCGCACGCGGGGCAACGGGCCGCGCGAGGCC
+AGCGGGAAGTTAATCCGCGGAAAATCCCCGCAGGCGCGGGGGCAACGACCCGCTCCTGGTCCGCGTCGGC
+CTCTGGGCAGGAAGATCCCCGCACACGCGGGGACGAGGTGCTTTTCATGACGGATGCTGAGGCCAGGGAA
+GGAAGATACCCGCACACGCGGGGACGACACGCCGCGAGCTCGAAGAGCCTCAAGTTCGGCTGGAAGATCC
+CCGCGCATGCGGGGACGACCATCACGCACAGTCGGTCAGCTCCTAGTGCTGGGGAGGATCCCCGCGCATG
+CGGGGACGACGGCACGGGACTCCCGGCCCGCTCCCTGAAACCGGGAGGATCCCCGCGCATGCGGGGACGA
+CGCCGTAGATCAGCCCGTCGGACTGGTCGGGCTCGGAGGATCCCCGCGCATGCGGGGACGACTTCCTCAG
+CGCATCCATGCGGTAGAAGTCGTACGGAGGATCCCCGCGCATGCGGGGACGACCTCAGGCTCGGGCGCGA
+GGGCCAGGGTCTCCCCGGAGGATCCCCGCGCATGCGGGGACGACACTTTCTGACCTGTGGTCATACCGGC
+TGGTCTGCCAGTTTTCCTTCGGTCGCTTTTCAAACGGCCGCGGAGCCCAGGACAGAAACGACCGCCCAAC
+ACCAGCCCCAGTAG
+>lcl|NZ_CM001166.1_gene_106 [locus_tag=STTU_p0107] [location=complement(87305..87694)]
+GTGCGCGGGGCCGACCTCGTTCGTCACGCCCGGCCCGTCGCCCCGGAGGGAGCATCCCCGCGCTCGCGGG
+GCCGACCCGTCGAACTCGCGGTCGGCGTAGCAGGTTCCCGGAGGATCCCCGCGCTCGCGGGGCCGACATC
+CGGTCTACGGGCCGGAAGTACCAGCCCGCCGGAGGATCCCCGCGCTCGCGGGGCCGACAAGGCCGATCGC
+ACGCTGCATCCAGCGCACATCGGAGGATCCCCGCGCTCGCGGGGCCGACCGAGGCCGCGCACGCGAAGCT
+CGCCGACGAGCTGGAGGATCCCCGCGCTCGCGGGGCCGACACTTGCTGACCTGCAGTCATACCAGCGGGT
+CTGCCAGTTTTCCAGCAGTTGCTTTCCGGCCGGTCGCTAA
+>lcl|NZ_CM001166.1_gene_107 [locus_tag=STTU_p0106] [location=87710..87844]
+TTGTCGAACATCGAGCCGTACGGGCTCGTCTGTCGTCCCCGCGTGCGCGGGGATCCTCCGGGCTACGCGC
+TCCTCTTCGACCAGGACTTGGGGTCGGCCTCGCGTGCGCGGGGATCCTCTGCTGCTGGTGGGTGA
+>lcl|NZ_CM001166.1_gene_108 [locus_tag=STTU_p0108] [location=complement(87919..88359)]
+TTGCGAAAGGCCCAGATCATTGAGGCCGCAAACACGGCGGCGGGGCGCACCGTGGTCCGGGCCGTACGGG
+TCCTCGCCCCCAGCACCGGCCCCGCGCCCACCCCGGCCCCGGCCACTGCCGACGGCGAAGGCACCGCCGC
+ACCCACGCCCGTACGGACCCGGGAGAACGCCTCGCCCGGATACCGCCCTGCGCTCCGCGCCCACCAGCAG
+GCAGCCCCCGCCCAGCGCGTCGACCACGACGTCCTCAAGGCCGACCGCCGCGCCGGCGAGCGCCAGGCGG
+CCGCGATGCGCGCCCTGTCCCACCACGCCTTCCCCGACGAAGTGCCCCGTCTCTCGGCGCGCGAGGACGT
+CGACGCGGAGCGGCGCACCGGTGCCGAGATCGAGGCGGCCGCACGTCGCCGGGCCCGCGCGGACCGGGCC
+CCGCGTCGTGCGATCCCGTAA
+>lcl|NZ_CM001166.1_gene_109 [locus_tag=STTU_p0109] [location=complement(88705..90783)]
+GTGGGCAACCCGCTCCAGCTGACCGCGACGATGCGTACCCGGCTGCTCGCCGCGGTGCGCGCTCTGGTGT
+CCGATCCCGCCCTGGACGGGGCGGGCGACCCCGCGCGCCTGGCGGCGGTAGTGCTGATGGCGAAGGCCAC
+GGTGGCAACCGACTACAGCACGCGGATCACCGCGACGGAGCTGGGTCGGTGGATCGGGCTGAAGAAGTCC
+CGGGTCGCGCACCACGTAGTACCGGAGCTGCGCGAGCGTGGCGTGCTGGGCTCGAACGGGACGACGAACG
+CTGCCGGGTGGATGACGGGCCTGGAGTGCTGGGTGATCCCGATGTACCGGGCGCAGCACGGCGGGGACCG
+TAGGCACGTCCTGGCGCTGTCGCGGGTGGAGCTGGTCGTGCTCCTAGCGCTGATCGAGGTGCTGTTCGCG
+CCGGGCTGGGAACACCGGGACGGCCGGGTAACCCCGGCCGGGATGCTCGCGGGGCGTACGGGGCGCGGGG
+CGGCGACGGACCGGCTCGGGCTGCTGCTGATGGTGCTGTCGTCGAACTCCAGAGGGTGGCTGCAGCTGTG
+CTCGGGCAGCGTGGACACCGGGCGGGGCCGTCCGGCGGCGACGGTGGCGCGGCTGATGGGCTGCACGGCG
+GCGGCCGGGGCGAAGAGCCTCAAGCGGCTCCAGGAGCAGGGCGTGCTGTCGGTGGACCGGCGGGAGACGG
+CGTCGGGTCTGCATGCGCGCAGTCGGGTCCGGCTGCTGCCGGTGGCCAGGGCGCACGGGATCGCTGTCCG
+GGAGGCCCGCGGGGCCGCCGGCGCGGTGTTTTCAGACCTCGCCGTTACTGCATCCGGCGATCTTGAGACG
+ACGGTTGAGACTGTGTCCCCTGTGGTTACTGGGGTTCAGGGTACCGGGATGGGCCAGGAGCCTGATTCGG
+CAGACCGCGCCGATGCTGCACACCTTCACGCCTCTCACGCTTCTGGGGCTACTCCTGCTGATCAAGTTGA
+GGACTCCTCGGGTTTTTCCGGCGAAGGCCGTGGGGGGACCCCGCCGTCGCCGGACCGCGCGAGCGCGCGT
+GAGGAGGGCCCGCTGCGCGGGGAAAAGCGTGAGGAGTCCCCCTCGTCGAGCAGCAGTGAAAAGCGCGGGC
+CGGGCCCGGCGGTGACCCTGGTGCCGGAGCCTCAGGGCTGCGCTCAAGGCCGTCAGCAACCGAAGCAGGC
+TCCAGCGCCGCTGCCGCCGGAGGATCTGCGGGCGGTCCTGGAGCCGGTGGACTGGATGTGGGCGCAGCTG
+CCCAGGCCGGGGCTGCGCCGCGTCGTCGAGGCGGCCGCGCACGCCGAGCTCGCCGTCCTGCAGGGCCTCG
+TGGGCCGTACGGATGCGCCGCAGGTCCTCGGTGCCCGGCTGTTCCGGCGCCTGGGGGAGCAGATCCGTAC
+GGGCGGCGTGATCCGGGATCCGGCGGGCTGGCTGCTCGCGCGGGGGTTGCCGCAGCGCCAGCAGTGCGGG
+GACGTGCGCTGCGACGACCGCATCCTGCTCGACTCCGGGCAGGCGTGCCCGCGGTGCGAGGACCGGCAGG
+TCGATCGCCGTGCGCAGCGTCGCCGGATCGCCGCCGAGGTCGAGGAGCGGCTCCCGTACGCGGGGGAGGA
+GGAGCGGCGCGCGGCGACTGTGCGGCAGCTGCACGAGGACGTAAGGGCCGCCGGGTGGGCGCGCGAGTGG
+GAGTGGGAGCGGGTCCGGGCGCGGCAGGCCGCGGCCCGCGCACGCGCCGATGCCGCCCGCCAGGACCAGC
+CGGAGCCCACCGCTCCCGCCCTGGGCGCGCTCCCGGCGCCGCGGGCTCGGGTGCTGGCGTCCCGTACGGC
+CGCCCCCGCTGTGGCGCCTGCCGGGCGACAGGTCCGCGAGGTCGTCGACGAGCTCGTGCTGGAGGAGCTG
+ACTCGCGAGCAGATCCTCGACTGGCGCGCCCGCGCCACCTACGACCACCAGGTCGTTCTCGACCACATCG
+CCCGCTACGGCGAGCACTCCGCGCAGCGGCTGTTCACCCGCGCGCTCGTCGCCACCGTCCACCGCGTGAC
+CGGCCGCGACCACCTCACCCTCACCACGAGCCCCTGGGGGATCGCATGA
+>lcl|NZ_CM001166.1_gene_110 [locus_tag=STTU_p0110] [location=complement(91495..91779)]
+ATGCAACTACCCCTCGGGCTGGCCGCAACCTCCAAAGCCAGGACGCGACATGAAGCAGAGTACCCGGAGT
+TCACCCCGGTCAGACAGGTGGAGCCACGGTTCCGGCGTGAGGATCACACCGCCGACGGACGTTACCCCTG
+TCCCTCCTACCGCCGCACACGCGTGACCGCCCGGAGCGGGGCTGCCCCCGCTCTCGCCGTCATGCCCACA
+CGCCTCATCCCCGAGCGCCGCGTTGTCGGCGTCTCGGGGCAGACCCCACCCGCTGCGGGGGGTCGGATGA
+CGTAG
+>lcl|NZ_CM001166.1_gene_111 [locus_tag=STTU_p0111] [location=complement(92060..93226)]
+ATGACGCAACAGGAGCTGGCAGCCCGGTTGAATGGACGGTCCGCTGGCTGGATGAGCCAGGTAGAACGCG
+GAATCCAGCCGGTACGTCGCGTCGATGTTCTCCAGGAGATTGCTGACGCGCTGGGTGTCTCCATCCAGAT
+GCTCGACCCCAGCTCCCCGATTTTCACCCCTTCGGTTCCACCTGTCACCGAGGCCACCAACGACCTCGAC
+GGTGCTCGAACCGTCATCTCAGGGCACCCCGCGATCGGCCTCATCACCGGGGTCGAGGAATCGGGAGCCA
+TTGACCTTGGTGCGCTCGAAGAGTCCGTCGAGCAGATTTGGGAGTACACCCACCGCAATGCGTATCCGGA
+GATCAGCGAGACAATCGCCGCGCTGCTCCCTCAGCTGGAACGTGCCGTACGCACCGTCCCCGCCCCGGAC
+CGGCCTGTCGCCTACCGGAACCTGGCGCGGGCGTACCAAGCACTCGCCGCCGCCTTCGCTCGGCAGGGCG
+ATTCTCGCTCATCATGGGTGTCCGCTGACCGGGCAGTAGCCGCCGGCGAGAGATCCGGTGACATTTTCCT
+CGTGCACGCGGGGATCTTCCGCATGGTGCACGCCTTCGTCCGCCTGGGGCACAACCAGGAAGCCGAACAC
+GCGGTCACCGAAGCGGTCGCAGCTCTCCAACGGCGCGCGGACCTCCCCCCGGAGGGCCTGTCCGTGCTCG
+GCTCGCTCCACCTCGCAAAAGCGCTGGTTCACGCCAGGTCTGGGCAACGCTCGGAGGCCCGCGCGGAACT
+GGAGAGCGCGAGACGGGTAGCGGAGCAGATCGGCGAGGACCGCAATGACTACAACCTCGAATTCGGCCCG
+ACCAATGTCATGATCCAGACAGTCTCAACCGCCCTGGATCTCGGTGATGCCGGGGAGGCTCTCGACATAG
+GGCAATCCATCGATGCCGCCTCGTTGTCGCCCGAGCGCCAAGCTAGGTTGTTGATGGACTTGGGGCGAGC
+CCACGCGCAGCGGCGACACACGCCCGACGCAGTCGAATGCCTGCTGCGCGCGGAGGAAATGTCACCGGAC
+CTAGTACGTCAGCACAGCGCGGCCCGGGCCGCGATCAGAGAGCTGTTGCTCGTGAGCGGGCCGAAGGCGT
+CCGCCGATCTGGTGGCTCTGGCCGCGCGGGCGTCCGCGGCGGAATGA
+>lcl|NZ_CM001166.1_gene_112 [locus_tag=STTU_p0112] [location=complement(93307..93645)]
+ATGACCATCCCAGGAGGAGAAGTGAGCGGATACGCACTCGTCGTGCGGTTCACCACCCGTGACGCCGACT
+CAGCCAAGAAGTTCGACGCCCTCGTGAGTCGCACTTTGGAGGGCATCCGCTACGAACCCGGCACTCTCGC
+CTACGTCGTCCATGTCCCGGAGGGCGAACCACTGGTCCGCGTGTTCTATGAGCTCTACGCGAGCTACGAC
+GCGTTTCAGATCCACGAGGCGCAGCCCCATACGCAGCGGATGCTCAGCGAGCGAGAGCAGTACCTCGACG
+GCAGCGAGGTCACGTTTCTCAACGAGCTGATGGGCAAGCGCCCGACGGAGACGACATGA
+>lcl|NZ_CM001166.1_gene_113 [locus_tag=STTU_p0113] [location=complement(93711..94109)]
+GTGGTCACGGGTGGAAACACCAACGACTGCACCCGGTTCCCCGCCGTGATGGAAGCGATCCGCGTGCCCC
+GGATCGGACCCGGCCGTCCCCGGGTCCGGCCCGATCACGTCCTAGGCGACAAGGGCTACAGCTCGAAGGC
+GATCCGCGCCTGGCTCCGTCGCAAGGGCATCGCCCACACGATTCCCGAGCGGGCCGACCAGGCCCGCAAC
+CGGGCCCGGCGGGGCAGCCGCGGAGGCCGCCCGCCGGCCTTCGACCGCGAGGTCTACAAGCACCGCAACG
+TCGTGGAGCGGTGCTTCAACCGTCTGAAGCAGTGGCGCGGGATCGCCACCCGGTACGACAAGACTGCCGA
+GTCCTACGAAGCAGCTGTCACGCTCGCGTCACTCCTGATGTGGGCGTGA
+>lcl|NZ_CM001166.1_gene_114 [locus_tag=STTU_p0114] [location=complement(94160..94558)]
+GTGGATCATGGTGTCGTGATACGTCGCCATGAACTGTCGGATGCCGAGTGGGAGTTCGTCCGGCCGCTGC
+TGCCCGAGTCGTTGCGGGGACGCAAGCGGTTGGACGATCGCAGGGTCCTGAACGGGATCGTGTGGAAGTT
+CCGGACCGGGACGGCCTGGCGGGACGTGCCCGAGCGCTATGGCCCGTGGGCCACGCTGCATACGCGTTTC
+CGCAGGTGGGCGGCGGACGGGACGTTCGACCGGATGCTCCGCGCCGCCCAGGCGAAAGCGGATGCGGCGG
+GCGACGTCGACTGGCTGGTGTCCGTCGACTCGACGATCGTCCGCGCTCACCAGCACGCGGCCGGGGCCCG
+AAAAGGGGGCTCCGCGACCCGGCCCTCGGCCGGTCAAGAGGCGGTCTGA
+>lcl|NZ_CM001166.1_gene_115 [locus_tag=STTU_p0117] [location=complement(94568..94960)]
+GTGACCGGGCGACAGGGTCGAGACGACGATCGCGTCCAGGGGGCTGACGCGGGAGGTACGGGTGCGGCCC
+CGGCGCGTACGGGCCGTGGGCATGGCGAGCTCGGGCATGGCGACTCCTCGGCAGGAGAAGGGAGGGGGAT
+TCGCGGGGCGGGTGCTCTCTCCGCCCACCAGGTCCACGAGCCAGCGGCCCACGTCCTGGCGGACAGACAG
+CGCATCAGCGCTGAGGTCATACAGCAGTCCTGCCAGCCAGGGGGTTTGGTGGTGCTACCGCCTCCGGCCA
+CCTGCCCGACTCCGAAGAGACGAGCCGCAGAAACTGCGGTGGCGACACGACCGACGCTACGCACACTTTT
+CGTGCTAGTCAATACTTCAGTGCTAGGCAGTGTCTTCAAATGA
+>lcl|NZ_CM001166.1_gene_116 [locus_tag=STTU_p0115] [location=94976..95716]
+GTGGAGGCCACGCAGGCCCGCCGTATCTCGCTGGTGTGCCCGGACTGCCGCACCTGGGTGGCCGTGACCC
+CGCACCGGGGTACCTACCTCCTCAAGCTCGTCCCGCACCACACCGGTCGTGCTGGCGTCGACGCCGCGAT
+CCGCTGCCGCTCCAGCAACCGCCTCGTCGACGTGGACCTCACCGACTCCATGTGGCGCCGCCAGTACGAC
+GAGTGGGCGCGCGAGGAGCGTCTCGCCGTCGACCTCACCCGCCACCGCCGAGCCACCGTCCAGACCCTCA
+AAGTCGCCCGGCCCCAGCAGCGGCCTGCCGACCGGCGCGCGCAGTGGGAGCGCGCGGTGCCCGCCGCCCG
+CCAGGCCGACGCCGCCCGCGCGGTCCCCGCCGACGCGCTCCCCACCACTCGCGGCCGGGCCGTCGACGGC
+CCCGCCGGCGCCCCGCCGGCCCTGCGCCGCCAGAGTGCCGGGGACCGCCGTTCCGTCCGCGCCCTGGCCA
+CCGGCACCCTGCGCGCTCTGGCCGACGCCCGCCAGGACCGGCTCGCGGGCGACGGGCTCGCCGAGCACCT
+CACCCGCGCCGCGTACCTGCACCTGGCCACCCTCTGGCGCCGCCCCCTGACCCCGGCCGACCAGCCCGCA
+CACACCGCGCTCATCGCTGCGGTCAGGGCCGCGCTGCCCGCGCCAGTCCCGGGCGAGACCGTCGCCGCGT
+ACATCACCCGCTGCCGCAGGTCCCCGCTCGCCGCCGCATGA
+>lcl|NZ_CM001166.1_gene_117 [locus_tag=STTU_p0116] [location=95822..96214]
+ATGTCCGCTACCGACCCGCTGACTGAGTTCGACACGGAGACGCTCGCGCTCCTGGAGGCGGTCGAGGTGC
+CGCTCCCCGCGTTCGGCGACCTGGACCTGGACGTCGCCTTCGGCACGCCGCTGGAGATGTACGACCTGGT
+GACCGCAGACGAGCTGGCCCGATGGGACGCCGTCTCCGTGGTGAAGAAAGGCCGGGCCCGGGCGCGCGAG
+GAGGTTGTTGCGGCCTCCGGGGCGCGGCGGGATGCGGCGCGGGACATCCTCGCCGCCGATCCGACCGTCA
+CCGAGCGGGTCCGCGAGCGCCTCGTCGACATCCTCATCCCCGCCGCGCGGCAGCTGCGGATCGACCGCAC
+CGTCGTCGTGTCGTTCGCGGAGTCCGAGGTGCTGGCGGCCTGA
+>lcl|NZ_CM001166.1_gene_118 [locus_tag=STTU_p0118] [location=complement(96383..96709)]
+GTGGGTGGTCGAGGTACGGCCGCCGTGGCCGTCGCAGTCCGAGCAGGCGATGCCCGCGGCGTGGTTCAGG
+CGGGCGCGCTGCTCGGCGGCGGTACGCGGCGCGCGACGACCGGCGGGGATACGGGTGTCGGCCTGGCGGG
+CCTCGGCGAGCATCCGGTCCTCGAACGTCGCGGCGGTGCGCTGAGGGTGGGGGCGGGCGGGCTCGGTCGG
+CGGCTGCGGCTGACGGCCCCCGGTCTCGTGCGGCTGCGGGCGGGTCGGGAGCGGGTCGCGCTGGACGCGC
+GGCGAGCGGGGCAGGGTAGCGTTCGGCATGCGAACTCCATCTCGTGA
+>lcl|NZ_CM001166.1_gene_119 [locus_tag=STTU_p0120] [location=complement(96810..97079)]
+GTGAACGTCCGTGACGTGGTGGCCCGCGTTGAAAGCGCGCGCCGCCGTCCGCCCGGCGAGGGCGAGCAAA
+CGGCGCGCGCGGGGATGCGCGGGTCCGTGGGAGAGCGCCCGCGCCGCGAGGAGTTGCGCGGCGCGGGCGC
+GTCTTATGTGGGGCACGCCCACCGCTACTTCGCGGGAGCGGGCGGCGGCGGGGGCGGGGTCTGCCCGCAC
+TCGCAGGGCGACATGGCGACGCTCTGGAACGGTTTGCCGTCCGCGCCGGTGTGGTTGTAG
+>lcl|NZ_CM001166.1_gene_120 [locus_tag=STTU_p0119] [location=97104..97280]
+ATGCCGACCACCTCCCCCACCTCCCAGCCGATCCCCGCGCCCGCGCCGACGCTGTGCCGCTACCGGCGCG
+AGCACGGCGACCCGACGACCTGGACCACCTCGGAGATTGAGGGCTGGCTGCACCGCCAGGACGCCGCCCA
+CGCCGACCTCACGACGCACGCGAAGGGAACCCGATGA
+>lcl|NZ_CM001166.1_gene_121 [locus_tag=STTU_p0121] [location=97412..97615]
+GTGGGCGAGACCGGCCCGGGGGCCGTGCAGCTCGAGGAGGCCAAGAAGATCTGCACGGGCTGCCCCGTCC
+GCGCCCTGTGCCTGGAGTTCGCGCTCGACTCCCGCCAGCAGGACGGCGTGTGGGGCGGCATCTCCGCCGA
+GGAACGCCGCCGCATGCGCCGGCGCCGCGCATGGCCCGCGACCACGGACACCCCCGCCGCGTGA
+>lcl|NZ_CM001166.1_gene_122 [locus_tag=STTU_p0122] [location=97732..97887]
+ATGCCCGATCAGCCGCAGCCCACCACCGAGCAGGTTGCCCAGGCCATCGTCGACGCCGCCACCAGCGGGG
+ACCAGGCGTTCACCGAGACGGTCGCCAACTCCTACACGACCGAGCAGCTCGAAGCGGCCCAGGCCTACCT
+CACGCAGGGACGCTGA
+>lcl|NZ_CM001166.1_gene_123 [locus_tag=STTU_p0123] [location=97992..98243]
+GTGAGGGGAGTCGGACAGCCCGAACCACGACCACTCAGTAAGGGAGTTAATCCCATGGCCTTTCTCCAGC
+GCCTCGTCAGCCCGCTGCGCCGCATAAACGCCGACCCCGACAAGCTCGTGGAAGAGGCGTGGACGCACAT
+CGCGGAGGCGGAGCGGAACCACGGCCTGTGGCCCGCGATGAGCGCCCTCACCGACCTCGCCACAGCCAAG
+GTCCAGGTCGCCCAGTACCTCAAGGAGCACCGCGACACGTGA
+>lcl|NZ_CM001166.1_gene_124 [locus_tag=STTU_p0125] [location=complement(98455..98628)]
+GTGGGCCACAGGCCGTTCACGAAGAGGTCGAACAGGGCGAGGACGGTGGAGATCACCGCGATGACCGTGG
+CCAGCAGAGCGGGCAGCGGGTTGCGCGGGACGAAGACGTCGTCCGTCATCTTGCTCGGGGTCGGGGTGGC
+CGTCGTGGTACTCATCGGGCACCCCCACTGGTAG
+>lcl|NZ_CM001166.1_gene_125 [locus_tag=STTU_p0124] [location=98734..100467]
+ATGACCGCCGTCGATATCCGCAAGCCCGAAACGGTCCGCCCGGACGACGACGACCAGCACTCCTGGCCCG
+TCCCGGCCCCGGCCGACCACACCGATCACGACCAGGAGCAGCCCGGCTCCCAGCAGCACGACCAGGACGA
+CCGGGACGACGACCCGCGCACCATGCGGCTGCTCGCCGTCGTCGCTGGCGTCGGCGGCCTGGTCCTCGCC
+GGGATCGGTTTCACCGGCTCCTACAACACGCTGCGCCACCTCGCGGAGAGCAAGGGCTTCGGGACTTTCT
+CCTACGCCTTCCCCGTCGGTATCGACGCCGGCATCCTCGTGCTGCTCGCGCTCGATCTGTACATGATGCG
+CAAGCGGATGCCGTGGCCGATCCTTCGCTGGACCGCGCACGGCCTGACCGTCGCGACCGTCGCTTTCAAC
+GCGGCCGCCGCCGGCCCGGTGACCGAGGACCCGCTCGCTGCGTCCATGCACGGCGTCATCCCGGTGCTGT
+TCATCATCGCCGTGGAGGCCGCTCGCCACTACATCGGCCGGATGGCCGACCTGCTCGCCGGTGAGACCCC
+GCTCGGGTCGGTCCCGCTGACCCGCTGGATCCTCGCCCCGCTGTCCACGCCGCGCCTGGCCCGTCGGATG
+CGGTTGTACAACCTCCCCTACAAGGAGGTCGCCGCCCAGCACCAGGCGTTGCGGATCTACCGCGAGGGCC
+TGCGCCAGAAGTACGAGAACCACGAGCAGAGCTGGCGCCGGGCGGCGACGCCGGACGAGCTGCTGCCGTT
+CAAGCTGGCCCCGTTCGGGTTCAGCGTGGAGCGCGCTCTCGGGGTCCCGCTGGAGGAAGAGACCAAGCGC
+CTCCAGCGGGCGGCGCGGGCCGCTGTTCAGCGTGCTGAGGCTGAGATTCAGCGCGTGCGCACCGATGTTC
+AACTGGGCGAGGCCCGCATTCAGGCGGAGGTCGACAAGATCCGTGGCGAGGGTCGCCTGAAGATCGCCCG
+GGCTGAAGCGGAACGCGAGGCTCAGGCGGAGATTCAGGCCGCCGAGGCCGATGCTCAACTGCGTGAGGCG
+CAGCGTCAGCACGCGCTCAAGCTCGCGGAGGACCAGGCTGCGGCCGAAGCGCAGGAGCTCGCCGACGAGA
+CCGAGAAGCGGCGCACGCTCTCCCGGATCGACCGGGAGAAGGTGCAGGCCAGTTGGGGTCTGGAGCAGAA
+GCAGATGGCCACCGAGGCCACCGAGCGCGAGCGCCGTATCCAGGCCGATGCCGCCGCCCGCGCCCAGCGC
+GAGGAGATCACACGGCAGGCCGGCATCGCGGAGCAGGCGGAGCGGCGCGCGCGGGCGCTCGCCGGGGAGA
+GGGCGGCCCTGGAAGAGGCCGCTGAACGCGAGAGGAAGGAGGCTGAACATCGCGCCGCGACGGTGAACAC
+GATCTTGGAGGCGCAGCGCGGAGCCGAGTCGATCGCCGTGTCGAAGGCCCGCGAGCAGGCCGCGATCGAG
+GACGCCGCCGCCCGCAAGGCGCGTGCGGCTGAACACGAGGCGGCGGCGGTTGAAGCCGCGGCGCGCGCCC
+GCATGACCCAGGTCGACTGGGATGTGCAGCGGGTCTCCGCGATGATCCAGGCCCGGGGCGATAGCGCGGT
+CACCGTCCGCGTCATCGCTGACGAGCTGGGCATCTCCACCGGCTCCGCGCAGGACCGCAAGACCAAGGCG
+CTCGCCCTGCTCAGGGGCGAGTCCACCGGCGATCTCGAGCGGGCTGCGGCCTGA
+>lcl|NZ_CM001166.1_gene_126 [locus_tag=STTU_p0126] [location=100826..102931]
+GTGGCAGACACCGCGACCGCGACCCCTGAAACCACCGCCGACACCACCGGCGACGGGGCCACGGACACCG
+CCGAATACACCGTCGTCACCGAGCCCGAGACCACCACCGACACGGCCTCGGACAAGCCGAAAGCCAACCG
+GTCGCGGCCGAGGGCGATGCCGCTGCTGATCCACGGCGGCAACGCAACCGGAATCGCCGCAGGCGTCGCC
+TACGGACTCGCCGGAGTGCCCGGTCTCATCGCCGCCGGCGCGGCCGGAGCCGCGGTCGGCGCCGCCGCGC
+TGGCGGGCCGCAAGAAGCGCTCGAAGGTCTCCGCCGCCCGCACGAACGCCGCGAGCAACCGCTCCGGCGG
+CGGGACGCACCGCTCCGGAGGTGGCGCGGGCAAGGGCGGCCTGCTCGGACGCGGCGGCGGTCGCGGCCGG
+GGCGGCGGCGGTGCTGCTGGTGGCGGCGGCCGCGGGCCCGGGCGCGGTGGCAAGGGCGGCGGCTGGCTGA
+ACGGCTCCGGGTCAGGGGGCGGTGGGACCGGCACGAAGAACCGGCCCGGCGGCGGCAAGCACGGCGCCGG
+TGGCGGCGGGCGCGGCCCGGGAGGAACGGGCGGCGGCAAGCACGGCCGCGGCGGCGGCCTGGGCGGACTG
+CTCGGAGGTGGCAGGAACCGGCGCGGTCCCGGCGGTCCCAACTCGCCCGGCGCGAACACCCCGAAGGGCA
+CCGGGAACGGCAAGAACAACGGGGGAGGCAAGAACGGTCCCGGCGGGAAGGCCGGCGCCCACCAGCAGTC
+TCGCACCGGCAAGGCCTGGCAGACCCTCAAGGGCTGGGGCAACAAGATGCGCCGCAACAACGGCGGCACC
+TCGAGCTCCGGCGGCTCCGGATCCTCCGGTTCGGGCGGCGGCTCCAGCTCGGGCACCTCCGGCTCCGGCA
+CGAAGACCATCACGCCCGCCAAGACCCGCCTCGGTCGCGCCCTGCAGAAGATGCGCGGCCTCGCGAGCAA
+GCTCCGCCGCTCCAAGAAGAAGAGCGGCTCCACCAGCTCCGGTGGAAGCGGCCCGACCTCGGGCCGCTTC
+CACCGGATGCGCCGCCTAGCCGCCCGCAAGCTCGGGCACTGGCTGCGCTGCGCAGGCGCCGGACTCCTCG
+CCGGACTCGGAGGGCTGGCAACGCTGCCCCTCGGACTCCTGTGGGGACTGGCCCTGCTGCCGTTCAAGCG
+CCGCGACCCGCTCCACGGGTTCGCGCTGCCCGTCCGTGTCGCCGGACGGATCTGGCGGTTCTTCTTCCGC
+CGCTCCAAGGCCCGCCACGACAAGAGCGCCAAGGCGGACACGCTCAACCTCAAGGTCAACAACCCCAGGA
+AGGACACCGATCCCGTGACCGGACCCTCGCTCGCTGCTGGCACCACGGTGCTGGACGGCAACAGCTCCAA
+GTTCGCGATGGCCATGCGCGCCGCGCACGCCTCCTACACCGGCTACAGCCCGCGCAGCATGATGGAGGTC
+GCTGCCGAGTACGCCGGCCTGCCCAACGGCATCCGCGCCGCGGCCCTGGCGGTCCAGCAGATGGCCGTCA
+ACGCCGACCAGAAGTACCCGTGCAGCAAGAAGGCGCTCGCCAAGCTGAGCGAGGCCTGCGCCAAGCTGGT
+CGCCGCCGCCGCTCGCGCGGACGGCATGGTCGCCTTCTTCCGCATGGTCCACGCCTTCGACATCGAGCGG
+ATCGTCGCCCCGAGGACGAACGAGTGGATGTGGAACGTCACCCCGACCGGCTCCGACGCCGCTGAGGGCG
+CGATGTTCATGCCCGGCCGCATCGAGTCCGGGTGCGTCCTGATGGCCGTGCTCTACCGCACCTTCGAGCC
+GGTCCACATGATGCAGGTCGGCTCCGAGTTCCAGGGCATCGCCTACGGGCTCACCGCCCTGGCCGACTGC
+GTCCAGGCCCTCTACGAGCGCACCATTGCCCTCTACCCGGTCGACGACCGCGTCACCGACGAGATCGGCA
+AGCTCGTCTCGATGATCCGGGCCGCGTCCGACGACGCGGACATGGCCGCGAAGCTGTTCGTGGAGGACCA
+CAGCCGCGAGATCAGCCACAACACCAGCCCCCGCAAGGGCCCGGCTGCCGAGTCCATGTGGAACACCCCC
+CGCTGA
+>lcl|NZ_CM001166.1_gene_127 [locus_tag=STTU_p0127] [location=103080..105521]
+ATGCGTCACTGGGACTGGTCGCTGCCCAGCGGCCACACCACCTTCCTCGGATACGCCACCGAGACCGCCA
+TGACCACCGTCGCGCTCGCCCCGCTCACCGGCCTGCCCTGGCAGGCTGCCGCCCTCACCCTGGGCAGCGC
+GGCCGCCGCCGGCACCGTCCACGACCTGCGCGTGAGCACCACCCTGGGCACGCTCACCACCCGTGCCGTC
+TCCTGGCTGACCGCGTCCGCATGGGCGTCCTGGGCGCTGGCGACCGCGCCGCTGACCACCACCGGCTGGG
+CGAGCGGCCTGGGCCTGGCCACCGTCGGCCTCGCCGCCAACGCCTCCGCCAACCGCACCGAGAACACCCG
+CTCCGAGCGCAAGAAGCTCCTCAAGCTCCGCCGCAAGTCGGTCGGCATCCTCCTGGACTGGGAAGACCGC
+ATGAAGCGCGTCGCCCGCATCGAGGACTGCCACGGCAAGGACGTGCAGCACTGGCCCGGCGAAGTCGGCT
+ACACCGTGGAGATGGACCTGCCCGCCGGCGGCACCAACGTCGACGACCTCAACGGCTACGGCCCGAAGTT
+CGCCAGCGACCTGCGCCTGCCCGACGGCTGCGGAGTCGAGCTGTTCCCCGGTGCCAACCGCGGCACCATC
+CTGATCGAGGTCACCCTCAAGGACGTCATCACCGCCGACATCCCTTACCCCGAGGACTACTCCGAGATCA
+GCCTCACCGAGCGGTTCCCGTTCGGCGTGTACCGCAACGGCGAGCCCGCGCTCGGCAGCCTCTGCAACGA
+CTGCGGGATCCTCGTGGGCGAGACCGACGCGGGCAAGACCAACACCCTGCGCGTCGTCACCGCCCAGCTC
+GCCCGCATGCCCGACGCGCTGATCTGGGCGATCGACACCACCGGCGGCGGCGTCGCCCTCCCCTGGATCA
+CTCCGTGGGCCACCGAGGGCATCGCGTCCGCGCCGATCGTCGACTGGATCGCGCACACCGAGGACGAAGC
+CCGCCTCATGCTCAAGATGGCCGCCGAGATCATCGCCGCGCGCAAGGCCGGCTACCAGCAGCTGATGCGC
+GAGAGGAAGACCGACAACAAGCTGCCGATCAGCGCGGAGATCCCCGGCATCGTCATCATCACCGACGAGA
+CCGCCTCCCTGCCGTACGACATCAAGGAGATGATCGACAAGGTCGAGCAGGAGGGCCGCGCGATGCGCGT
+GCGCGCACTCGTGGCCGCCCTGCGCGCCACGCAGGACGCCATCACCGCGATGATGAAGCTGATGTCGAAG
+TGGCGGGTCGGCATGACCGTCTCCGACGCCGAAGAGCTCGCCTACCTCTTCCCCGGCTACATCAAGATCG
+ACCCGAAGGACGCGCCCGTCGCAGGGTCCGGGTGGAACATGCACACCCGCCTCGGACCGAAGAAGCCGAC
+CGCGATGAAGGTATGGCGCCTGGTCGACGAGCTGATGGACACCATCTGCCAGGCCACGGCCGGGCGACGG
+CCCAAGCTCGATGAGCTGTCTGCCGCGGTGGACAGCGGCGAGCACTACCCGCAGCGGTGGGCGCGCACCC
+TGCCCGACCTGTACAAGGGGCAGAAGCTCACCGAGTCCGCGCAGTACGCCGTCGACAACGCCGGTGAGAT
+CATCGCCGCCGCGACGCTGCTCGCCTCCGACCCGGTGCCGCAGGGCAGCAGCATGGCGTCGCCCGCTCCG
+GTGGTGCCGGCCGGGTTCGAGGGGTTCGGCGGTGCAGAGGAGCTGTTCGCAGCCGTCACCGCACAGCTGG
+ACCCGAACGCCGCGCACCTCGCCGTCCCCACGGCTCCGGCCCCCACGCCGGCCGCCGCGCCGACGGCACC
+GGCCCCGCTCCCCCGCCCTGCCCGCCCGGTCGATCCGCGCGAGCTGGGCTGGGAGCTCCTGGCCGCCGCC
+GGGGCGACCGGCTACACGCCCAAGCTCCTGCACGAAGCCCTCGCGGCGGAGATGGACCGGCGGAAGGTGG
+GCGACGCCCCGGCACAGCGCACGGTCGGCGGCTGGCTCCAGGCGTGGGCGAAGGACGGCAAGGCCATCAA
+GGACGACTCCGGGCAGTACACCCGCTACGTCGCCCGCGAAGCCGCGGTCGGCCCGGCCGTCTCCGGCCCG
+GCCACCCCGGCCGGGTCGGAGACGGCACCCCTGCCCGAGGGTCTGGACGCGGCCCTGGTCCTCCAGGCCG
+TGGACTTGGTCGTCTCCACGCAGTTCGGGTCGGCGTCGATGCTCCAACGCAAGCTGCGCATCGGCTTCGC
+CCCCGTCCAGAACCTGATGGACTTCCTCCACCAGCTGGGCATCGTCGGCCCGTCCGACGGCTCAAAGGCA
+CGCGAAATCCTGGTCTCGACGGCAGACTTGGACGCGACCATGATGAGGATCGCCGACGAACTCGGCTACA
+CCACGCGCGACTTGGGCGCGATGGGCCTCGCGGCGGCTGCCGCTTCGCATGCCAAGGAGTGA
+>lcl|NZ_CM001166.1_gene_128 [locus_tag=STTU_p0128] [location=105526..105831]
+ATGGCTGAGACCGCAGACGAGGAGATCGAGCGCCTGGAGGCCGAACGGCACTCCTACAGCGAGACCTTCA
+AGAACACGTCCGACACGGACGCGGTCACGCGCGCGCACCTCCAGTCCGAGATGGACCGGCGCACCGACCG
+GATCCAGGAACTCCAGCAGCACCAGCCGCTCGGGTTCCTCGCCCGCTGGGGGCTGCGCGCCGCCTCCCTC
+GCCCTGCTCTGGGGCGCCTGGGAGGTCGGCCCCTGGTGGGCCAAGACCGGCTGCGTCCTGCTCGCTGCCT
+TCCTCGCCTTCTACAGCCTCGGCTGA
+>lcl|NZ_CM001166.1_gene_129 [locus_tag=STTU_p0129] [location=105943..106572]
+GTGGAACCCCGCGACCTCACCCTCACCGACCAGACCCCCGCCCCGCCCGCCGTCGCACTCCCCTACGAGG
+GCCTGGAAAAGATCTGGGAGCTGTTCCCCGACGCCCGACCCGGCGCCGGCGGCCTGCCCGCCCCCACCCC
+GCACACCGCCGTCGGCCTGCCCACCGACGAGGCGTACATGGCCCGGGTCTACGACCTGGTCCGCCGGGAA
+GAGGCACTGAACCACATCCGCGCGCAGTACCAGCAGGCCGCCGCGCACGTCGCCCTCGCCCCGGCCCCGG
+TCTACCCCCAGATCGTCGCCCAGACCCCGGCTCCCGCCCTGCCGCCCGCCCCGGCCCCCGAGCCCCAGCG
+CGCGGTGCCGGCGTACGTGTGGAAGTACAGCGCGCTCACCCTGTCCACCGGCGGCTGCATCGCGCTCACC
+GGCGTCGGCATCGGAGCCGCCGCCCCGACCCTCGCCCAGATCCCCGCCATCCTCACCGCGACCGGCCAGG
+TCCTGATGAGCGGGACCGTCCTGGTCGTCGTCGTCCTCCTGCTGCTCGCCCTGCGCGGCACCGGGGGCGG
+CGGCGGGCGCGGCGGCAACACCTTCAACATCCGCAAAGCGGTCTTCCGGCGCAACACCTTCCGGGGATGA
+>lcl|NZ_CM001166.1_gene_130 [locus_tag=STTU_p0130] [location=106667..107410]
+TTGGCTACCAACGACCCCAACACGCGCGCCGAGAACGACCTCACCACGAAGGTCGCGACGACCAAGACGC
+CCCCGCGCCTCAAGACCGCCCGCGCCTGGTGGACCCAGGCGTGGAACGAAGGCGGCATCCTGTACTCGCT
+GTGGGACGACGTCCGCCAGGCACCCGACGCCGGATGGCACGGCATGGCCAACTGGATCAAGACCGCCCTC
+GGCATGATCGCGTTCTCGTTCGTCGTGTTCCTCTTCACCGGCGCCGTCGACGTCCTGATGGACGCCGTGG
+ACCACCTCCTGACCGCCGTGCCCACGGTCCAGATCAGCGACAACACCTCCAGCGGCGTGTGGGCCACGAT
+CGACAACCCGATCCGCTCCTACATCGCCGCCCACAGCGCGGACCTGCCGATCAGCGGGGCCACCGTCTAC
+ACCCTGTGGCGGTTCACCGGCCTGTTCTGCCTGGTCGCCGGGTTCTTCACCCGCAACAACGGCGTCCGTC
+TGACCTGGACGGCCTGGGGCGCGGCAGGCATCGCGATGGTGTGGACGACCACCCCGGACACCAGCCGCAC
+CGTCGCCACCGCCGTCGCCCTGCTGGCCTGGACGCTCGCCTCCGCCTTCGCACTGCGCGGCCTCAACCTG
+CGCCCCCGCGTGCTCACCAACATCGGCGCACCGCAGATCACCGTCCAGCCCGAGATCCACGTCCCCGTCC
+AGCCCGGCCCCGCTGACAACGACAACATCCGCCACCTGCGCTGA
+>lcl|NZ_CM001166.1_gene_131 [locus_tag=STTU_p0131] [location=107521..108099]
+ATGGCCCTCACCCTCTTCACCCGCCGCCCCGAGCCCGCCCCCACCGAGGAGGTCCTCCACCCCGCGCGCT
+GCCCCGAGACCGGTGAGTCCTGGACGCCCGAAGGCGTCACCGTCGCCGAGCGCTACTACAACCTCGCGGG
+CGCGGTTGTCCTCGTCTACACCGCCGACACCTCGACGAGCCCCGGCACCTACTACGCGGTCGCCTGCCTC
+GGCTGCCACTACGCCACCCGCCAGGACTCCACGTACGCGCGCTACACCCTGACCGCCGCCGCGAAGGTCG
+CCAACACGCACGCGAGCAGCTGCCGGGCACTGCCCCGCACCATCCCCGCCCGCCCCGACGACGACACCGT
+CCGCGAACGCCTGCACTCCTGGGTGCGCCGCGCCCGCCGCCAGGACGAGGGCGTCCAGATTTGGATCCGT
+GACCTGGACCTGATGCGCCTCACCCTCCAGCGCACCACCAAGTGGATCGAGGCCGTGCTTCATCAGCTGG
+CCGAGGACCAGCCGGACGTCCTCTGGATCGCGCACAGCCAGTACAGCGACGCCGTCGCCTACTCCGCCCG
+CCAGCTCCCGGAGGCCTGA
+>lcl|NZ_CM001166.1_gene_132 [locus_tag=STTU_p0132] [location=complement(108317..109756)]
+GTGCTTCGCGCGGATCACGTGCTCCGGCACGCGGCGCTCGCGGGCCGCGTTGCGGGCGAGGCATTCCTCG
+AGCGGGGTGTCGAAGAGCACGGCGTGCACCAGACGCCCGTGGTGGCGGGCACGCTGCACGAGGAACGTGC
+GCGCGGTAGGGGCGGTGTTCGTGCTGTCGGCGACGGTGGTCAGCCCGCGTTCCAGGCGCGCGTCGAGGAC
+GATCTCCTGCATCGCGACGACCTGCGCGTTGGCGCTCTGGTCGCCCTCGTCGCCGGTGAGCAGGCCGCGG
+TAGGTGTCGAGGCAGATCCTGGAGGCCTGCGGGAAATGGGCCGCGGCAGTCGATTTGCCTGCGGCGGGCG
+CCCCGACGAAGACGATGAGGCTGCCGGGCGGGAAGCCCGCGAGCAGGCCCGCGCGGACCTTCGATGCCTC
+GCGTGTGGCGCGCTCCTCGTCCTTGCGGGCGAACTCCTCGTCGATCCAGCCCTGTACGGGAAGGCCGAGG
+CCTTCGGCGGCCGCGTACGGGTCGGTCATCTCCGGCCACTCGCCCTCCTCTTCCAGGGCGGCGGCGAGGG
+CTGTGGCGCCGTCCGGGTCGGTCTGGGCCAGGGCGGCGAGGGTGCGGTGCAGGTTCCACGCGGCAGCGCT
+CCCGGAGGCGTACGCCCACATCGTCTGCGGGTCGGGGGCGGCCGGGATGCGCATGGACAGGCGGATGTGC
+GCGTGGAGCGCGAACTCGTGCAGCGCGCGGACGTGATCGGTGGGCAGCTGTGTGTCGGACACGTTTTCTC
+CTCGCGTGAGGCGGCTGAGGGACCACCGCACTGCCCCGGCCCTGGAGGAGGGCCGAGGCAACACGGAGGC
+CCCTCAGCTGTGCGGGCCGGGAAGGTCGGCGGCGGCGTGCTGGACACGCGGCGGCGTGGGGGTGGGGTCG
+GTGGTGCCGTGGGCGACGGCTGCGAGGGTCCGGCTGAGCCGGTGTCCCTGCGCGACGGCGGCCTCCATGA
+GCTCGGTGAGGCGCGGGTCCAGGTTGTGGTGGCGGGCGCCGACGAGAACGCCTTCGAGGCGGGCGAGGTC
+GAGGAGGAGTCGGTCTCGGACGTCGAGGACGGAGGGCTGGAGGGACAGCGCGGTCGGGTGCTTCGCGATG
+GCGAGCGCCGCGTGGTCGGCGAATTGTGCGTTCGCGGTCTCGGTCTGTTCGGCGAGCGCGCTGTCGATCG
+CGCGGGTGGTGGTGTGGGCGCGGTGCCGGCCGAACCGGGCGGCGAGCGTGTCGAGGCGATGACGAGTGAG
+GGGCATGAGGGCTCCGGTGTTCGGGGCGGGGTGGGGCTCCGGGACGGCCGGGCGCTGGGCCTGCGGCCGT
+CCCGCACCGGTCAGCGGCCCGCGCGGCGGCGGGCGTCGGCGAGGATGCTCTGCGCGTCGGGGTGGGCTTT
+GACGGCGTTGGACAGCGCGTCCCACCACCGGCGGGCGTAG
+>lcl|NZ_CM001166.1_gene_133 [locus_tag=STTU_p0133] [location=109825..110112]
+ATGAGCGGCACCCCGAACGCCAGGACCGGGCAGGGCTGGGACCGGGCGGACTTCCGGTGCGGGCGGTGCG
+GCGCCCGCCGCACCGCGACCACGGAACCCGAGTACACCGCCGTTGTCGCGGCTCACCAGCACGCGCACGC
+GCTGTGGGACCGGCTCACCCCCGCCGAGCGGCTCGCGCTCACCGAGGCCACCCGACTCGTCCTCGGCGAT
+CTGCGCCTGAGCGCCGAGTGGCTCCACGTCGTCACCCTGCACGCCGAGCAGACCGCAAGGAAGGACCCGA
+CCTTCTGA
+>lcl|NZ_CM001166.1_gene_134 [locus_tag=STTU_p0134] [location=110112..110762]
+ATGAACGCCCTCGACCGCCTGATCACAGTGCTGCGCGAGCGCAGCACTGTCACGGACACCAACCCGCCAC
+GCGGCTGGGTCGTCCTCCTCGCGCCCGACGGGAGCCACCTCGCCTACCTGCCCCTGGCCGCCCCCGACAT
+CCTCCAGCTCGCCGAGGACTGCGGCCTCGACACCACCGGGGAGAGCGCGGACGCCGACCTGCTCTGGGAC
+GCCCTCGACGACGCCGCCCCGCCCACCCTCCTCACCGGGGACTGGACAGCGCTGCTCCGCGTCCACGACG
+GCACCAGCACAGTCGACGAGATCCGCCTGACCGACACCGAGCTCACCGACCTCGCCACCCTCCTCGACGA
+CAGCGCGCGCCGCCGCGCTGAGCGCGAGCAGCTGCACGCCGATCATCCCGAGCTCGTCGCCGAGGTCACC
+GCGATCGCGGCCTGGCCCGAGGACGAACTCTCCGCCGACATCACTGCGATCGCCGCCTGGCCGGAAGACG
+AGCTCGCCGCTGAAATCGAGGATCTCGCCCCGCGCAGTCAGAGCGACATCTGCGTGCTCTACGCCGAAGT
+CCTCGCCCACGGCCGCCGAGTGGCTGCGACCCGCGCCCTCGACGACTGGTTCGGCGCGGTCACCGACCCC
+AGCGACGAAGACCCCCGATAA
+>lcl|NZ_CM001166.1_gene_135 [locus_tag=STTU_p0135] [location=110812..111207]
+GTGCGCGTACACATCACCTCCTTCGGGCACCTCCACGGCCCCCGCCCCCAGGACGCGGACATCACCCTGG
+ACCTGCGCCCGTTCCGCGACCCACACTTCGACCCGGCCCTGCGCGAACTGACCGCCCGCGACCGACGCGT
+CATCAAGACGGTCCTCACGACCCCCGGAATCCGCGAGCTGATCGCGGCGACCGTGGCGCAGGCCCGCGCC
+TATGCCGCCGCGCCCGCCGCCCGCGAGCGGACCCTGCACATCGCGGTCGGCTGCTCGGGGGGCCGACACC
+GCGCCGGTGTCACCGCCCACGTCCTCGGCCGACGCCTGCGCCGCCGCGGCCACACCGTCACCGTCGTCGA
+CCGCGACTTACACCGCCCCGTCGTCGACCGCCCCGCCCCACGGTGA
+>lcl|NZ_CM001166.1_gene_136 [locus_tag=STTU_p0136] [location=111403..111768]
+ATGGAGCAGGTGATGCCCCGGGCCCGCCGGAAGCGCCGTCGCGAGGCCCGCCGCGTCCCGCGCAGCGACG
+CGCACCTGCCCGAGTACGACCGCGGGGACTGCCCCGAGGGCCTCCTCACCCGACGGCAGTTACGCGACCT
+GGGACTGAGCCCCGGCGGACACGGCCCGGTCGCGGTGCTGCGCTGCAAAGGCTGCGCCTACCGGCCCGAC
+CAGGCGTGCAACCACCCCACCCGGGCCTGGCTCTACAGCGTGGCGCTCGCCCGACCGAAGCGCACGCCGA
+CGCTCGCCCAGGAATGGGCCCTGGACAGAGCGATGGCCGCGAGGTCCACGTGCCCGGAATGCAAGCGCCG
+GTACTACTTCAGGTAG
+>lcl|NZ_CM001166.1_gene_137 [locus_tag=STTU_p0137] [location=111921..112982]
+GTGCTGAAGTATGCGCTCAGACCCAAGGCCCGTAGGTCAGCCGCCGTAGAGGCCCCACTCGTCGAGGCCC
+CCGTAGATGTGCGCTTCGAGGCATTGCGGGGCGTCAAGGCCCACGGCCTCACCCCGGTACACGGCGATGA
+GGGAGTCCTTGCCCCGCCACCACGAGTCGGTCACACCCTGTACTTCGGGTACCGGCTCGAATGCGCCGAG
+ATCCAGTGCGTCGACGGCCTTGCGCTTGACCCTCGTGACGGTCGTGGCCCAGCGGCGGGCATGAGCGGCG
+AGCGCCAGGGATTCCACCCATCCGTCAGTGTTGGCATGCAGGGGCGTCCACTGGTAGGCGTCGATGCCGA
+ACGCACCGTCGGGGCCGATCGCGAAGCTGTAGGCCATGGAAACCCGGCAGCCCCCTGCCGGGAACGACCA
+GCCTTCTGCGGGCATCTCCTCGGGGCAGTCGGCATCCAGGATGCGCGGACCGCCCTCGTAGAACGGGGCC
+GGCGGCAAGGCGAGGCCGCCCCAGCGGTCCTGGAAGGCAGCAGCCCGCTCGATCTCCGCAGCGGGGACCC
+CGTACTCGATCCACGCGTCGCGGTGTCGCCGGATGTCCGGCCGGCGAACACGTATGCCCTCCGTCTCGAC
+AAACCGCTGGGCCCTACGGCTCAGGCCGGCAGGCGCGACCGGGACGGACGATACGGGCTGGTCAGCCATT
+ACCGCTGCTCGCCGTCACCGGCGTGGAGCACGGCCGACGCAATCTCCCGCACGCGCTCCGGGCTGATCCC
+TGTGCGCTGCTCGACGGCGAGGGGGTGGTCGGTGGGCTCCAGCTCGACGAAGGGGCGCTCACCGACCGGA
+CGGGTATGGACGCGCGTCTTCAGGTTGAGCGTCGTCGCCGGGTATACCGGAAGATCGGTGGTGAGCCAGC
+CGAAGTACGGCTTCTCAGCCTCGCGGCCGGGCCTGTCCCACAGATCCGAGGCTTGGGAGAAGCTCTCTCG
+GCTGAGCGAGACCCAGACGCCCCAGGAGAACACCTCGGCACTGCCGATGACCGGTATCTCGATCAGGCCC
+TTCACGAAGTAG
+>lcl|NZ_CM001166.1_gene_138 [locus_tag=STTU_p0139] [location=complement(113383..113535)]
+GTGGTGGCCTTGGTGGTGGCGACCACGGCCGCGACCAGCACGGCGGTTCGGGCGCGGATGGTCAGGGCCG
+GGCGAAGGGGTGGACGAGCCACGGTGATTCTCCTTGATCAGGCGGCCAGCCGGTGGATGACCGGGGCCGT
+GGGGACGAAGTAG
+>lcl|NZ_CM001166.1_gene_139 [locus_tag=STTU_p0138] [location=113539..113889]
+GTGACCGGCCGCACCCGCACCCGCCTGAACCGGGTGCGCGCCTCCGTCGGCATCGCCCAGCTCGCCCTCC
+AGCAGATCGAGGACGACATGAGCGCCGACGACGTCGACGGCCAGGAGCTCGCCGCGATCCTGCGCGAGCT
+CCAGGAGGACGCCGACGTCCCCTGCGGCCTCTTCCCCGCCCTCGCGCAGCTGGTCACCGCCGCCGCACGC
+CGGGCGGAGCAGATCGAGCCCGACCGCGACGGCGACGCCTCCTGCCCCCTGCACGAGGCCGCCGCCCTGC
+TCACCGACAACGCCGGGCCCCGCCTGAACTGGGCGGCCCGCTCCCTCGACCCGCAAGGAGATCTCGCATG
+A
+>lcl|NZ_CM001166.1_gene_140 [locus_tag=STTU_p0140] [location=113913..114848]
+ATGCCCGAGCACAGCCTCGTGGTCCTCATCGGTGCGTCCGGCGCCGGGAAGTCGACGCTCGCGCGCACCT
+GGCCCGCCTCGCAGGTCCTGTCCCTGGACGCACTGCGGGAGGCCGTGGCCGACGACGCGGGCGACCAGGA
+CGCGACCGGCGACGCCGTCGCCGCCCTGCACCTGCTCCTGGAGGCGAGGATGCGCCGCCGGTTGTTCACG
+GTCGTCGACGCCACCAACGTCACGGCCGCCGCCAGGAAGCCGCTCATCGCCGCCGCCAAGCGCCACGACA
+TGCTCCCGATCGCGGTCGTGTTCACCACGCCCGGCAGCATCTGCATCGAGCGGCAGGGCCCGCGGCCGGC
+CAACCGCACGGTGCCGGAAGAGGTGGTTGCCCAGCAGCACGACGACATGTTCGCCTCCCGCCGCACCCTG
+CGGGCCGAGGGCTTCCCCGAGATCGTCTACTCCGACAGCATCTGCCGACTCGCGCCGTACCTGGAGCGCC
+TGAGCGAGAGGCGGCAGGCCGACCTCGGGCTGGACGGTGGCGCCGGCCTCGGTGACCTGAACCTCGTGGC
+CCGGGTGTTCGGCGAGAACATCCTGCCGCTGTGGCAGTGGAAGCCCGGCTCGAACATCGCCGGCGGCGAC
+CGCGTCGCGGAGATCCGCCTCGGTCAGCAGTACCTCACCCTCGCCCTGCGCACCGACGTCGACGGCGAGG
+GCGACGTCGGGTTCGACGTGATGGTGCCGTGCCCGCACGACGACGAATGCACCGGCCACGCCTGGGTGCC
+CGCCTACAGCGTCACCTGCCTGTTCCGCGCGCTCAACGGCGACCTGGACGACGACGAGGACATCGTCTGC
+ACCGTCCACGGCCCGAACACCGACGAGGACCAGGAGGACGATCCCGAGGGCCGCGCCGACCTAGAAGAGC
+AGTTCGCGACTGCGGTCCGCGAGTGA
+>lcl|NZ_CM001166.1_gene_141 [locus_tag=STTU_p0141] [location=115076..115849]
+ATGGCCCGCAAGCCCATCACCTGGTACATCGCCACCCCCACCGACGGCACCATCGAGATGTCCCGCGAGG
+CCGGAACCCCGGTGGACCTTTCCGTCAACGTCGGCAAGGCCATCGACCACCCCAACCCCTGCCGCAACAA
+GTGGTACGACGAGAGCGGCTTCTCCTACTTCCGCATGGTCAAGCGCGTCGGCGAGGCGCTGGAGGACACC
+GGTATCTGGCCCATCACCTGGCCCGTCCGGTTGTGGATCGTGGAGCCGCTCGGGGAGACCGGCAACTGGA
+GCCAGCGCCACTACCCCTACCGGCTGCTCTCCCACCGGATCCGCGTCCTCGAGGAGACCGACGCCCACCG
+CGCGCTCGGACCCGCCGGCCTCGACGTCCTGAACGTCGTCCAGCAGGAGATCCCCGAGCGGGCCGCACGC
+TGGGCCGCGGACTGGGACGCCGACCCCGAGGGCATGCGCGTCCGGACGTGGAACTGGGAGCAGTGCGGCG
+GTCCCACCTGCGGCAGCGGCCGATGGGCGGACGAACTCGCCATGGCGGTCTCGCACAACCGCCGCGAGTC
+GGGCGCCCAGACCTGGATCGAGCACCTAGCGCGCAACGCCGTCGACCAGGCCCTCGCCGACACCGACGCC
+AGCATGACGGCCCGCTGCTACGCCTACGGCCGCGCCACCGGCCACGCGGTAGCCGCCCAGCACCAGAGCC
+GCTTCGAGCCGTACGTCCTGGACGCGCTGCGCGGCGTCGGCCTCGACTCCCCTGCCCCGGCCGTGGCCGC
+CTGA
+>lcl|NZ_CM001166.1_gene_142 [locus_tag=STTU_p0142] [location=115981..116658]
+ATGGACTCCGTCCTGCACACCACGGGCCGCTTTGGCCCACGCACCCTCCTGATCACCGCCGCTGCCGTCC
+CGCTGACCGGCTGGGCCGTCCACGCGACCGTGCTGCTCAAGCAGATCGCTGCCAAGGAGAAGGACCCGCT
+GACCGGGCTGCTGCGCCGCGACACCTACACCGCCCGCGCCCGCCGGATCCTCGCCCGGCACGGTGACAAC
+ACGACCGTGGTCATGGTCGACGCCGACCACTTCAAGCAGATCAACGACCGCGACGGCCACGAGGCGGGGG
+ACGCGGTCCTCGCCGCGCTCGGGCAGCGGCTCACGGCCTGGGCCGGTCCGCGCGCGGTGTGCGGGCGCCT
+GGGCGGCGACGAGTTCGCCGTCGCCCTCCCCCTGCCCGCCGAGCACCGCGCCGAGCGCCTGGAGCAGCTC
+GTGCGGGCACTGCACGCGCCGGTCCGCCTCGACGACGGGCGCCTCATCCAGGTCGCGGTCTCCGTTGGCG
+CCGCCACCACCGACACCCTCCACACCCGCGACCTCGCCGCGCTCCAGCGCGCCTCGGACGCGGCCCTCTA
+CGACGGCAAGCACACCGGCCGCGCCGTCCTCGCGACCACCGCGCACACCCGCGTCCCCTCCATCAACGGG
+CGCAGGATGGGCCGTCCCGGCACCAGCGTGTGGGGGCAGGCCGCATGA
+>lcl|NZ_CM001166.1_gene_143 [locus_tag=STTU_p0143] [location=116768..117376]
+GTGGTGGCGCGGATGGTTCCTCATCCACGCCGGCCGCGGCACCGACCACCAGGCGCTCACCGACCCCCGC
+GTCACCTGCACCTTCCCCCGACAGCCGCTGGAGTTCGGCGCCGTCCTGGCCGTCGCGCGCCTGACCGACT
+GCCACCAGGACGAGCCCGGCCGCGCCTGTTCGGCGTGGGCCGACCCGGAGGCGTGGCACCTCACCCTCAC
+CGACGTCACCCCGCTCCTGGAGCCGATCCCCGCGCTCGGCCGCCTCGGCCTGTGGCGCCCCAGCTGCGAG
+CTCACCGCCCACGCCCTCGCCCAACTCCCCCACCTGAAGCCGTGACGCGCGCGAACCGGCCGAAACAGCT
+GTGGGAGCCGGGTCTCATCCCGGCTCCCGGCGCCCTCCTGGACTGGCGCGACGCCCGCCACCACGACGCC
+CGCAACGCCTACCCCTGCACGCTGTGCGGCCACCCCACCCACCTGCGCTCCCACACCGGCGAACCCGCCC
+ATAAAACGTGCGCCGAAACGTGGATCGCCACCCACTACCCCGAGGCCCGCCGCACCGCGCGCTTCGCCTC
+CGACCCGGCCCCCGCGCGCCGCTCCGATGCCGCCGACGACCACGCCTGA
+>lcl|NZ_CM001166.1_gene_144 [locus_tag=STTU_p0144] [location=117396..117572]
+ATGCCCGTGAACCACACCCCGCGCGCCGACTCCGACCGCGCCCTCGCCTACCCCGAACCCCCCGCCACCT
+CCACCTGGCACCACACCACCACGCCCCGCCCGCGCACCCGCAAGCTCACCCCCGAGCAGCAGCGCCACAA
+CCGCGAACGCCTCCAGCACGAGCTCAGCGCGAAGTGA
+>lcl|NZ_CM001166.1_gene_145 [locus_tag=STTU_p0145] [location=117578..118447]
+GTGTACGCCGACCTGAACCCCGCCCAGACCGCCGAAGCCCTCGAACTCACCCCACCCAGCCCCGACACCG
+AAGCAGCCGCCGCCCGCACCGTCGCCCGCCACGCCCACGGCAAGGAGGACCTCGTCCTCCTCCTCGACGC
+CCTCGGCCTCCCCCACAACGACGACACCCTCACCGCGCTGTTCCCCCTCCTCACGGAAACCGGAGCCACC
+CTTCCCATGACCGCCAAGAACCCCGCCACCGTCCTCGCCCCCGCAGTCGATATCGCGGCCTTCGACGCCG
+CTCCCGCTCCCGCTCCCGCTGGCCGGAGCGTGTCTGCGTTCGAGGCCATGGCCCTCTCGATGCACACCAA
+CGGCGACAGCATCCAGGGGATCTGCGCGGCCACCGGCCTGAGCGAGACCGAACTCAGCGACCTCCTCGCC
+GCCCCGGCCACCGGTACCCCGGACGTCGCGCTCGCCGTCACCCCCGAGATCCAGGAACTGCTCGACTGGG
+CGGCCGCGCACCCGGCCGCCTCGGTCCGCAGCCGCGCCGCCCGCATCACCGCCGACCTGGCCGAGCTGTC
+CGAGCGCCGCGACAGCGAGGCCGCGCAGCGCGAGGCCGAAGCGAAGGTCGCCAGGGCCAAGGCCGAACTG
+GAGAAGGCGCAGGAGGAGCTGCGCACCGTCAAGGCCGGCACCCGCACCACCACGGCGGCCGCCGTGGCCG
+CCCCGATTCGCGCGGCCCTCGGCAGCGGCCGTACCCGGGAGGAGCTCGCCGCCGTACGGGCGTGGGCGCG
+CGAGAACGGCCATCAGGTCGCCGACACCGGGATCGTGCCCAAGCGGGTCCTTCAGGCGTACGACACCGCG
+CACCGGGCGCCGGTCCGGAAGGCCGGCTGA
+>lcl|NZ_CM001166.1_gene_146 [locus_tag=STTU_p0146] [location=118450..118932]
+ATGACCGACGACGCGATAGCCCTGGACGAGGAGACCGTGCCCGGCGACCTGCACGGATCGACGGCGCGGT
+TCCGCCTCACCGTCTCCCCCACGGACGAGCGCACGGACGAGATGATCCTTCCCTGCAGCGTCACCGACCC
+GGCGCTCGCGCACACCGTCATCCACGACCTGGTCCCCGGCGACAAGCTCCGCGTCACCGGCCACCTCCGG
+CTGCCCCGCACGCCGGACGAGCCGATGCGGCTGGACGTCACCGAGCTCGCCGTGCTGGAGACCGCGCCGG
+AACTGTCCGACCCGGCCGCCGTCACCACAGCCGTCCTCGAGCGGCACGGGCCGTACGTCTGCTGGTTCGA
+CGCCGAGAACTCCGGTGAGATCCCGGTGTGGACCGAGGCCGGGGTCTGGGTCGGGCACGCCGGTGACCCG
+GACGCTCTGGGCGAGCTGATCGAAGCCTTCGAGCAGCGCCAGGCCGCCAGCGGCGAGCAATAG
+>lcl|NZ_CM001166.1_gene_147 [locus_tag=STTU_p0147] [location=118943..119410]
+GTGCCCATCCGTCCCGAGAACCTGCACCGCTACCCGCGCAACTGGCCCCAGATCAGTGCGCGCATCCGCT
+TCGAGCGGGCGGGCGGCCGCTGCGAGTGCGAAGGCCAGTGCGGCCTGACGCACCCGGGCGGCCGCTGCCC
+CGCCGTCCACGCGGAGACCCACCCCACTACCGGGTCCGTTGTCTGCCTCACCACCGCCCACCTCAACCAC
+ACACCCGAAGACGTGCGGGACGAAAACCTCCTCGCCGCCTGCCAGCTCTGCCACCTGCGCATCGACCACG
+GCCACCACCAGGTCACCCGCGCACGCACCCTCGACGCCCGTACGGCGGCCACCGGACAGCTCGGCATCCT
+CGACAACGCCGACCTGGTCCGAACCGAACCACCCACCCCGCCGCCCCGGCCGCCCGCACCCCGCACAACA
+CCCGCCGACCGCCAGCAACTCACCCTCACCGACCAGGAGGCCCCCTGA
+>lcl|NZ_CM001166.1_gene_148 [locus_tag=STTU_p0148] [location=119410..119592]
+ATGCCCAAGCAGCCCCAACCCCCGCGCACCGTCCTGGAGCGCTTCCCCGCCGGAGGCCCCCGCGGCTCCT
+GGCCCGCCGAAGCGTTCGCCGCCGCCCAGCGCGCTCAAGGTGCGCGGGTGCAGGTCGTCATGGACCTGCA
+CACCGACCAGTTCCTCGTGGTCACCGACACCACTACCCACTGA
+>lcl|NZ_CM001166.1_gene_149 [locus_tag=STTU_p0149] [location=119615..120034]
+ATGACCGAGACCGAGACCACCCGCTACACCGCCGACGTGGTCGCCCTGACTCCCGACGGCAACGTCCTGC
+TGATCGAGCGCGACTGGCCGCCCTTCGAGGGCGCCTGGGCGCTGCCGGGTGGCCACCAGGATGAGGGGGA
+GACCAGCCGCATGGCGGCTGCTTGGGAACTCCTGGAGGAGACCGGGGTCCGCGTCGACCCCGACCAGCTG
+CGCACGATCGGCACATGGGACCAGCCCGGCCGCGACCCGCGCGGCAGGTACAGCACCGACGCCTACCTCG
+ACGTCGTCCCCACCGGCACTCCGATCACCGCCGGGGACGACACCCGCACCGCCCGCTGGTGGCCTCTGGA
+CGCACTTCTGGAACGGCTCGCGTTCGACCACGCCGACATCCTCCACGCGGCCACAGCGTCCAGCGCCTGA
+>lcl|NZ_CM001166.1_gene_150 [locus_tag=STTU_p0150] [location=complement(120628..120876)]
+GTGGTCGTTTTGACGGCGCTCCACACGGGGCAGGAGCGGTGGATGAGTACCGCCCGCCGCCGCCTGGGCA
+CAGGCCCCCAGCCCGGTGTCCCGTTCTTGCTGGCCAAGAGGGTCGCGTCGGATGTTGAGCCCCGCATCCC
+TGCGGAACGGCTCCTCGACGTGCCCGAGGCGGTCCGGGCCGCCGCCACCCGCGCGGTGGCGGACGGGCGC
+CGTGTGCTCGGCACGAGACCGGCCCTCCTGAAAACGTGA
+>lcl|NZ_CM001166.1_gene_151 [locus_tag=STTU_p0151] [location=complement(121090..121260)]
+GTGACCGACCTGGTCGGCGGGCTGCGGGATCACGGCACGGATGCCTCGCCGCCGGAGATGCTCACGGATC
+GCGCGGGATGCATACGCGCGGTCCGCCAAGACGGCGTCCGGCCGGGCAAGACCCGGGCCGAGCCGGCCGC
+ACCCGTTGGCAGGCCTCCCGTCACGCTGTAG
+>lcl|NZ_CM001166.1_gene_152 [locus_tag=STTU_p0152] [location=121517..121978]
+ATGGTCTTTCGACACCCCGACGGCGACTATGCGATCACCGCAATCTACTCCGTGCCCGATGACGCCTGGC
+ATCTGGAACTGGATCTCGTGGCCGGGCAACGGAGTCTCGTGACCGCAACCACCCCCGACGAGGATCCGGC
+ACGGGAGCCGACAGTGCGCTTCAACCCGAGCGCAGAACACACCGACGTCCCGTACGAGGTCATGCGCTGG
+TTCATGCACCAGGTTGATGAAGAGATCCGTAGCTCCCGTGCCTGGATGCGGCTGAGACCGGAGCTCGTCG
+AGATCGTCTATCAACTACGTCAGGAGCACATGGGTGTCATCGACGATGACGCCTTTCCCCAGGTTCTGGC
+GGACATGCGTACCACGGTGCCTGAGGAGGACCTCCCCGCCGTTCTAGAGGCCGCCTTCGGGCGGAACCCT
+GACGGCACCACCAAGACCACCCGCAAACGCCCCAGCCTGTAG
+>lcl|NZ_CM001166.1_gene_153 [locus_tag=STTU_p0153] [location=complement(122106..123047)]
+GTGCCCTCCCCCACCGAGCTGCCCCCTCACCGGATCAGCCTGAACCCGGACAACCCGCGCTCCTCCCTCG
+GCGACCTCACCGACCTCGCCGGAAGCCTCAAGGACCACGGGCAGAAGCAGGCCATCACGGTCATGAACCG
+CGACGCATACATCGCCGCGAACCCCGCCGCCGAGGAGAAACTCGAACCCGACACGGCATACGTCGTCGTC
+GACGGCTCCAGCCGTCTCGCAGCAGCCCGCGAAGCCGGCCTCACCACCGTGAAGGTCATGGTCGACGACG
+GCCAGGGCGGCACCAGCGAAGAGATCCTCGAATCCGCCCTCGTCGCCAACATCCACCGCCGCGAACTCTC
+CGAACTGGACGAAGCCCGCGCCCTGCAACGACTCCTCGCCCTCCACGGCTCACAACGTGCCCTCGCCGCA
+CGCCTGCACCGCTCCCAGCCATGGATCTCGACGCGCCTCGCACTCCTCGGACTCTCCGAAGAGATGCAGA
+ACCTGGTCGGCACCGAGAAGATCGAACACCTCCGAGCCATCGGCAACAAACCGGCCGAGGAGCAACCCGC
+AGCGCTCCAGGCGCTCAAGGACAAGGAATCCACGCAGCGCACCGTGCGGAGCCGGAAAGGTGCGGCCACC
+CAGGCGGCCGACACGGGGGAGCGGGCCGAGAATGATTACGGCGTAATCGCCTCACCGAACGTGCCCGAGA
+GCAGAAAACAGCCGGCGCATGATTACGCCGTAATCACCTCCGCCCCCGCCTCATCATCCGAACCGCCTGA
+GTCGTCGCAGCCGCCGCGCCCTCCACAGCCCGCAACTCCCCGCACAGCGCCAGCAGCTCTCATCCCGGTC
+ACAGCGATCCCATGGCGGCACGTCAACGTTGTCCACCGGATCCTGCGGGAGCACATGACGCCGGAGGACT
+ACAAGGCGCTCCAAGAGCTCATGGCCACATGA
+>lcl|NZ_CM001166.1_gene_154 [locus_tag=STTU_p0154] [location=complement(123155..124420)]
+ATGGTTAGTAACATCTCACCCATGAGTCAGCCCAGCGACCGCGAAAAGGTCGTCTCCAAACTCCCCGCCA
+GCCTCCGCCAACAACTCAAGATCCGTGCGGCACAACATCGCCTCGACATCCAGATCGCCGTGGAACAAGC
+CATCCACGCCTGGACCGCCCTCGCCGCCTCCCCCGCAGCCGTTGACGTCAGCGGCGCCAGCTCCTTCGCG
+ACCTTCCTCCCCCCGGGCCAGTGGGACACCTTCAAGAAGGCTGCCGCCGCCCGTGACGTGACTCTTACTC
+AGGGCCTGGCACAAGCCGTGCAGCTGTGGCTCGACATGAACCCCTCCCCCGAGGTCATCCGTCCAGAGAC
+AACCCGCCGCATCATCGTCTGCAACCAGAAAGGCGGTGTCGGCAAGACCGCCATCACGGCAGGGACAGGA
+GAAGCCCTGGCCGAGAACCCTGACACCCTGCGCCCGGTACGAGTCGCCAAGCAGCTCGCCGCCGCACAAC
+TCGCATCACCGGAAACTGACGGCAGCAGCGACGCGCTCGAGGTAGAAAACCTCCCCGGCCTCGGCTTGCG
+CGTCCTCCTGATCGACTTCGACCCCCAATGCCACCTCACCCGCCAGCTCGGCGCCGAGCCCCTCCCCCTC
+GACGGCGACAGCCTCACCAAGCACATGGGCGGAGAGGCAAAGGGCGAACTCCGCGACCTGATCGTCGCCG
+TCGACCAGGAACACTTCGGCGACCGGCTCCACATGCTGCCCGGCTGCAACGACGCCTTCCTCCTCGACGT
+CAAACTCGCGTCCGTTCGCGCCAGCGAGAAAGCCCTGGAACGAGCCCTCGCCCCCCTCGAAGGTGATTAC
+GACGTAATCATCGTCGACTGCCCACCCAGCCTCGGCCTCTCCATGGACGCCGCGATCTACTACGGCCACC
+GCCGCGACGGCGAAGCCCCCGGACAGTCAGGCACCCTCATCGTCGTCCAGGCCGAAGACAGCTCCGCCGA
+CGCCTACGACATGCTCACCACCCAGATCGACGACCTCCGCAGCGACCTCGACGTCGTCATCGATTACCTC
+GGCATCGTCGTCAACCTCTACGACGCCCGCCGCGGCTACATCGCCACCAGCTCCCTCCAGGGCTGGGTCG
+ACATAAAGGACCCCCGCGTCGTCGGCCTCGTCGGCGACCTCAAGGAGCAGAAGGAAGCCGTACGCATGCA
+ACAACCGCTCCTGTCCTACTCCCCCACCTGCACACAGTCCGTCGCCATGCGCGCCCTCGCCCGGGAGCTC
+GCATGA
+>lcl|NZ_CM001166.1_gene_155 [locus_tag=STTU_p0155] [location=complement(124906..125775)]
+ATGAGCGAGCTGCCGAGCGTGTGGGACCTTCTGGGGCGTCTGGGCCTGGCGGGCGGGGTGGTGGTGGGGG
+TGGTCGGCGCCGTCGTCCTGTCGCTCGTGATCGTGCCCGCCGAGGACTTCAACCGCGGTTTCGAGACGGG
+CGTGCGGGCAGTGGTGCGGTACCTGTCCGGCCGCGAGCTGGGCAGCGGGACCGCACCAGGTGACGCGACG
+TGGTGGCGTCCGGCGACGAACGAGGCCCCGGCGCCGCCCCCGAGGGCCCGGCCCCTGCGGGCGGCTGCGA
+CGGCGGTGAAGCGGTGCGCGGTACGCGCGAGGACGTCGGGAGTTCGGTACGGGCGGCGGGTGCGGGGACG
+GGTGCGCGAGCGGTTCCCGGACGTGCTGCGGGCGGCGGGGCGCGGGGTGAGGTCGGCGGCGGGAGCGGGC
+CGGGCCGCGCGGTCCCTCGCGCAGTGGCCGGCACTCGGACGGGCCGTCGCCCGGACGCTCGCGCGGAGCG
+GACCGGCGGCATGGGCCGCAACGGCGGCGGCCGGGGCGGCGTGCGGGCGCGGGGCGGGCCGGGCCGGGCG
+GTGGACGGTGCGGGCCGGGCGGGCGGCGTACGCGGCGGCGGTGCGGTCGGGACGTGCCGCAGGGCGGGTG
+GTGAGCGGCGCGGCCGTGGGAGTGGTGCGGGTGCTGCGGGCGTGGGGGCGGTGGCCGTACGCGGCGCGCG
+CGGCCGTACGGATCGCGCCGGGGGTGCTGGCGTGGGGGGTGCTCGCGGCGCCGGGGACGACCCGCGCCGT
+GGTCCTGGTGCTCCTCGGCGCCGTCGTGCTCGCAGCGCTGAGCGGGCCGTCAGGGGCCCGGTGGTGGTGT
+GTGCCCCCGGCACGGGAACGGCGCGCCTAA
+>lcl|NZ_CM001166.1_gene_156 [locus_tag=STTU_p0156] [location=125923..127152]
+ATGGACGGCCCGACCGAAGAGACCCTGTGCGTGGACGGCGCGCGGCTGCGGCGCGCGCGCGAAGCCCGGC
+ACCTGACGCGCCCGCAGCTCGCCTCCCTCCTCGGCGTGGGCCCCGACTGGGTGAAGAGGGTGGAGACGGG
+GCAGCGCACCGAGGACAGGCTGCCGACGCTCTACCGCCTGTGCCGCGTCCTGGGCCTGACCGACGTCGCG
+GAGCTGACGGGCGGGCAGACGTCCATGCCCGTGGCGACCGGCGGGCGCCTCGCCCACCCCGGCGTCGAAG
+AGCTGCGAGCCGCGGTGCACGCGCCGCTCTTCGTTCAGGAGGAGCCCGAGGACGTCGGTGTCCTCGCCGG
+GCGGGTCGCCCGGACGTGGGCGATCTGGCACGGAGTGCGCGAGCAGCGCACCGCTGTCGCAGCCGTACTT
+CCCGATCTCATCCGCACCGGGCACGCCACGATGCGCGCCGCCGAGGGCCCCGAGAAGCGCCGCGCCGCCG
+TGGTCCTCTCCGAGGTCTACGCCCTCGCCCAGCAGTACGCCGCGCACATCGTCGACCCGCCCCTGTACTG
+GACGTTGGTGGACCGGGCCCGGATGCTCGCCGAGACGGCCGACGACGTGCTCGCGCTCGCGGGCGCCGCC
+TGGGTCACCGGCAACGGCTTGCGGGCGGCGGGGGACACGGAGGGCGCGCGGCGCGTCGCGGCCGACGCCG
+CCGAGACCCTGGAGCGCAGCACCGAAGACGGCTCCGACCGGCTACGGGGGCTGTACGGGAGCCTGTGCCT
+GCACGTGGCCCTCAGCGCCGCCCAGGAGCGCCGCGAGGGCGACGCGTGGCACTGGTGGGACAAGGCCGAC
+CGCGCCGCTGCCCGCCTCGGCACCGCGTACATGCACCCGTGGACGGCGTTCGGCGAGGGCAATGTCGCCG
+TGCACGGGGTGAGCATCGCCGCCGACCTCGGCGCCCACGGCACCGCGCTCCAGCGCATGACCGAGGTGGA
+CCCGGAGACGATCCCGAGCGTCGAGCGCCGCTCCCGCTTGTACCTCGACGCCGCGCGCGGCGAGCGCGCG
+CGGCGCCAGGTCGCCGCCGCCCTGACGTACCTGCGTCTCGCGGTGGCGACCTCGCCGGAGGCGGTGCGCT
+ACGTCCCCGCCGGGCGCGCGCTCGCCGAGGACCTCGCTCGTACCGCCCCCGCGCCCCTACGCCGGGCCGC
+GCACGAGGTCGCCTCACTCGTCGGCGTGCCCGTCGAGTAG
+>lcl|NZ_CM001166.1_gene_157 [locus_tag=STTU_p0157] [location=127261..127503]
+GTGACGGGCTCTCACGCTGAGAAGGTGCCGAACCTGGAGTACTACACCGATCTCCCGCGCGCGCTGCGCC
+GCCCCCGCCTCGACGCCGACGGGGAGCGCTGGCTGCCCGTCGCCGTGACGAAGGAGTGGCACAAGGAGGG
+GGAGGTCGTCGTGGTGTTCCTGCGGCCCGCACGCGGGGGAGGGCGCGAGTGGATCGTGCCCCTCCCCGAC
+CTGGACACCCTGACCCGGGAGGCGACCCCATGA
+>lcl|NZ_CM001166.1_gene_158 [locus_tag=STTU_p0158] [location=127656..128237]
+ATGGTCACCCTCGGCCGCGCCCCCGCCATCACGGCCCTGCGCCTCGCCGCCGTCCTCACCCACGCCGCCG
+CCGTCCTCCCCGACCTGCGCGCCGACCGCGCGGAGCCGGGCGAAGAGGAGGACGCGGCCGACGCCGTGAC
+CGCGCTGCGTACCGCTCTGGACCGGGTGGGCCTGCGGCTGCCCTCTCTGGGCGCCGAGCGCCCCGCTGCC
+ATGGGCACCGCCATGGTCGCGCTCGGCGGTGCCGCCTCCGGCGTCGCGGTGAGCCTCGCGGACGTCCTCA
+CCCGCACCGCCGACGCCGCCCCGGTCCTGCGCGCCGACGCCGCCGAGCCCCCCGGCGCGGCCCGGGAGTT
+CTGGCCCCTGCCCGCCGTCCTGCTCCGCGACGGGCACTGCCTGCGGTACGGGGGCGTCACCCGCGTCGCC
+GCGCAGGCGCCCCGGCTGCCCGCCCCCCGCGCCTCCACCGCTCCCCGGCTCGAAGTGCGCTGCGTGGACG
+GCACCACCCTCCGCATGTCCCCCCGGGCCGCGCTCGACGTGTACCTCCCCCTCGCGTGGCGGCTCTCCCT
+CCAGGACGGCCCGCGCCCCTGA
+>lcl|NZ_CM001166.1_gene_159 [locus_tag=STTU_p0159] [location=128381..128956]
+ATGCCTGAGCGGAACATCGAGTTCGGCGCGTACGGCGCCCAGGGCGTCAAGGGCCACGAGTTCGTCGCCC
+GCCGCCTCGACAGCCTCGCCGGGTTCATCGCGTCCCCGGTCACCACCCGCCGTGGCCTGACCGCGCGGCT
+GCGCTACCTCACGAGCAGTGCCCGCCAGCTCGCCGCCGCCCGGGAGGCCGGGCTCACGATCTCGGACCGC
+ACGATCAAGGCGCAGATGCAGGGCACACGCCGCCCCTCCGCCCGTACGCTCCGCGAGATCGACGCCACTT
+ACCGCGCGGTGCGTCGTCAGAACGTCTCCCGGCACCTCCTGGCCCGCCTCAACCGGCAGGGCCGGGGGAC
+CCGCGTCGAGTTCCACCCCGTCAATCAATCCGGGGTGGAACGCCCTCGCCAGCGGGTCGTGGAGTACCGC
+ACCCTCAACGTGCGCAAGTGGGAGCGGATCGTCGGCGCGTGGGAGGCCGGGGACGACGCGGGCCTGGATG
+CCGCGTGGGTCGACGAGGTGGTGGTCGACCTCGGTTCGCAGTGGGGTCAGTACGAGTACGTCACCAACAT
+CGGCTTCGCCGCCTGA
+>lcl|NZ_CM001166.1_gene_160 [locus_tag=STTU_p0160] [location=129002..129427]
+ATGACTGACCTACCGCACAACGAGTACATGGCCGCTGTCGCCGACGCGCTCGCCGCCCGCGACATTGCGC
+CCGCACAGTGGTGGACCAGCGAAGACGACTCCGGCGCTGGCACCGACCGTCTCGACGCCGTCTTCCAGTG
+GCACACCGGCGTCGCGGACCGCGACCACTGGCCGCACGGCGTGTACCTGAGCTGGGACCAGTACGACGGA
+TGGCGCCTCATCGAGGCCGGCGGAGGCCGGAACATCTACGACCTTTCGCCGGATTCCCTGATCTACTGCG
+ACCCGCGGCAGGTCGCCGCCGACGTTCAGGCCCGGCTCACACACGGGCTCGACGGATGGTCCCCGGGCCC
+TATCTGCGTCGTCGGCGCCCGGTGGGACGTGCGCCCCACGATGGCCGCTGTAGAACGCTGGGAGGCGGCG
+GCCTGA
+>lcl|NZ_CM001166.1_gene_161 [locus_tag=STTU_p0161] [location=129914..130153]
+GTGCTTTTGTGGCTCCAAATTGAGACTCGACACGGGTGGTTGTGGGCGTACGACCTGGAGCACCTCGACT
+TGCTACGGCGCTTCGTCCAAGCACCGCTGCGCGAACGAGCGCCCTGGTACGACACCGGGCAGAAGATGAC
+GTTGGTCGCCCGTCTGCCACTATGGATCAAGCGCGCGAAGAATCGGGACGAGATCCTGCGCGGCATTGCT
+CGAATCCGCGCATCACTGGTCTGTGCCTGA
+>lcl|NZ_CM001166.1_gene_162 [locus_tag=STTU_p0164] [location=complement(130337..130885)]
+GTGTCGGGCCACGAAGGCGCGAGCAGCAGCGGGGCGCCGGGGGTGTGGGTGGTGCTCGCGGACGGGCAGG
+AGGTGCGGGGGCGGCTCCTCGCGCGGCGCCAGCTCCCGGACGGGTGGCGCTACCGCGTCGCGCTCCCGCT
+CTACCGCAACGTGGGCGGGGAGGGCCTGGAGGTCGAGGCGGCGCAGTACGAGGTGTGGGTGCGGGCCCCC
+GAGCATGTGCGGCCCGTCGAGGACGTCGACTACACGGGCGTGCCGACCACGGCGCTCCCGGCGCCCTCGC
+TCGTGGAGGTGGCGCTCGGGCCGCGCAGGCCCGCCGGGTGGGTGCTGGCGAAGAGCGGCGGCGGGCGCCG
+GGGGCCCTCCCGTGCGGTGCTGCACGCCGTGGACTGCGCCGAGGCGCCGCCCGGCCTTCCGGTCCTGCGG
+GTGGAACAGGCGCTCAACGCTGCCGAGCACCCCGCCACCCGGGCTTGCGCCCTGTGCGGGGCCGGTGCGG
+AGCTTGATCCGCTTCTGCGGGGCTTCGACCCGCAGGAGGACGCGGTGGGAGACCCCTGA
+>lcl|NZ_CM001166.1_gene_163 [locus_tag=STTU_p0162] [location=complement(130888..131412)]
+GTGTGCGAGGGCGAGGGCGTGGTAGGTGGCTCGCCGTTCGAGGGCGAGCCGGAGCAGGGCATCGTTCACA
+CCCCTACCCGATCACATGTTCGATTTTTTGGGCAACCGAACCCGCGCAAAACGCCACATCACCGCCGTGC
+GCGCGCTCTGGCCGGTCGTACCCTCGCTGGTGTGACCGATTTCCCCGACGATCTCCTCGCGGCTCAGCGC
+GACCTCACCGCCGTACGCGCGACCCTTTCCGCCCGCCTCGCGGCGCTGCCGCCCTCGGCGGAGCCGATGC
+CCGCGTGGGAGCGGCCGGACGGCTACTGGGCGGGCGCCCGTACGCACCCGGCCTCCCCGGGGTGGAGCGA
+GGAGGAGCGCCAGGAGGTCGCCGCGCTCCGCGAGCGCGAACGGGATCTCGCGGCGGCGATCGTGACGCAC
+GAGCTGTGGGCGAGCGTGCCGGCCGAGGAACGGATGCGGGCCCGCGACGCACTCAAGCACGCCCACGAGA
+CACAGGCCGCCGAGGCGGCGGGGGCCCGGGGCTGA
+>lcl|NZ_CM001166.1_gene_164 [locus_tag=STTU_p0163] [location=131505..131753]
+GTGCCGCCCGCCCGCGCCCGCGTCCCCGCCCTCGCGGGGGACCAGGTGACGGCGGGGGACGGGCGCCACC
+GCGTGCTCGCCGCCGTACGGGACGCGATCGCCGAGACCGGCCAAGGCCCCTCCGTACGGGAGATCCAGCG
+CGTCACCGGGCTCGCGCTCGCCACCATCGCCCACCACCTGAAGGCCCTGGAGGAGAGCGGCGCCCTCGTC
+CGTACGGGCCTGCACTGGCGCACCTGCCGCCTGGGCTGA
+>lcl|NZ_CM001166.1_gene_165 [locus_tag=STTU_p0165] [location=131871..132767]
+GTGAGCTTCGGCCTGGTCACGATCCCCGTGAAAATGCTCCCCGCCGTCGGCGACCACAGCATCCACTTCC
+GGCAGATCCACACCGCCGACGACGGCCTCGTCCGCAACCGGAAGGTGTGCGAACTCGACGGCAAGGAGCT
+GTCGGCCGACGAGATCGCGCGCGGGTACGAGGTCTCGAAGGACACCGTGGTCCCGCTCTCGGACTCCGAC
+TTCGACGACCTCCCCCTCCCCACCGCGCGCGCCCTGGAGATCGAGGCGTTCGTCGACGCCTCTGAGATCG
+ACCCCATCCAGATGGGCGACACCTACTACCTCGCCGCCGACGGGCAGGTCGCCGCGAAGCCGTACGCGCT
+CCTGCGCGCGGCCCTGGAGCGCACCGACAAAGTCGCCCTCGCGAAATACGCGTTCTCCGGGAAGGAGCGC
+CTGGGGATGCTCCGTGTGCTCGACCAGGACGTCATCGCGCTCCAGGTCCTGCACTGGCCCGACGAGATCC
+GCTCCCCCGAGGGACTCGCCCCGCCCAGCGTAGACCTCACCGAGGACGAGATGACCGGGGCGCTCGCCCT
+CATGGACACCATGGCCCGCGACGGCATCGGCGACGAAGAGGACGAGTACCGCAACGCGGTCGAGAAGCTC
+GTCGAGGCGAAGGCCGAGCACCGTGCGCCGCCGCGCGCCGAGCGCGAGGAGCAGCCGCGCGGGGAGGTCG
+TGGACATCATGGCCGCCCTCCAGGACAGCGTGGACCGCGCGCAAAAAGCCCGCGGCGAGACCGGCAAGGA
+CGCGACCGTCCACGAGATGCCGAAGAAGCGGGCCGCGAAGAAAGCGCCGACGAAGAAGACCGCAGCCAAG
+AAGGCAACGTCGAAGAAGACGACCGCGAAGAAGACGAGCCGGAAGAAGCCCGCCTGA
+>lcl|NZ_CM001166.1_gene_166 [locus_tag=STTU_p0166] [location=complement(132845..133870)]
+GTGCGAGAATCCGGGCCCATGACGGACCCTCAGCAGCCCTCGCAGACCGACCGATCGGATGCCGACGACG
+TCGAACAGCACGCCTGTCCGAAGTGTGACACGCAGCCCGGCTCGCCGTGCCGCTCGCGCGGCGGCGCGGT
+TGCCTCCGCCTACCACACCCGCCGCTTCACGATGGTGCCCCGGCTGAAGAAGGCGCTGCGCGTGCCGACC
+CCGGCCGACCGCGGCCCGGGCCGGCCGTGGCGGCCGGGCACCCCGCCGCCGACGCCGATCGATCCGGACC
+TGCCGAGCGCGGACATCCGCATCGGCTACGCACGGTGCTCGACGCTCGGGCAGGAACTCGACTCCCAGCT
+CGACGCGCTCGCGGGACACGGCGTCCCAAGGGACAAGATCTTCAGCGAGAAGATCAGTACCCGGGTGCGG
+GTCCGCCCGAAGTTCGAGGAGGCGCTGAGGACCGCGCGGGAGGTCAAGGCGCACGCCCCGCACTGCCGGG
+TCATCTTCACCGTGTACGAGATGAAGCGCCTCGGCCGCGACGCCGCCGAGCTCACCGCGCTCGCCGACCA
+CCTCACCGCCCACGGCCTGGTCCTGGAGATGCTCGCCGGGCCCTTGCCCGGCATCTACGACCCGACCGGG
+CCGGGGAAGCTGCTGTTCGCGTTCTTCGCCGCGATGGCGGAGACCGAGCGGGAGAACATCCGGGAGTCCA
+CGCTGGAGGGGCTCGACACGGCGGCCCGCAAGGGCAAACACGGCGGCCGACCCCCGGTCATCACCGACGA
+CATGCTCCACACTGTCCTGCGGCGCCGCGCGGGCGGCGAGTCCGTCGAGCAGATCCAGCCTGACCTGATC
+ATCCCCACCGGCAAGCGCAAGGGCCACAACCCCTCAGTGGCCAGCGTCTACCGGGCCCTCGCCGAGCACG
+CCAAACGCGAGGCATACCCCGAAGCCGTCGCCCAGGCGCACGCCGACTTCGCTGCCCTTCGGGCCGACGA
+CGTCCCCGGGCCCCGCCTCGCACCCTCTGACCGAGCGTCACTCTGA
+>lcl|NZ_CM001166.1_gene_167 [locus_tag=STTU_p0167] [location=complement(134159..135334)]
+GTGCTGATCGCGGGAGCCGGTATCGCCGGTCCGGCCCTGGCCCACTGGCTCAAACGGCACGGAATGCAGG
+CCACCCTCGTCGAGCGGGCCCCCGCCCCGCGGGAGGGCGGACAGACCGTGGACCTGCGCGGTGCCGGACG
+GGACGTCGCCCGCAGGATGGGCCTGGAACACACCCTCCGGGACCACGCCACCCGCGAAGAAGGCATCCGC
+TTCGTCGACGCGGCGAACCGCACCAGAGCCGCCTTCACCAGCGGCGCCTTCGGCGGCCAGGGACCGATCG
+CCGACCTGGAGATCCTGCGCGCCGACCTCTCGCGCATCCTCTACGAGGCCACCCACCCACACACCGAGTA
+CCTATTCGGGGATGAGATCACACAGCTGTCCGACACAGGAAAGAAGGTCGACGTCACCTTCCGCAACGGG
+CCGGACCGTGCATTCGACCTCGTCATCGCCGCCGACGGAGCCCGCTCCCGCACCCGCGACCTGATCTTCG
+GCGACACCACCGACATCCGCCCCGTGGGCCTGACGACCGCGTACTTCACCATCCCCCGCGAGCCCTCGGA
+CGGCACCTGGGCCCGCTGGCACAACGCCACCCATGGACGCACGGCGACCCTGCGCCCCGACAACCGGGGC
+ACCACCCGCGCCTCCCTGTCCTACCTCTCCCCGCCCCGCGGAGACGAACGCCTGGCACCCGACGCACAGA
+AGCAACTCCTGCGCCGCCTGTTCACCGGCGCGAGCTGGGAGATTCCACGCATCCTCACCGCCATGGACAC
+CGCCGACGACTTCTTCCTCGACTCCGTCATCCAGGTCCGCATGCCTTCCTGGTCCCGGGGGCGGATCGCT
+GTCGTCGGCGACGCCGCGTACTGCGCCTCGCCCCTCAGCGGCATGGGCACCAGCCTCGCTCTCACCGGCG
+CCTACGTCCTGGCCGGTGAACTCGCCCACCACGCGCATCACGGCAACGCGTTCGCCCGCTACGAGCACAT
+CCTCCGCCCCTACATCACCCGCGCCCAGCATCTACCGCCCGGCGTTCCTCGCATCGCCTCACCCCGCACC
+CGGGCCGGCATCCGGGCCCTCAACACCGTCCTGTACGCCGCCTCCCGGCCCCGCATCGCCAAAGCGCTCA
+ACCGCTTCCTCGTACCGCCAGCCGACACCTTCACACTGCCCCCGTACGGCCTCTGA
+>lcl|NZ_CM001166.1_gene_168 [locus_tag=STTU_p0168] [location=complement(135449..136951)]
+ATGCGTGACCCGTCCCCCACCCGCGAGGAGACGACCGAGCCCTACCGGTGGCGGTGGCTGATCCTGGCGG
+TGATGATCGTCGCGGAGATCATGGACCTCCTGGACGCCTCGATCGTCAACGTCGCCGGACCGGACCTGGA
+GAAGTCCCTCGGCGCCGGCTCGGTCGGACTGCAGTGGGTGATCGGCGGCTACGCCCTCACCCTGGGCGCC
+GGTCTGGTGCTCGGCGGGCGGCTCGGTGACCGTTACGGCCGGCGCCGGATGTTCCTGATCGGACTCGCGG
+CCTTCACCACTGCATCGCTGCTGTGCGCGATCGCGCCGAACATCGAGTCGCTGATCGCCTTCCGCCTGCT
+GCAGGGCACCGCCGGAGCGATGCTGCTGCCCCAGGGCCTGGGTCTGCTGCGCGAGAACTTCTCCGGCCCC
+GAGCTCACCAAGGTCTTCGCGATCTTCGGCCCCGTCCTCGGACTGGGCGGCATCATCGGCCCAGTCCTGG
+GCGGCTTCCTCATCGAGGGCGACTTCTTCGGCCTGGGCTGGCGCTCGGTCTTCCTGATCAACCTGCCCAT
+CGGCATCGCGGCACTGATCGTCGCCGCGAAATTCGTGCCCAAGAAGGCGGGCGACCGCACGGTCCGGGTC
+GACATGACCGGCGCCGCCCTGATCGTGGCGTCCTGCGCCCTGCTGGTGCTGCCGCTCAACCAGGGCCAGG
+AGAGCGGCTGGCCGCTGTGGACGTGGCTGTCCATGGCCGCCTCCGCGATCGGGTTCGCCCTCTTCGCCCT
+CCAGCAGCGTCGCACGGCCGCCGTGGGCCGCGAGCCGCTGGTGACCCCCGGCCTGCTGCGCAAGCCCGCC
+TTCACCGTCGGGCTCGGCGGCATCGCCCTGTTCTTCGGCGGACTCATCGGCACCCAGCTCGTCCTGACCC
+TGTTCCTCCAGATCGGCCAGCACTTCACCGCTGGTGACGCGGGCCTTGGCAACCTGCCCCTCGCGGTGGG
+AACCGCGATCGGCGGCGCCATCAGCGGCGCGTTCCTCGCTGACAGGATCGGCCGCAAGGTGCTCCAGATC
+GGACCGCTGGTCCAGCTGGCCGGCGCCGCCGTGCTGTGGTTCGAGCTCGACGGCCTCGACTCCGCCTCGT
+TCTCGATCTGGGACATCGTCCCGGGCACGACAGTGGCGGGCATCGGCGCCGGCATGGTGATCGCCGCACT
+GTTCAGCTTCATCCTGGCCGCGGTCGACGACGACGAGATCGGATCCGCCTCCGGGGTCCTGTCGGCGGTC
+CAGGCGGTCGGCGGCTCCATCGGCGTCGCGGTCTTCGGCTCGGTGTTCTTCGCCCAGGCCAAGACCGGCG
+ACTTCACCGGCGGCTTCCACCGGGCCCTGATCGTCCAGGCATGCCTGCTGGTGGTCTTCTTCGCGATCAC
+CTTCCTGCTGCCCAAGAAGGGCCGCCCCGAAGACGAGCAGCACGGCATCACCCCCGAGACCACTGCCGAC
+GACTCCGGCACCAAGCAGCACCTCGCCATCTGA
+>lcl|NZ_CM001166.1_gene_169 [locus_tag=STTU_p0169] [location=137074..137571]
+GTGCGTGACGGGGTCGCTCAGCAGCGTGAGCGGCTGATGGAGTCGCTGAGGATCTACGGTGGCCACTACT
+CCGAGCTCAGCCGGCGCTTCGCCGCCTGGCTGGGCCTGCACTCCACGGACGCGACGGCGGTCCTGGAGAT
+CGCCGCCGCCGAGGAACGCGGCACCCCCCTGTCACCGGCGCGGCTGAGCGAACGGATCTCCCTGTCCACC
+GGCGCCACCACCGCGCTGCTGAACCGCCTCGAAGCGGCCGGGCACATCACCCGCGCCCGCGAGCACTCCG
+ACCGGCGCATCGTCACATTGCACAGCGGCGAGCACATCCAGGAGCGGGCGGACGAGTTCTTCGGCCCGCT
+CGCCCACCGCCTCGACGCCGCGATGTCGCCCTACCCGCCCCAGTTCCTGGAACAGGTCGAAGCGTTCATG
+GCCGACCTGAACGCCACCATGGACGGCCACCTCACGGAACAGAACGCAGTGGCACCGCGCTCCCTCCGCA
+CTCCCTGA
+>lcl|NZ_CM001166.1_gene_170 [locus_tag=STTU_p0170] [location=complement(137825..140512)]
+GTGGATCAGCCCGCGGTGAAGTCGCCGTCCGCGGCGAGTACGGCGCCCGTAACGAAGGCGGATCGCGGGA
+GACCAGGAAGCACAGGACTTCCGCGACCTCGTGCGGCTGCGCCACCCTGCCCAGGGGGTGGACGTTCCCG
+AAGGACGCGAGATAGGCGCGGCTGTACGGCCACGGTGGGCCGGCTGTCGGCGGCGACCCGGTCCCGGCTG
+GACGACCTGGTGGCCGAGGACGCCGGCGGGGAGGAGTCGGCGGGCGGCGGGGTGTCATTCTTCTCCGAGC
+TGAAGGCGGACCCGGGCGCGCTGGGGCTGGACAGTCTGCTGGCGGAGGTGAACAAGCTCCAGCGGGTGCG
+TGCGCTGGAGCTGGCGCCGGAGCTATTCGGGGACGTGTCGGAGAAGCTGGTGGCGGCGTGGCGGGCGCGG
+GCGTCGAAGGAGTACCCCTCGGACCTGCGGGCGGCAGCCGGGCCGGTGCGCTACACGCTGCTGGCCGCGC
+TGTGCCATGTGCGGCAGACGGAGATCACCGACTCGCTGGTGGAGCTGTTCATCCAGCTGGTGCAGCGGAT
+CAACACGCGGGCGGAGAAGAAGGTTGAGGGCGAGTTCACCAAGGATCTCAAGCGGGTCCGTGGCAAGGAG
+GGGATTCTGCTGCGGCTGGCGGAGGCCGCGGTCGCGGAGCCGGGCGGCACGGTCCGCAAGGTGATCTTCC
+CGGTGGCCGGGGAGTCCACGCTGAAGGCCCTGGCGGCGGAGGCCGCGGCGAACGAGGCCCGCTACCGGGC
+CCGGGTGCGCACGGTGCTGCGGTCGTCGTACTCGGGGCACTGGCGGCGGATGCTCTCCCCGCTGCTGGGG
+GCGGTGGAGCTGAAGTGCAACAACACCGCTTACCGGCCGGTGATGGACGCCATCGACCTGCTGAAGCGGT
+ACCTGGACCAGCCCATCGCCAAGGAGGGCGCGTTCTTCGACGAGTCGGAGAACATCCCGCTGGCCGGGGT
+GGTGCGCGAGGAGTGGCGCAAGGCAGTGGTGGACGAGCGCGGCCGCGTCGAGCGCATCCCGTACGAGCTG
+TGCGTGCTGGTCAGCCTGCGGGACGCGCTGCGGCGCCGGGAGATCTGGGTCCCGGGCGCGGGCCGGTGGC
+AGAACCCCGAGGGCGACCTGCCCCCCGACTTCGAGGACAACCGCGATGTCCACTACGACGCGATCCGCCA
+GCCGCAGGACCCTGGGTCCTTCATCGGGGCCCTTCAGAAGCGGCTGCGGGAGGCCCTGACCCGGCTCGAC
+ACCGCGCTGGAGCTGGGCACCACGGGCGGCGTGGACATCGTCCGCAAGCACGGCGAGCCGTGGATCAAGG
+TCTCGCCGCTGGGCAAGCAGGCAGAGCCGGAGAACCTCGTCGCGCTGAAGGCGGAGATCGAACGCAGGTG
+GGGCACCATCGACCTGATCGACATCCTCAAGGAGGCCGAGTTCGCCACCGGGTTCACGTCCGAGTTCGCC
+TCAGTCGCCACGAGGGAGGCGGTCCCGAAGGCGGTGCTGCGGCGCCGGCTGCTGCTCGTGCTGTTCGCGC
+TGGGCACGAACATGGGCATCAAGCGGGTCGCGGTCACCGGCAAGCACGGCGAGAGCGAGGCCGTCCTGCG
+CCGGGTGCGGCACCTGTTCGTCAACCGCACCAACCTGCGCGCCGCCCTGGTCCGCCTGGTCAACGCCACC
+TTCGCCGCCCGCGATCAGGCGTGGTGGGGCGAGGGCACCGCCTGCGCGAGCGATTCGAAGAAGTTCGGGT
+CCTGGTCCAGCAACTTCATGACCGAGTGGCACCAGCGCTACCGCGGGCCCGGGGTGATGATCTACTGGCA
+TGTCGAGCGGAAGTCGCTGTGCGTCTACTCCCAGCTCAAGTCCTGCTCGGCCTCCGAGGTCGCGGCGATG
+ATCGAGGGCGTGCTGCGGCACTGCACGGACGTGGAGATCGACCGCCAGTACACCGACACCCACGGGGCCT
+CGATCGTCGGGTTCGCCTTCGCCCACATGCTCGGCTTCAACCTGCTCCCCAGGTTGAAGAACGTCGGCTC
+GGCGCGGTTGTACCGGCCGGCGGCTGGGGAGGACGACACCTGGCCGCATCTGGCGCCGGTGCTGTCGACC
+AAGACGATCGACTGGGACCTGATCGCCCAGCAGTACGACCAGATCGTGAAGTACACCACCGCCCTGCGGC
+TGGGCACCGCCGAGGCCGAGCAGGTCCTGCGGCGCTTCACCCGCGGAGGCCCCAAGCACCCCACCTACCG
+GGCGATCGAGGAACTCGGCCGGGCGGCACGTACGGCGTTCATCTGTGACTACCTCGCCGACGCCGACCTG
+CGCCGCGAGATCAACGACGGACTCCAGGTCGTGGAGAACTGGAACTCCGCCAACCACGACCTGCTCTACG
+GCAAGGACGGTGATCTGACCGGCTCCGACAAGGAGTCCCAGGAGGTCTCGATGCTCGCGCTGCACCTGCT
+CCAGTCCGCGCTGGTGCACGTCAACGCCCTGCTCCTCCAGGACATCCTCGCCGAGGAGAAATGGCAGAAG
+AAGCTCACCGACGCCGACCGGCGGGCCCTGTCCCCGCTGTTTTGGACGCACGTGAACCCGTACGGCCGGT
+TCGAGCTGGACATGAATTCCCACCTGGACCTCGTCGCCGCCGTGGCGGCTTCGGTGCCCGGCCCGCGCAG
+CGGCGAGCCGGCCACGTCCCCGGCCTGA
+>lcl|NZ_CM001166.1_gene_171 [locus_tag=STTU_p0171] [location=140575..141183]
+ATGCGGGAGAGAGAAACATTCGAAGAACAAGGCGCGGCGGGCGGTGAGGGGCGACGCACGCGTCGGCACG
+ATCCGCGCCGTCGGGAGCGGGTGCTCGACGCCGCGCTGGAGGTGCTCGTCGAAGACGGGGTCGCCGGGAT
+CACGCACCGCAAGGTGGCGGCCCGCGCCGACGTGCCACTGGGCTCCGTCACCTACCACTTCGCAAGCCTG
+ACCGAACTGTGCACGCAGGCGTTCGCCTGGTACGTCGAACAGCGCACCGCCGAATATGAGGCCCTGTTCA
+CCCAGGTGGCATCGCGCGAAGACCTGATCGACGTCCTGGTGACGGTGGTCCAAGGAGGACCGGCCCGGCA
+TCGCAGCGCGGTTCTCGGCTTCGAACTGCATTTGGCGGCGCTGCGCGATCCCGCGCTGCGCGTCCTAACC
+CAGCAGTGGACCAGCTCCAGCCGGGCGGTGCTGGCCCGCTTCACCGGGCCGCGGGCCGCCGCCCGCCTCG
+ATGCCCTCCTGGAAGGAATGATCATGCACGCACTGCTCTCCACGGACCAGGAACCGCCCGAGGCGACCCG
+GGAGTCCCTGGCGCAGACGCTCGGCCCGGCCGCCGGGCCGAGTAAGTGA
+>lcl|NZ_CM001166.1_gene_172 [locus_tag=STTU_p0172] [location=141261..142421]
+TTGGGCCTGGCCGGGGCCACGTGGGCGTCCCGCCTGCCGCAGATCCGGGACCGCATGGATCTGGACGCCG
+CGGCAGTGGGTCTCCTGTTGCTCCTCCTCGGGGTCGGCGGTCTGGTGGCGTTGCCGCTGGCCGGTCTCCT
+CGTCACACGGGTCGGGCCGCGCCGGGCCGTCACCACGGTGGGCGCGTTCGTAGGTGCCGGCCTCGCTGCG
+GTGTCGACCGGCTTCGCTCTCTGGCCACCGTTGCTCCTCATCGGCCTCTTCGTCCTGGGCACTGCCACGG
+GCTTCTGGGATGTCGCGGTGGCCGTGCACGCCGCAGCCCTCGAACGACGACTCGGTCGCGCTCTGATGCC
+CCGCTTCTTCGCCGGGTTCAGCCTCGGCACCGTCGTCGGCGCCTGCCTCGGCGCGCTCCTGACGGCGCTG
+GGCGTAACGGTGAGCCTGCACATCGGCGCGGTGGCCCTGCTCATCACCGTGCTGACACCCGTGGCGGTTC
+GCCGCTTCCTCCCCCGGAGTGCACCCCCGGCATGGCCACCACGCAGGACGACGCAGGAGCCCGGACAGCG
+CGCATGGCGCGACCCACGCACGGTCGTCCTCGGCCTCGTCGCCCTGGCCTTCGCGTTGGCGGAAGGAGCG
+GGAAGCAACTGGGTCAGCCTCACTGTCATCGACCGCCACCGCACCACGGCCGCAGTCGCTACGCTCGCCT
+ACGCCGCCTTCCTCGCGGCCGTCACCCTCGGCCGCTGGCTCGGTCCGCTGATCGTCGGCCGCCTGGGCCG
+GCCAGGAGCACTGCGCGCGTCTGCGTTGGCCGCCTGCCTCGGGGTGGTCTTGTTCGCGGCCGGGCCCAGC
+CTCTGGGCGGGGTTCGCGGGGACGCTGCTGTGGGGAGCGGGCGCGGCACTCGGCTTTCCCCTCGGTCTGA
+GCGCCGGTTCGGACGACCCCGCCCAGGCGGCCGCGCGGGTCGGCGTGATCACCTCGATCGGGTACTGCGG
+CTTTGTCTGCAGCCCGCCCCTGTTCGGCGCCCTCGCCGACCGGACCGGCCTCGCACCGGCGTTGCTGGTC
+GTAGCCGCCGTCATGGCCGCGTGCCTCCCCCTCGCGGGCGCCCTGAGGGACACCTCGCGGGTTGTGTATG
+AAGAGGCGACCGACGGCGTCGCGCCGGGGCCCTTGCACTGA
+>lcl|NZ_CM001166.1_gene_173 [locus_tag=STTU_p0173] [location=142535..143683]
+ATGAAGGAGCACACCGTGCCGACCAGCACACCCGTCATCCAGGTCGCCGACGCCGACCTGGAAGACCTCC
+GCACCCGGCTGCGCGCCACTCGCTGGCCCGAGCCCTGGCCGGTCGACGGCTGGCAGGCGGGTACCGACGC
+AGCCGAACTCCGCCGCCTCGTCATGTACTGGGCCACCGACTACACGTGGCGCACCCACGAAGCCGCCGTC
+AACGCACTGCCCTCCCATTTTGCCGACATCGCCGGCACACGAGTGCACTACCTGCGTTACGAGGCCGAAC
+ACCCTGACGCCCTGCCGATCGTGCTCACCCACGGCTGGCCGAGTACCGTCATGGAACTCACCATGCTCGC
+CGAACGACTCGCCGCCCCCTCCCGCCACGGAGGAGACGCCCGCGACGCCTTCACCGTCATCATCCCCTCC
+CTGCCCGGCTTCACCTTCTCGCCACAGCGCCCCGCCCTCACCGACGCCGAGCAGACCCATGACCTCTGGC
+ACCGGCTGATGCACGACCACTTGGGCTTCCAACGCTACGCGGCCCACGGCGGAGACCTGGGCGCCGGCGT
+CACCTCACGGCTCGCCGAGGCCCACCCCGAGGCCGTCGTCGGCATTCATCTGCTCGCTGCCGCGGCCCCG
+GCAGAGTACGATCCGGCCTCGCTCACCCCTGAGGAGAAGACCCACCTGTTGTCCGCCGCGGCCTGGCAGG
+CAGAGGAGGGCGCCTACATGCACCAGCAGAACACCCGTCCCCTCACCCTCGCGCCCGCACTGAACGACTC
+GCCCGCCGGACTGCTCTCCTGGATCCTCGAGAAGTACCGCGCGTGGACCGACTGCGGCGGCGACCTGTCC
+ACCCGCTTCGGCGACGACTTCCTCCTCACCCAGGCATCGCTCTACTGGTTCACCGGCACGATCTCCACGT
+CCTTCCGCCCGTACTACGAGTACGCGCACCAGCTCACCCGGCGCGTGCGGCGGGTCGACGTCCCCACCGC
+CCTCGCCCTGTTCCCCGCAGACCTCGCCCAACCGCCCCGGAGCTGGGCCGAGCGCACCTACCACCTCACG
+CGTTACACCCGTATGCCTCGCGGCGGCCACTTCGCCGCGCACGAGGAACCGGCCTTGCTTGCCGACGACA
+TCACCGCGTTCTTCGGCGACCTCCGTTAG
+>lcl|NZ_CM001166.1_gene_174 [locus_tag=STTU_p0174] [location=complement(143857..143970)]
+GTGGATGGACTGCATGGGAGCCCACTTCATAAGAGGCTCGACGAACACTGCGCTGGCCGATTCGGGATCG
+CACCACCGCTAACCGGGGAAATCACCACGAAGATCAACCACTGA
+>lcl|NZ_CM001166.1_gene_175 [locus_tag=STTU_p0175] [location=complement(143981..144157)]
+ATGCCCACCGAGACCCTGCCGCCCGAGGTGCGGAATTTCATCGACGATGCGCGGCGTCACCTGGCTTTCT
+GCGCCGGGCTGCGCGCGGGCGAGGACCCGGCGTACGCGACCGTGCTCCTGGCCGCCGCCGAGCAGGGAGA
+AGAAGTCCTCGCCCGGTACGAAGGCCGCGTAGCTTAG
+>lcl|NZ_CM001166.1_gene_176 [locus_tag=STTU_p0176] [location=complement(144230..147016)]
+TTGGCTTGTCTGCCTCGTGAGGAGTTTCAAATTTCTGTTTCTCGGGTTCCGTTGCGGAAACATCAGGTGG
+AGCTTATGTCGGACCTCAGGAAATGGGTTCGGGTGGCTGCCCGGGAAAGCGCCCGTTCGGGGCGGGGGGC
+GCGGGCGACGGTGGTGTCCGCTACGGGTACGGGGAAGACGATCAGCGCGGCTGTTGCGGCGTTGGAGTTG
+TTCCCTTCGGGGCGGGTTCTCGTGATGGTGCCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGC
+GGGCGGTGGGGCACACGGCGCCGATGGTCGGGGTGTGCTCGCTGCCCGGGGATCTGCTCCTGGAGGAGTT
+GCGGGTGCGGACGACGACGCACCCGATCCGGCTCGCGCTGTGGGCCGGGCAGGGGCCTGTGGTCGTGCTG
+GCGACGTACTCCTCGCTCGTGGGCGGGGACGGGCAGGGCGGGCCCCTGGAGGCCGCCCTGGCGGGCTCGG
+GGTTGTACGGGCAGCGGATGGACGGCTTCGACCTCGCGGTCGTGGACGAGGCGCACCGTACGGCGGGCAG
+CGCGGCGAAGCCCTGGGCCGCGATCCACGACAACGCCCGTATCCCGGCGGCGCACCGGCTCTACCTCACC
+GCCACCCCGCGCGTCCTCGCGCCCGCCCGCCCCGACAGGGACGAGGACCAGGAGGAGGGCGGCGGGGAGG
+CGCCGGCACTCGTGACGATGGCGAACGACCCGGAAGGCGAGTACGGGGCGTGGATTCACGAACTCGGGTT
+GTCCGAGGCGATCGAGCGGAAAATTCTTGCGCCTTTCGAGATTGATGTTTTGGAGATTACCGATCCTGAG
+CCGGAATTGATGGAAGGAATGGACCGGGAGGCGCGGCGTGGGCGGCGGCTCGCCCTGCTCCAGACTGCGT
+TGCTGGAGCACGCGGCCGAGCACAATCTGCGCACCGTGATGACGTTCCATCAGCGGGTGGAGGAGGCGGC
+GGCTTTCGCGGAGAAAATGCCGGAGACAGCGGCGGAGCTTTACCGGAATGAGGTGTCGGCGGAGGATCTT
+GCCCTAGCCGAGGAGCTCCCGGCCTCCGAGGTGGGCGGGGGCTTCTACGAGCTGGAGCCGGGGCGGCATG
+TGCGGCCGGAGCGGGTGTGGTCGCGGTGGCTGTACGGAGAGCACCCGGTGGCCGAACGCCGTGCGGTGCT
+GCGGGAGTTCGCGAACGGGATGGACTCGGCAGGGGTGCGGGTGCACCGCGCGTTCCTCGCCTCCGTCCGC
+GTGCTCGGCGAGGGCGTCGACATCGTCGGGGAGCGCGGGGTCGAGGCGATCTGCTTCGCCGACGCGCGCG
+GGTCCCAGGTCGAGATCGTGCAGAACATCGGCAGGGCGCTGCGCCCGAACCCGGACGGGCAGACGAAGAC
+GGCGCGGATCATCGTGCCCGTCTTCTTGGAGGCCGACGAGGACGGGGAGGGGATGGTCGCGAGCGAGGCG
+TACCGGCCGCTCGTGGCCGTGCTCCAGGGGCTGCGCTCGCACTCCGAGCACCTGGTCGAGAAGCTGATGC
+TCCGGGCCCGGGTGCGGGCCGAGAGCGCGAGCGCGCGCAGCGCGGAGGAGGCCGGTGCGGGGCCCGCGCG
+GGTCCTGTCCGACTCCGGGACCTCTTCCCCCGCCTCCCAGGCCTCCGGGGACGTCGAAGGCGAGAACGAG
+GACGACGTCGAGGCGGGCGCGGACGGCGCTGAGGCGGGCGCGGACGGCGCTGAGGAGTCGGAGTCGGTGT
+TGTTGCGGTTCTCGACGCCGCGCTCGGCGTCGACCATCGCGGCCTTCCTGCGGACGCGGGTGTACCAGCC
+GGAGTCGACGGTGTGGCTGGAGGGCTACGAGGCGCTGCGCGCCTGGCGGGCCGAGCAAGGGGTGCGCGGC
+TTGTGCGCGGTCCCGTACGACGCCGAGGTCGCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGA
+CCACCGCGCAACGCCGCGCCCGCCGCGAGGGCACCCTCAGCGCACACCGCATCGACCTGCTCGACGCGGA
+GGGCATGGTGTGGGAGCCGCGCGAAGAGGAGTGGGAGCGCACGCTCGCCGGGCTTCGCTCCTACCGGGCC
+GCGTACGGGCACCTCGCCCCCCGCCGGCGCGAAACCTGGGGCGAAGACGAGGGTGAGGACGTCGTACGCG
+TCGGGGACCTGATGGCGAACCTCCGCCGCAAGGACGGACTCGGGCGGGACGCGGAGCGGGCCGCCGCGCG
+CGCGGCCCAGCTGAGGGCCGTCGATGCGGACTGGGACTGCCCCTGGCCGCTGGACTGGCAGCGCTGCTGT
+CGGCAGCTCGCGCTCCTGGCCGCCGACGAACCCGACGGACGCGCGCCCCGGATCGCGCGCGGGGTGCGCA
+TCGACGGGGACGACCTCGGCGCGTGGGTCGCGCGGCAGCAGGAACCGCGGGTGTGGGCGAAGCTCAGCAC
+CGAGCAGCGGGCGCGACTCGAAGCGCTCGGGCTCCGGCCTACCGAGACGGCCCCACGGCGGGGTGTGGAG
+GGCACGGGGGCGGCGGGGAGCGGGAAGCGGACGGCGGCGGCGCGAACGGCCTTCCAGCGCGGCCTCGCGG
+CGCTCGCGCAGTGGGTCGAGCGGGAAGGCGCGGAGAAACCCGTACCCCGCAAACACACCGAGACCGTGAG
+CGTGGACGGTGAGGACGTCGACGTACGCCTCGGCGTGTGGGTCTCGAACGTGAAGAGCCGCTTCGACGGG
+ATGGGCGAGGACGAGCGCGGCCAGCTCACCGCGCTCGGAGTGCCCTGGGCGGTGTAG
+
Binary file test-data/streptomyces_Tu6071_plasmid_genes.icm has changed
--- /dev/null	Thu Jan 01 00:00:00 1970 +0000
+++ b/test-data/streptomyces_Tue6071_plasmid_genomic.fasta	Tue Nov 28 10:11:42 2017 -0500
@@ -0,0 +1,2107 @@
+>gi|333028963|ref|NZ_CM001166.1| Streptomyces sp. Tu6071 plasmid pTu6071, whole genome shotgun sequence
+GGCCCCGTACGAGGGGCGCGGCCCCGTACGAGGGGCGCGGCGGCGCGGGTTTCATCATACGCTGCATCAG
+GTGCTGATGCACTGTGTAGACTTGGGGGAATTCGGTGACACCCTGCCGCGTGTAGCTCTTCCCTGATTCG
+CCCTCAACGCAGCCCAATTGATGCATATGTTGAGTTGGGGATTTGGCTCGTCTGCCTCGTGAGGAGATTC
+AAATGTCTGTTTCCCGGGTTCCGCTGCGGAAACATCAGGTAGAGCTTATGTCGGACCTCAGGAAATGGGT
+CCGGGTAGCCGCCCGGGAAAGCGCCCGCACGGAGCGTGGGGCGCGGGCCACGGTGGTGTCCGCTACGGGT
+ACGGGAAAGACGATCAGCGCGGCTGCTGCGGCGTTGGAGTTGTTCCCTTCGGGGCGGGTTCTCGTGATGG
+TGCCGACGCTGGATCTGCTGGTGCAGACGGCGCAGTCGTGGCGGGCGGTGGGGCACACGGCGCCGATGGT
+CGGGGTGTGCTCGCTGCCCAGGGATCTGCTCCTGGAGGAGCTGCGGGTGCGGACGACGACCCACCCGATC
+CGGCTCGCGCTTTGGGCCGGATCGGGGCCGGTGGTCGTGCTGGCGACGTACTCCTCGCTCGTGGGCGAGG
+ACGGGCAGGGCGGACCCTTGGAGGCCGCTCTCGCCGGGGCTGGCTTGTACGGGCAGCGGATGGATGGCTT
+CGACCTTGCGGTCGTGGACGAGGCGCACCGCACGGCGGGCAGCGCGGAGAAGGCGTGGGCGGCGATCCAC
+GACAACGCCCGTTTTCCGGCGGCGCACCGGCTGTACCTCACCGCGACCCCGCGCGTCCTGGCCCCGGCCC
+GTCCCGCCAGGCACGAGGGCGAGGAGGGACGCGGGGAGGCGCCGGCACTCGTGACGATGGCGAATGATCC
+GGCGGGCGAGTACGGGGCGTGGATTCACGAACTCGGTTTGTCCGAGGCAATCGCGCGAAAAATCGTCGCG
+CCTTTTGAGATTGACGTTTTGGAGATTACTGATCCTGAGCCGGAATTGATGGAGGGATTGGATCGGGAGG
+CGCGGCGTGGGCGGCGGCTTGCGTTGCTTCAGACCGGGCTTTTGGAGCACGCGGCCGAGCATAATATTTG
+CACCATGATGACGCTTCATCAGCAGGTTGAGGAGGCGGCGGCTTTCGCGGAGAAAATGCCGGAGACGGCG
+GCGGAGCTTTACCGGAATGAGGTGTCGGCGGAGGATTTTGCCCTGGCCGAGGAGCTCCCGGCCTCCGAGG
+TGGGTGGGGGGTTCTACGAGCTGGAGCCGGGGCGTCATGTGCCGCCGTCGCGGGTGTGGTCGCGGTGGCT
+GTATGGGGAGCATCCTGTGGCCGAACGGCGTTCTGTGCTGCGGGAGTTCGCGAACGGGATGGACGCGGAG
+GGGCGGCGGGTGCACCGGGCGTTCCTCGCTTCCGTACGGGTCCTGGGTGAGGGCGTCGACATCGTCGGGG
+AGCGCGGGGTCGAGGCGATCTGCTTTGCCGACGCACGCGGGTCTCAGGTGGAGATCGTGCAGAACATCGG
+GCGCGCGTTGCGCCAGAACCCGGATGGGCGGGCGAAGACGGCGCGGATCATCGTGCCGGTCTTCCTGCGG
+CCGGACGAGGACGGGGAGGGCATGGTGGCGTCGGAGGCGTACCGGCCGCTCGTCGCCGTACTCCAGGGCC
+TGCGCTCGCACGACGAGCACCTGGTCGAGAAACTCATGCTGCGGGCGCGCGTACGGGCCGAGAGCGCGAG
+CGCGCGCAGCGCGGAGGAGGGCGGTGCGGGGCCCTCGCGGCTCCTGTCGGACTCCGGGACGGCGGCTGCG
+GCCTCCGAGGGCGTCGAGGGCCAGGAGCAGGGCGAGGACGGCGCCGAGGCGGAGTCGGTGCTGCTGCGGT
+TCTCCTCGCCGCGCGCGGCGTCGACGGTCGCGGCGTTCCTGCGGACGCGGGTGTACCAGCCCGAGTCGCT
+GGTGTGGCTGGAGGGGTACGAGGCCCTGCGCGCCTGGCGGGCCGAGCAAGGGGTGAGCGGGGTGTGCGCG
+GTCCCGTACGACGCCGAGGTCGCCGCGGGGGCCTCGCGGCGGTACCCGGTCGGGCGGTGGACCGCCGCGC
+AACGCCGCGCCCGCCGCGAGGGCACCCTCAGCGCACACCGCGTCGAGCTCCTCGACGCGGAGGGCATGGT
+GTGGGAGCCGCGCGAGGAGGAATGGGAGCGCACGCTCGCGGGGCTTCGCTCCTACCGGACGGCGTACGGG
+CACCTCGCCCCCCACAGGCGCGAAACCTGGGGCGAAGACGAGGGTGAGGACGTCGTACGCGTCGGGGACC
+TGATGGCGAACCTCCGCCGCAAGGACGGACTCGGGAAGGACGCGAAGCGGGCCGCCGCGCGCGCCGCGCA
+GCTGAGGGCCGTCGATGCGGACTGGGACTGCCCGTGGCCGCTGGACTGGCAGCGCTGCTGCCGGAAACTC
+GTGCTCCTGGCCGCGGACGAGCCCGGCGGGCGCCTGCCGGAGATCGCGCCCGGGGTCTGCCTGGACGGGG
+ATGACCTCGGGGTGTGGGTCGCGCGGCAGCAGGAGCCGCGGGTGTGGGCGCGGCTCAGCACCGAGCAGCG
+GGCGCGGCTCGAAGCGCTCGGGCTGCGGCCCACCGAAGCGGCCCCGGGGCGGGGTGTGGAGGGCACGGGG
+GCGGCGGGGAGCATGAAGCGGACGGCGACGGCGCGAACGGCTTTTCAGCGGGGTGTGGCGGCGCTCGCGC
+AGTGGGTCGAGCGGGAAGGCGCGGGGAAACCCGTACCCCGCAAACACGTCGAGACCGTCAGCGTCGACGG
+CGAGGACGTCGACGTACGCCTCGGCGTATGGATCTCGAACACCAAGAGCCGGTACGACGGGCTGAGCGAG
+GACGAACGCGCGCAGCTCACCGCACTCGGAATGCCCTGGGCAGGATGACGAGCAGGCGGCGGATGCGACC
+AGCGTAGGAGGGGCGGGGAGCGGCGGCAGCCGGACCGGGCCCGGCTGCCGCCGGTCAGCCCAGGCGGCAG
+GTGCGCCAGTGCAGGCCCGTACGGACGAGGGGGCCGCTCTCCTCCAGCGCCTTCAGGTGGTGGGCGATGG
+TGCCGAGCGCGAGCCCGGTGACGCGCTGGATCTGCCGTACGGACGGTCCCTGGCCGGTCTCGGCGATCGT
+GTCCCGTACGGCGGCGAGCACGCGGTGGCGCCCGTCCCCCGCCGTCACCTGGTCCCCCGCGAGGGCGGGG
+ACGCGGGCGTGGGCGGGCGGCACAGCAGAGCCCGGCGGGCCGTGGTGGGCGGGCCGTCGAGCAGGCGGGC
+GGACTGCCGGATCAGTGCCCGGCGCAGAGGTGTCGGGGGGCGGGCGGGGCCGCCGAGGGTGAGGTCGCGG
+TAGGTCGCACGCCTCTCCTGGGCGAGGCGGAGCAGTTCATCGGTCACCCCCACACTGGATCACGTGTTCG
+ATTTTCTGGGCAACCGAACCCTCACAAAACGCCACATCACCACCGTGCGCGCGCTCTGGCCGGTCGTACT
+CTCGCTGGTGTGACCGATTTCCCCGACGATCTCCTCGCGGCTCAGCGCGACCTCACCGCCGTACGCGCCA
+CCCTTTCCGCCCGCCTCGCGGCGCTGCCGCCCTCGGCCGAGCCGATGCCCGCGTGGGAGCGGCCCGACGG
+CTACTGGGCGGGCGCCCGTACGCACCCGGCCTCCCCGGGGTGGAGCGAGGAGGAGCGCGAGGAGGTCGCC
+GCGCTCCGCGAGCGGGAGCGGGATCTGGCCGGGGTGATCGTGACGCACGAGCTGTGGGCGAGCGTGCCGG
+CCGGGGAGCGGATGCGGGCCCGCGACGCACTCAAGCACGCCCACGAGGCCCCGGCCGCAGCCGGGGCGGC
+GGGGGCGCGGGGCTGAGCGTGCCGGGCAGCGAAGCGGGCGAGGGCGGGGCGCCGGGGGTGTGGGTGGTGC
+TCGTGGACGGCCAGGAGGTGCGGGGGCGGCTCCTGGCGCGGCGCCAGCTGGCGGACGGGTGGCGCTACCG
+GGTCGCGCTCCCGCTCTACCGCAACCTCGGCGGGGAGGGCCTGGAGGTCGAGGCGGCGCAGTACGAGGTG
+TGGGTACGCGCGCCCGAGCACGTACGGCCCGTCGAGGATGTCGACTACACGGGCGTGCCGACCACGGCGC
+TCCCGGCGCCCTCGCTCGTGGACGTGGCGCTCGGCCCGCGCAGGCCCGCCGGGTGGGTGCTCGCGAAGAG
+CGGCGGCGGGCGCCGCGGGCCCTCCCACGCGGTGCTGCACACCGTCGACTGCACCGAAGCCCCGCCCGGC
+CTTCCGGTCCTGCGGGTGCGCGTCCGACCCGCAGCCTTTCTGAGCGGGGGCTGCGGGTCGAAAAAGGCGG
+GCCTCAGGCGGCAATGAGGCCGTGGGGATCGATGATGAACTTCTCGGACACGCCGGTGTCGAAGGTCGCG
+TAGGCGTCAGGGGCGTCGTCGAGGCTGATCACCTTCGTGTTGAGCATCGCGCTCAAGTAGGGCATGCGGT
+CCCACAGAATCGCCATCATCAGCTCACGGTTGTAGTGCATGATCGGTGCCTGCCCGGCGGCGAGCCGCGG
+CGACTTGATCCAGGCCTTGCCGAAGTCGATCGGGTACGTTCCCTGCTGCTCGGCCTTCGACTTCGCGAGC
+GGGTCGGGACCGTAGACGCCGATGACTCCGGTGGCTCCGCCCGCGCGGGTGGCGTCGAGCACCTGGTTGA
+GGGCGTGGGCCGGGTCCATGTCCTCTGCCTCGCGGCCGATGCCGTGTGCCTCGGTGCCGACGTAGTCGAC
+TGCGCAGTCGACCATGGGTTCGCCCAGGATGGCCTCGATCTGGTCGGTGAGCGCTGCGTCCTGGCTCAGG
+TCGATCGTCTCGCAGCCGTTCTTCTTCATCAGCTCCAGGCGGTCCTTGTGGTAGTCGCCGACGATGATGC
+AGGACGCCCCGAGGAGCCGCGCCGCTGCTGCGCCGCAGCGGCCGACCGGGCCGGCGCCGGCGATGTACAC
+GGTGGAGCCCGGTTTGGCGCCGGCCTCCATGAGGCCGTGGAACGCGGTGGGCAGGATGTCCGAGAGCAGC
+GCCAGGTCACGGATCTTCGCCATGGCCTGGTCCCTGTCCGGGAAGCGCAGGAGCTGGAAGTCGGCATAAG
+GGACGAACAAGTACTCGGCCTGTCCACCGGTCCAGTCGCCCAGGTTGAAGCCGTACGCTCCGCAGGACAC
+CTCAGGGTTCGTGGTCTCGCAGACGTCGGTCCGGCGGGCCCGGCAGTTGCGGCATCGGCCGCAGGCGACG
+TTGAAGGGGACGGAGACGAGGTCGCCCTCGCTGAGGAACTCGACGTCGGGGCCGACCTCGATGACCTCCC
+CGGTCATTTCGTGGCCCATCACCATACCCTGGGGCACCGGGAAGGACCCACGGTAGATGTGCAGATCGCT
+CCCGCAGATGTTGGTGGCGACGATCCTGAGGATGACGCCGTGCGGGGCTTTCTTCCCGTTCGGCATCTGA
+AGCTTCGGGAAATCCAGAGACTCGACGCGCATCTCCTTCGGGTTCTGGAAGGTGACGGCGCGGTTGCTAC
+TTGCCATGACGATCTCCTCTGCTGTTCCAACGGGCTCGGCCGTGGGAGTGCCGGATGTCCTGTGATTGGC
+TTGTGACATCTCCCGGTCAGGTGGGTTGCGGTGCGTTGGCGAAGCGTTCGACGATCGCCTTGCAGAAGGC
+AGAGAGGTCCTGCGGGCCGCGGCTGGAGATCAGCTGGCGGTCAATTACGACCTCCTCGTCGACGACCTCG
+GCGCCGGCGTTGCGCAGGTCAGTCCGAATGCTGGGCCAAGAGGTGAGGCGGCGACCGTGCAGCACGTCAG
+CCTCGGCCAGGGTCCAGGGTCCGTGGCAGATGGTGGCAACGGGCTTCCCTGTCTCCACGAACCCCCTCAC
+GAAGGCGACGGCGTCGGGGTCGGCGCGCAGCTGGTCGGGGTTCATGGTGCCGCCGGGCAGCAGGAGCGCG
+TCGTAGTCACCCATCCGGGCGTCGGCGACCTTCTTGTCCACGGTGAAGGTTCCGGCCGGCTCGATGTCCA
+TCTGGCGCGCGTTGATTTCGCCGGTGTGGAGGGACAGGAGTTCAGCCTGCGCTCCAGCACCCAGCAGTGC
+GCCGAGAGGTTCTTCGAGCTCGACGCGCTCAACGCCGTCCGTGGCCAGGATTGCGATCTTCCTGCCGTGC
+AAGTCGTTGGTCATGGTGCGTAGTTCCTTCCGATGATCAGTGGGACCGGTTCGGTACGTTCTGCGCCGCT
+CAGCTGCCGTCGATGAGGGAGGAGGACCTTGGCCCGACTGCCCTCTCGGTGGCCGAAGGTGCTGGGAGGC
+TCGGTGCTCGGTCCAGCGACAGCTCCTGGAAAACGATCCAGGCCAGCTTGGCTTTACCCTGCGCGATCAG
+GGCCCACAGCTGCCGGTTGTACGCCTTGACGTTGGCCGGGCCGGTCCCCGCAGTCGTGCGGGCGCGTCCC
+CGGGGGACGGAGTACCGCACGAAGAGATCTTCTCCTGCTGCCCCACCTCCGCAAGACATATCAGAAGGGT
+TGAATCTTTGTGCTTGGCTGGTGGCGCGGCGGAAACCCGGAGGCGCTGAGGCATGATCGGCCTACGCCAA
+ACCGCTACCGTCACTTGGTCGTCGGCTCCTCGTCGCACATCGCAAGGCGCGATGCCCGCGGGTACGCACT
+TCGACGTCGTCGTCCTGGCGCGAGTTCGGCGGGTACGCGGCCGTGCGGGCCTCCCCCTCTGGGCCGGCGC
+ACCGCCGTCGAGGCCAAGTCCCGGGGGAGAGTGGGGTTGACGATCGTCTGTGGGCCCGACCTCATGGCCG
+CTGGGCTGATCCACGCCGTCCCTCGGGCAGAACCTGCTCTACGCGGGCTGCTTCTCCACGACGACATCGA
+GTTGCTCGATTGTGGGCTCCTCGAAGAGCTCACCCGTCTTCTCGCCGAGCGCTTTGGCGACCGCACCCGA
+CAGATGCGTCTGACGTCCCTCATCGTCGGGAAAGGCATCGAAGATCCCGAACGACGATGGTCCGAACTGG
+ATTCCGATCCACCTGACGGTCTTGGGCTCCCCCATGACGACCGACAGCGCCTGGTTCAAGAAGTCGCGGA
+CGTCGTCTTCCCTGCCGGGCAGCGCTTCGAGGCGCACCAGAACCGCTTTGCTGACCTGCGTTGTCATGTC
+GGGGCTCCTCTGCCTCTACTCGGTTCGCATTGTCAATGACCGGAACGCCGCTACGCCCGATGCGCCGACC
+CATCTGCCACTGCTCGCCGATCACCCCTACCGCTTGACGCTTTGACTGTCGCGGTGTAGGAGATACTGCT
+GACGAAGATGCTCATCCAGCCCCTGTTGGTGACCTGGACGCCGTGGAGATTCCTCACCGGACTGTCGAAG
+AATGCGCCGTGAAGGCACTGATCGCCGCCGTGGAACCGTTTGACCTGTCTACCGTCACCCGGGGTCGCAT
+CACGCGCAAACGCAGTCTGCCGGCGACCGGCGTCCGATTAGCGGACCAAGTGGTGCCTCTTCGGATAATC
+CGCTCAAGACCGCCCCGACCCCGAACAGGGCTTGATCAGGTTCCGTGGGGTTCAGGTTAGAGGTGATGCC
+CAGATCGGGAGCGCTCGTCCCGGGTCATCACGATGACTCGGGCAGTCTTGGCGACGACGAGGCCCGGCCT
+AACAGCGGCCTGACCGAAGCCGACCGCAGCCGGATCCTGTTCTCACAGCGGGGCGGAGTCCGCGCCCAGC
+CTCGTGCCGTCCGCCTCGGGCTGGATACCGAGCGCATGTGTGCAGTACTCCCGAACCGTTCGATGGACTC
+GGTCAGATAGGGCGAGATGCTCGATAGGTCCTCCGGCTCGACAGGTTCTCCGGCTCGACCGGCCAGGGCT
+CCCCCAGCAGCTGGCGGACGATCTCGGCGATATCCCGGGCGTTGTGGAGAATGAGCGCTTTTTGCCGGAA
+CAGTACGATGGTGTCTGCCGGCACCGATGAGGTCGGGCCACCCGACTCCGGGTGGAGCCCGGTCGGGCAC
+GCGCCAGGGGGCGTCACAGCATCTCCAGCGGGCGTTTGCTCTTCGGGGGCGGGAACGCCCGGTCCAGCAT
+CGCGAGGTCCTCGGCGGTCAGGTCCACCTCCAGAGCTGTTCTGTTCTCCTCGACGTGCGCGCGGGAGGAC
+GCCTTCGGGATGGCAATGACGTCCTCGTGCCGCAGGACCCAGGCCAGGGCGATCTGCGCGGGCGTCGCAC
+CGTGGGCGGCTGCCACGTCCCGCAGCGCCGTGTGGCGGAGCAGTCGGCCCTGCTCGACCGGCGAGTACGC
+CATCACGGGGATCGATAGTTCACGACACCTGGGCAGCAGACCGTACTCAGGCCCTCGACGGCTGAGGTTG
+TACAGCACCTGATCGGTCTGCGGCCCGGCTCCAGGCGGCAGGTCCGCGAGATCATCCACGTCCAGGTTGC
+TCACACCCCAGGAGCGGATGGCACCCTCCCGCACCAAGGCCTCGAACGCCTCAACCGTCTCCTCCAGCTG
+CACGGCTCCACGCCAGTGCAGCAGATACAGATCGATCCGGTCCGTGCGCAGACGGCGCAGGCTCCCCCGG
+CAGGCCTCGGCCACTCCGCGGGCGTCCGCATGGGAGGGAAGCACCTTGCTGACCAAGAAGACCTCGTCCC
+GCCGTCCGGCCACCGCCTCGGCGACCACCTCCTCCGCCGCGCCGTCCCCGTACATCTCGGCGGTGTCGAC
+AAGAGTCATCCCCAGGTCCAGCCCGGCACGCAAGGCCGACACCTCGGCCGCGCGGCGCCCGGGATTCTCC
+CCCATCCCCCAGGTACCTTGACCGAGCGCCGTGACCGCAACCCCACAAGGAAGGCTGACCGCCCGCGGAT
+CCGCCATAACTTCCTCCTGGATGTAACGGTGGCCAAGGCTTTGGACCACCAAGTCCACTCCGATCTCAGA
+TCGGAATGGAATCCTCTCAGACAGGAATGGAATGCTCCTGCGGCGCGCCCCCAGGATTCCCCGTGCGGCC
+CATAGTTGATCCAGCGAGAGTCGTCCGCGTCGCGCTGCCGCACTGATGTGATCGGGATCTTCCCGAATGG
+CACCGCGATCACCGATGCTTCCCCCGGCCCGGGCCTGACGACCGGCCTAGCGGGGCGCCGGGGGTGTGGG
+TGGTGCTCGTGGACGGGCAGGAGGTCGGGGGCGGCTCCCCGCGCGGCGCCAGCTGGCGGACGGGTGGCGG
+TACCACGTCGCGCTCCCGCTCTACCGCACCGTGGGCGGGGAGGGCCTGGAGGTCGAGGCGGCGCAGTACG
+AGGTGTGGGTACGCGCGCCCGAGCACGTACGGCCCGTCGAGGATGTCGACTACACGGGCATGCCGACCAC
+GGCGCTCCCGGCGCCCTCGCTCGTGGACGTGGCGCTCGGCCCGCGCAGGCCCGCCGGGTGGGTGCTCGCG
+AAGAGCGGCGGCGGGCGCCGTGGGCCCTCCCGTGCGGTGCTGCACACCGTCGACTGCGCCGAGGCGCCGC
+CCGGCCTCCCGGTCCTGCGGGTGGAACAGGCGCTCAACGCCGCCGAGCACCCCGCCACCCGGGCCTGCGC
+CCTGTGCGGCGCCGCCGCCGAACTCGACCCGCTCCTCCGGGGCTTCGACCCTCACGACGAGGACACGGGC
+GCTTCTCCCTGATGAGGTCACAGGCATGGGCTCGCGGTACTCGTGCGCTTCGGCAGGGCATCGTAGCTAC
+GTGATCGCTACGTGGATGGACTGCATGGCACCGGCCGACGTCTGCCTGGAGGCGGTCTGTGAGGAGCCGC
+GCGAGCGGGTCGACGGCGTGCTCTACGCCTGCCCCGCCCACGGGGCCGAGGCGGCCTCGCGGATCACCGA
+GGCGGGATGGACCGCGCTGGTCAAAGTGATGGGGCCCGCGAGCCGGGCCAGGTGCGAGGTCTTCGACGGC
+GCCACCCGCGAGGCACGTCACCTCCTGGGCGCGTAGCCCTTCTCAGGCGGCGAAGCCGATGTTGGTGACG
+TACTCGTACTGGCCCCACTGCGAACCGAGGTCCACCACGACCTCATCGACCCACGCGGCATCCAGGCCCG
+CGTCGTCCCCGGCCTCCCACGTGCGGACGTTCAGGATGCGGTACTCGACTGCCGAGCTAATGGGGGAAGT
+GTGAAACGTACGAGGGTGATCGTGTCGGGGTTGAGGGTGCCGTGGCTGTATGGGCTGGCTCCACGAGAGC
+GTGGGGCAAGTGCGGCAGGATGTGTGACCAACGTGGCCCCCGAGCAACGTGATGGAGCGTCAGACATCTC
+GATCACCCGCCCGGGGGCCTCGCTCGTTGCGCTATACGACCCATCACCCGATCCCGGGCAGGCGGCGGCG
+CCCCCGGGGGGGGCGAGACGGCTGCCCC