annotate test-data/uniprot_globins_match.out @ 7:b28e8ed99424 draft default tip

"planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
author iuc
date Wed, 21 Jul 2021 14:11:12 +0000
parents b4fe2f703b4b
children
Ignore whitespace changes - Everywhere: Within whitespace: At end of lines:
rev   line source
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
1 # hmmsearch :: search profile(s) against a sequence database
7
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
2 # HMMER 3.3.2 (Nov 2020); http://hmmer.org/
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
3 # Copyright (C) 2020 Howard Hughes Medical Institute.
4
be0cc39776f9 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
4 # Freely distributed under the BSD open source license.
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
5 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
7
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
6 # query HMM file: /tmp/tmpzdnl83p_/files/f/6/6/dataset_f66fafa4-758d-4ace-89be-ff71fce4f56c.dat
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
7 # target sequence database: /tmp/tmpzdnl83p_/files/0/d/9/dataset_0d912a57-511c-4a51-a642-30fdf00f581c.dat
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
8 # max ASCII text line length: unlimited
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
9 # Vit filter P threshold: <= 0.001
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
10 # Fwd filter P threshold: <= 1e-05
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
11 # random number seed set to: 4
7
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
12 # number of worker threads: 0
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
13 # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
14
5
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
15 Query: dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 [M=149]
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
16 Scores for complete sequences (score includes all domains):
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
17 --- full sequence --- --- best 1 domain --- -#dom-
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
18 E-value score bias E-value score bias exp N Sequence Description
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
19 ------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
20 1.3e-70 223.2 0.1 1.4e-70 223.0 0.1 1.0 1 sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
21 5.8e-70 221.1 3.3 6.4e-70 220.9 3.3 1.0 1 sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
22
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
23
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
24 Domain annotation for each sequence (and alignments):
5
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
25 >> sp|P02024|HBB_GORGO Hemoglobin subunit beta OS=Gorilla gorilla gorilla GN=HBB PE=1 SV=2
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
26 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
27 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
28 1 ! 223.0 0.1 1.4e-70 1.4e-70 1 149 [] 2 147 .] 2 147 .] 0.99
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
29
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
30 Alignments for each domain:
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
31 == domain 1 score: 223.0 bits; conditional E-value: 1.4e-70
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
32 dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 1 vvLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
33 v+L+++ek++v+a+W+kv +v+evG+++L rl+v+yP+tq+fFe+F+dLst+d+++g+++vk+Hgkkvl+A+sd+la+ld +l++++++LselH++kl+vdp++fkll++vlv+vla++++keft++vqaa++K++a+va+ala+kY+
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
34 sp|P02024|HBB_GORGO 2 VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLD-NLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 147
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
35 69****************..*************************************************************.******************************************************************7 PP
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
36
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
37 >> sp|P02185|MYG_PHYCD Myoglobin OS=Physeter catodon GN=MB PE=1 SV=2
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
38 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
39 --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
5
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
40 1 ! 220.9 3.3 6.4e-70 6.4e-70 2 149 .] 2 148 .. 1 148 [. 0.99
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
41
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
42 Alignments for each domain:
5
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
43 == domain 1 score: 220.9 bits; conditional E-value: 6.4e-70
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
44 dataset_a435d3bd-3e95-4c54-859f-736e9bc413b2 2 vLseaektkvkavWakveadveevGadiLvrlfvsyPetqefFekFkdLstedelkgsadvkkHgkkvldAlsdalakldekleaelkaLselHakklkvdpkyfkllsevlvvvlaarlpkeftadvqaaleKllalvakalaskYk 149
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
45 vLse+e++ v++vWakveadv+++G+diL+rlf+s+Pet+e+F++Fk+L+te+e+k+s+d+kkHg++vl+Al+++l+k ++++eaelk+L+++Ha+k+k+++ky++++se++++vl++r+p++f+ad+q+a++K+l+l++k++a+kYk
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
46 sp|P02185|MYG_PHYCD 2 VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 148
b4fe2f703b4b "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7d31599a80c15f11ed00b2b3cbfb77ed6dfc8f3d"
iuc
parents: 4
diff changeset
47 8*****************************************************************************.99******************************************************************7 PP
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
48
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
49
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
50
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
51 Internal pipeline statistics summary:
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
52 -------------------------------------
4
be0cc39776f9 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
53 Query model(s): 1 (149 nodes)
be0cc39776f9 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 7c3ac4ad5a64b737e1b8f73c522e006097596f1d
iuc
parents: 0
diff changeset
54 Target sequences: 2 (301 residues searched)
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
55 Passed MSV filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
56 Passed bias filter: 2 (1); expected 0.0 (0.02)
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
57 Passed Vit filter: 2 (1); expected 0.0 (0.001)
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
58 Passed Fwd filter: 2 (1); expected 0.0 (1e-05)
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
59 Initial search space (Z): 2 [actual number of targets]
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
60 Domain search space (domZ): 2 [number of targets reported over threshold]
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
61 # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
7
b28e8ed99424 "planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 0bccf5220ed6549db7e053f85bbe917326b0a0be"
iuc
parents: 5
diff changeset
62 # Mc/sec: 34.40
0
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
63 //
f239ab5f45f4 planemo upload for repository https://github.com/galaxyproject/tools-iuc/tree/master/tools/hmmer3 commit 4261b86af790a3535c0b9a8122f92225f8f67b47
iuc
parents:
diff changeset
64 [ok]